BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N14 (845 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 38 0.010 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 35 0.071 12_02_1174 - 26696869-26698191 35 0.094 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 35 0.094 07_01_0080 + 587674-588510 35 0.094 06_03_0790 - 24636805-24637770 35 0.094 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 35 0.094 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 34 0.12 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 34 0.12 03_05_0576 + 25765137-25766420 34 0.16 08_01_0059 - 394001-394708 33 0.29 07_03_0560 + 19479597-19480667 33 0.29 07_03_0177 - 14770777-14772045 33 0.29 03_01_0515 - 3864796-3865425 33 0.29 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.38 07_03_1751 - 29215074-29216270 33 0.38 03_02_0765 + 11000724-11002496 32 0.50 11_06_0610 - 25449085-25453284 32 0.66 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 0.87 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 0.87 02_02_0444 + 10340927-10341063,10341157-10341241,10341480-103415... 31 0.87 01_01_0070 - 542603-542686,542803-543441 31 0.87 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.2 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 31 1.2 06_02_0175 - 12624608-12625297 31 1.2 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.2 07_03_1160 - 24430240-24431268 31 1.5 05_01_0142 - 940421-940701,941262-941574 31 1.5 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 31 1.5 02_04_0400 - 22608519-22608844,22609044-22609122 31 1.5 02_03_0120 + 15463163-15465250 31 1.5 12_02_0848 + 23636478-23638058 30 2.0 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 30 2.0 06_01_0486 - 3455030-3455770 30 2.0 12_02_0306 + 17307166-17309091 30 2.7 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 30 2.7 11_01_0621 - 4981070-4981136,4982906-4983825 30 2.7 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 30 2.7 07_01_0516 - 3850252-3852870 30 2.7 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 30 2.7 03_05_0737 + 27258320-27259007,27259263-27259435,27262684-272627... 30 2.7 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 30 2.7 01_05_0490 + 22672241-22674679 30 2.7 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 2.7 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 3.5 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 3.5 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 29 3.5 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 3.5 02_02_0582 - 11798252-11798908 29 3.5 02_02_0240 + 8196140-8198248,8198381-8198650 29 3.5 10_08_0216 - 15942379-15942852,15942956-15943033 29 4.7 07_03_0559 + 19475893-19476783 29 4.7 04_03_1022 - 21778315-21779007 29 4.7 01_06_0046 + 25943183-25943590 29 4.7 12_01_0838 - 7830944-7831444 29 6.2 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 6.2 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 29 6.2 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 6.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 6.2 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 29 6.2 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 29 6.2 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 29 6.2 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 6.2 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 28 8.1 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 28 8.1 08_02_1334 - 26224546-26225337 28 8.1 08_02_1256 + 25645085-25645396 28 8.1 08_02_1084 - 24232968-24234779 28 8.1 08_02_0743 - 20647440-20647927,20647997-20648426,20650127-206505... 28 8.1 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 28 8.1 08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572,460... 28 8.1 07_03_1533 + 27523811-27524710 28 8.1 07_03_1136 + 24218601-24218734,24218769-24219906 28 8.1 07_01_0788 - 6140512-6140659,6140744-6140808,6141691-6141799,614... 28 8.1 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 28 8.1 04_01_0197 + 2323790-2324098,2324145-2324774 28 8.1 03_06_0297 - 32924162-32924605 28 8.1 02_04_0021 + 18975992-18976408 28 8.1 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 28 8.1 01_02_0031 + 10364487-10365407 28 8.1 01_01_0570 - 4231100-4232560 28 8.1 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PK PP PP PPPP PP P PP P PP Sbjct: 319 PKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPP-PPPKGPSPP 365 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPP-----PXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P K PP PP PPP P PP P PP G P PP Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP PP PP PP A P PP P Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPP 347 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP PP G PP Sbjct: 344 PPPPPPAKGPPPPP---PPKGPSPPPPPPPGGKKGGPPPP 380 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPP P A P P P + PP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPP 354 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 522 PPXXXXPPPPXX--XPPXPXLXXXPXXXGXXPSXSXPPNXXG 641 PP PPPP PP P P PS PP G Sbjct: 331 PPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGG 372 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 4/44 (9%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXP----XXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP PP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPP 379 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGV 665 PP PPPP P P P P P P + GV Sbjct: 348 PPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPGV 395 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 35.1 bits (77), Expect = 0.071 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP PP PL PP Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPP 1193 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP P P PP P PP Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P PP PL PP Sbjct: 1169 PPPPPPLSPSLPPPPPPPP--LPSGPPPQPAPPPLPIQPP 1206 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPPP P P PP P PP Sbjct: 1172 PPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPP 1211 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 P G P P P PP PP A P PP P PP GP Sbjct: 1141 PLPEGPPPLPSDSPPCQPPLPPS--PPPATPPPPPPLSPSLPPPPPPPPLPSGP 1192 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP PPP PP P P P S PP P Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Frame = +3 Query: 522 PPXXXXPPPP-----XXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVACLXY*G 686 PP PPPP PP P L P P P P V + L Y Sbjct: 1165 PPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQP 1224 Query: 687 PYP 695 P P Sbjct: 1225 PAP 1227 >12_02_1174 - 26696869-26698191 Length = 440 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P+ R PP PP PPP PP P PP Sbjct: 129 PRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPP 164 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP P PP PP P PP P PP Sbjct: 155 PPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPP 194 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P R P PP PPPP PP P P P + PP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPV-VQPKPQPPP 183 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P + P PP PPPP PP P P P + P Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPP 188 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PP P PP P PP P + PP Sbjct: 177 PKPQPPPSLQPPSPPPPPPTRPPSVKPPV--VQPKPQPPP 214 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPP---PXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPP P PP P PP P PP Sbjct: 183 PSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPP 225 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP PP P PP Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PPPP PP P PP Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPP 451 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXE 619 PP PP PPPP PP P PP P E Sbjct: 425 PP--PPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPE 459 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 539 PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PPPP PP P PP P PP Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 >07_01_0080 + 587674-588510 Length = 278 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP PP P PP Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPP PP P PP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXL 597 PP +PPPP P PP PP L Sbjct: 97 PPPSSGSPPPPPPPPPPPPPPPPPPL 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 491 KRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXP 589 +R PP P PPPP PP P P Sbjct: 89 RRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >06_03_0790 - 24636805-24637770 Length = 321 Score = 34.7 bits (76), Expect = 0.094 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 648 WGPXXY*GGXSXRGXXPQXGGXXXGXAXGGXXXGGGGXXKXGGXXGG 508 WG GG G GG G GG GGGG GG GG Sbjct: 77 WGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 629 RGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 R +LRG G GG GG G GGGG GG Sbjct: 70 RHTSLRGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGG 106 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG +GG G GGGG GG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P+K+ PP PP P PP P A P PP Sbjct: 115 PRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPP 150 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +2 Query: 437 KXPXXXGXFX*XXXXXPKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLX 616 K P G P+ PP PP PPPP P P PP G Sbjct: 249 KPPAAPGTLPNGSGGPPRPPPPQVPP--PPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPP 306 Query: 617 EXPP*XXXGP 646 PP GP Sbjct: 307 PPPPPLANGP 316 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXLXGXXXXXXXXLIXXGPP 648 PP PPPP PP PP + G + GPP Sbjct: 275 PPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP PP PPPP PP P P G P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P PP PPPP PP P PP P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXP 577 PK PP PP PPPP PP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PPPP PP P PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPP 376 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PP PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 507 NXXXXPPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 N P PPPP PP P P P PP GAP Sbjct: 343 NATSDAPKLMPPPPPPPPPPPP----PPPPPPPRPPPPPPPIKKGAP 385 >03_05_0576 + 25765137-25766420 Length = 427 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP PP A P P E PP Sbjct: 77 PSPPPQPSSPPPPPPSPPPAAAVSVSPPTQPRPRPELPP 115 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 488 KKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 K+ G PP P PPP P P PP Sbjct: 61 KRGGPEAPPSPSPSPSPSPPPQPSSPPPPPPSPPP 95 >08_01_0059 - 394001-394708 Length = 235 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P R PP PP PPP PP + P PP P PP Sbjct: 5 PPPRRAPPPPATPP----PPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPP---PXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP P PP + P PP P PP Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPP 68 Score = 31.5 bits (68), Expect = 0.87 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 485 PKKRGXXXP--PXXPPXXXXPPP--PXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P +R P P PP PPP P PP P P PL PP Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP PP P PP P+ PP Sbjct: 2 PPPPPPRRAPPPPATPPP--PPRRAPPPPS-PPIRPPPP 37 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVA 668 PP PPPP PP P P P P P S +A Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLA 53 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP--XAXPXXXPPXXGXXPLXEXP 625 PP PP PPP PP A P PP P P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRP 42 >07_03_0560 + 19479597-19480667 Length = 356 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG + GG G G GG +GG G GGGG GG Sbjct: 253 GGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGG 295 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG GG G G GG KGG G GGGG Sbjct: 82 GGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGG 117 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXG 522 GG GG L G G GG GG G GGG G Sbjct: 114 GGGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGG 155 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 G + GG+ G G GG GG G GGGG Sbjct: 151 GAGGGVGGGSGTGGGLGGGGGGGFGGDGGGGLGGGG 186 >07_03_0177 - 14770777-14772045 Length = 422 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG KGG G GGGG GG Sbjct: 369 GGGGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGG 411 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG GG G GP GG KGG G G GG Sbjct: 148 GGGFGKGGGLGGGIGPGIGGGYGKGGGLGGGIGKGG 183 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 614 RGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 +G G GG KGG G GGGG GG Sbjct: 51 KGLGAGLGGGYGKGGGFGGGGGGGGGGGFGGG 82 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -1 Query: 629 RGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 +GG G G GG GG GGGG+ GG Sbjct: 63 KGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGG 99 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXX--PPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P G PP PP PPPP PP P PP P P Sbjct: 63 PPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 31.9 bits (69), Expect = 0.66 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = +2 Query: 383 PXXXXPXXCPPFFSXXXXKXPXXXGXFX*XXXXXPKKRGXXXPPXXPPXXXXPPPPXXXP 562 P P P S P G P PP PP PPPP P Sbjct: 43 PTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPP---PPPPPAASP 99 Query: 563 PXAXPXXXPPXXGXXPLXEXPP 628 P P PP P+ PP Sbjct: 100 PPPPPSPPPP----SPVKSSPP 117 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPP 591 PP +PPPP P PP PP Sbjct: 54 PPSVTSSPPPPAAGPLMPPPPPPP 77 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPL 613 PP P PPPP PP PP P+ Sbjct: 91 PPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSPV 125 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 32.7 bits (71), Expect = 0.38 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +2 Query: 410 PPFFSXXXXKXPXXXGXFX*XXXXXPKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXP 589 PP FS P F P P P PPPP PP + P P Sbjct: 281 PPIFSPPSPPPPPPPA-FPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFPWPFP 339 Query: 590 PXXGXXPLXEXPP 628 P P PP Sbjct: 340 PLAPLFPPYPSPP 352 >07_03_1751 - 29215074-29216270 Length = 398 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG I GG G G G KGG G GGGG GG Sbjct: 274 GGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGG 316 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGG-GVXXXXGG 519 GG + GG G G GG GG G GGG GV GG Sbjct: 164 GGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGG 207 >03_02_0765 + 11000724-11002496 Length = 590 Score = 32.3 bits (70), Expect = 0.50 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = -1 Query: 665 HXPXXXGGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 H GG +GG L G G GG GG G GGG+ GG Sbjct: 70 HGGGLGGGFGGGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGG 118 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG GG G GGGG GG Sbjct: 541 GGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGGGGFGGG 583 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG + GG G G GG GG G GGGG Sbjct: 209 GGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGG 244 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG + GG G G GG GG G GGG GG Sbjct: 159 GGGGGLGGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGG 201 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 G + GG G G GG GG G GGGG Sbjct: 267 GAGGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGGG 302 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P + PP PP PPP PP P PP G P P Sbjct: 859 PPEAHVSSPP--PPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTP 903 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PP P+ PP Sbjct: 1152 PPPPAPVILPPPPIKSPPPPAPVISPP----PPVKSPPP 1186 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PP P+ PP Sbjct: 1168 PPPPAPVISPPPPVKSPPPPAPVILPP----PPVKSPPP 1202 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PP P+ PP Sbjct: 1184 PPPPAPVILPPPPVKSPPPPAPVISPP----PPVKSPPP 1218 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PP P+ PP Sbjct: 1200 PPPPAPVISPPPPVKSPPPPAPVILPP----PPVKSPPP 1234 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P P PPPP PP P PP P P Sbjct: 1216 PPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAP 1253 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 512 PXXPPXXXX-PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP PP P PP P+ PP Sbjct: 1135 PLPPPVPVSSPPPPEKSPPPPAPVILPP----PPIKSPPP 1170 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPP PP P PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP P PPP PP P PP P Sbjct: 32 PPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 509 PPXXPPXXXXP--PPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP PP PPP PP + P PP P P Sbjct: 93 PPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP PPPP PP P L P P P+ P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLP 390 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P + P P PPP PP P PP P PP Sbjct: 330 PDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PP PPP P P PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP PP PPPP P PP P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 5/45 (11%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXX-----PPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P P P PP Sbjct: 352 PPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPP 396 >02_02_0444 + 10340927-10341063,10341157-10341241,10341480-10341537, 10343738-10345885,10345943-10346388 Length = 957 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 632 IRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGGXXXV 507 + GG L G G GG +GG G GG V GG V Sbjct: 550 VEGGGLDGGGKVLGGGLDEGGGGGWLYDGGTVGGLDGGGDVV 591 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P P PPPP PP P PP P P Sbjct: 82 PPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPP 119 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPP--PPXXXPPXAXPXXXPPXXGXXPL 613 P + PP PP PP PP PP A P P P+ Sbjct: 85 PTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPPV 129 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP P P PP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PPPP P P PP Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGPPPPPPP 947 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXG 601 P+ G PP P PPPP PP P PP G Sbjct: 133 PRGPGQEPPPPHVPKAAPPPPP--PPPPHAPPGPPPTKG 169 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PK +G P PP PPPP P P PP P PP Sbjct: 211 PKLKG---PKGAPP----PPPPPPPSPHRHPAAHPPPPPHHPAPRPPP 251 >06_02_0175 - 12624608-12625297 Length = 229 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -3 Query: 717 DPGXGXWXGKGXXXXXXXXXXXXWGPXXY*GGXSXRGXXPQXGGXXXGXAXGGXXXGGGG 538 D G G G G WG GG G GG G GG GGGG Sbjct: 64 DGGGGGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -3 Query: 711 GXGXWXGKGXXXXXXXXXXXXWGPXXY*GGXSXRGXXPQXGGXXXGXAXGGXXXGGGG 538 G G G WG GG S G GG G GG GGGG Sbjct: 68 GGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPP-XXXPPXAXPXXXPPXXGXXPLXEXP 625 P +R PP PP PPPP P P PP P P Sbjct: 81 PPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPPTPTP 128 >07_03_1160 - 24430240-24431268 Length = 342 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXP-PXXGXXPLXEXPP 628 PK G PP P P P PP P P P P + PP Sbjct: 92 PKPDGPPIPPVQPCPDQPPQPKPDGPPLPNPNQPPQPNPNGPPKPDMPP 140 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 P +G PP PPPP PP P PP G P Sbjct: 30 PPHQGYPPQGYPPPPGAYPPPPGAYPP--PPGAYPPPPGAYP 69 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +3 Query: 525 PXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVACLXY--*GPYPP 698 P PPPP PP P P P + PP G P G Y G YPP Sbjct: 36 PPQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQ-HGYPQPGGYPPPGGYPQHGGYPP 94 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 494 RGXXXPP--XXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 +G PP PP PPPP PP P PP G PP Sbjct: 38 QGYPPPPGAYPPPPGAYPPPPGAYPP--PPGAYPPQHGYPQPGGYPP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 6/54 (11%) Frame = +2 Query: 485 PKKRGXXXPPXX---PPXXXXPPPPXXXPP---XAXPXXXPPXXGXXPLXEXPP 628 P G PP PP PPPP PP P PP G PP Sbjct: 41 PPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPPGGYPQHGGYPP 94 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXP 577 PP PP PPPP PP P Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPP 108 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG +GG G GGGG GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG RGG G G GG GG G GGG GG Sbjct: 58 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 >02_03_0120 + 15463163-15465250 Length = 695 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 457 GFPXKXXXXPKKKGXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 GFP P K PP PPPP P PP PP Sbjct: 276 GFPNSSYAPPPTK---YIGPMPPNNQPLPPPPSPSPSPPPPSPPP 317 >12_02_0848 + 23636478-23638058 Length = 526 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P +R PP P PPPP PP P P Sbjct: 56 PVQRAGDTPPPPPIIDASPPPPSTSPPPPPPRRGRP 91 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP P P P A P P G P PP Sbjct: 41 PPFAPPGGNGPVPSSIRAPQAPPPGARPFPGSPPPPSQPP 80 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXP--PXAXPXXXPPXXGXXPLXEXPP 628 PP PP P PP P P + P PP P PP Sbjct: 109 PPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPP 150 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXP---PXAXPXXXPPXXGXXPLXEXPP 628 PP PP P PP P P P PP P PP Sbjct: 97 PPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPP 139 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXP---PXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP P P P P PP P PP Sbjct: 77 PPYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPP 119 >12_02_0306 + 17307166-17309091 Length = 641 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 626 GGTLRGXGPXXX--GGXXKGGXXGXXXGGGGVXXXXGG 519 GGTL G G GG GG GGGG+ GG Sbjct: 538 GGTLCGGGARGGAPGGVGSGGGVALTGGGGGIVCGGGG 575 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 626 GGTLRGXGPXXX-GGXXKGGXXGXXXGGGGVXXXXGGXXXV 507 G +L G G GG +GG G GGGV GG V Sbjct: 530 GSSLTGDGGGTLCGGGARGGAPGGVGSGGGVALTGGGGGIV 570 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 490 KKGXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 KK PP TPPP P PP PP Sbjct: 108 KKDKRKEIPPPPPLAETPPPMNERPPTPPPVQPP 141 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 491 KRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 KR PP PP PPP PP P PP Sbjct: 111 KRKEIPPP--PPLAETPPPMNERPPTPPPVQPPP 142 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXA 571 PP PP PPPP PP A Sbjct: 127 PPPPPPHPLPPPPPTPPPPTA 147 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 2/81 (2%) Frame = +2 Query: 353 GGGKKNFX--GEPXXXXPXXCPPFFSXXXXKXPXXXGXFX*XXXXXPKKRGXXXPPXXPP 526 GGG F G P P C P S P P P PP Sbjct: 25 GGGYDIFATYGSPIPPSPTTCYPVSSAAPTAPPPKPSPTPPPASPPPAPTPPQTRPPSPP 84 Query: 527 XXXXPPPPXXXPPXAXPXXXP 589 P P PP A P P Sbjct: 85 PQQQQPRPVSPPPVAEPYYWP 105 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 509 PPXXPPXXXX-PPPPXXXPPXAXPXXXPP 592 PP PP PPPP PP P PP Sbjct: 16 PPQPPPTSRPLPPPPPPPPPAHGPSPPPP 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXLXG 603 PP PPP P PP PP G Sbjct: 11 PPRLLPPQPPPTSRPLPPPPPPPPPAHG 38 >04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 Length = 676 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PPPP PP P PP G P PP Sbjct: 479 PPRDNASSWAPPPPRGNPPSWVP-LPPPPGGNAPSWVPPP 517 >03_05_0737 + 27258320-27259007,27259263-27259435,27262684-27262758, 27262832-27263296 Length = 466 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 629 RGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 RGG RG G +GG G GGGG GG Sbjct: 359 RGGGGRGGGRRGYQNGGRGGRGGRGMGGGGYQNGRGG 395 >02_02_0663 - 12740733-12741104,12741260-12741326,12741709-12741809, 12741852-12742273,12743678-12743685,12745164-12745396 Length = 400 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PPPP P A P PP Sbjct: 43 PRWEPPPYLPPPPPYPIPQPARPRAAPP 70 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/72 (29%), Positives = 24/72 (33%) Frame = +3 Query: 489 KKGGXXNXXXXPPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVA 668 KKGG + PPPP PP P P+ PP P A Sbjct: 624 KKGGSKSRRIHSVAPPQPPPP--PPPTTRRSRKPPQPPSRPAPPPPPPPQQQPPFYPRRA 681 Query: 669 CLXY*GPYPPXS 704 + Y P PP S Sbjct: 682 VVYYTYPLPPPS 693 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 626 GGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG G G GG +GG G GGGG GG Sbjct: 74 GGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGG 109 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXP---XXXPPXXGXXPLXEXPP 628 PP P PPPP PP + P PP G PP Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPP 666 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXE 619 P PP PP PPPP P P PP PL + Sbjct: 537 PSPTAAAPPPPPPP----PPPPSGNKPAFSPPPPPPPPPPPPLPQ 577 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP P PPPP PP PP P P Sbjct: 608 PPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLP 646 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 525 PXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSG 659 P PPPP PP P P P S P P G Sbjct: 613 PNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPG 657 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXP--PXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 G PP P PPPP P A PP P PP GP Sbjct: 319 GAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGP 370 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXP 589 P RG PP PP PP PP P P Sbjct: 134 PYVRGATAPPPPPPPPMAVAPPPFLPPPLRPFAAP 168 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXL 597 P F PPPP P PP PP L Sbjct: 32 PFTFLCPPPPPPPPPPPPPPPPPPPL 57 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >02_02_0582 - 11798252-11798908 Length = 218 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GT RG G GG GG G G GGV GG Sbjct: 73 GGGFGGGAGTTRGGGASVGGGA--GGGVGIDVGHGGVDVGIGG 113 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +3 Query: 540 PPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSG 659 PPPP P P + P G P+ PP P + G Sbjct: 593 PPPPPPIPGQPQVIRMPGSMGPMPTNIPPPPPGQNPYMPG 632 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = -1 Query: 605 GPXXXGGXXKGGXXGXXXGGGGVXXXXGGXXXVXXXPFF 489 GP GG G G GGGG GG P++ Sbjct: 67 GPYASGGAAASGGGGGGGGGGGYGYGAGGGYGQAGGPYY 105 >07_03_0559 + 19475893-19476783 Length = 296 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 611 GXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 G G GG +GG G GGGG GG Sbjct: 63 GGGGFGGGGGFRGGGGGGLGGGGGFGGGGGG 93 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 626 GGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG G G GG KGG G G GG GG Sbjct: 167 GGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGG 202 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 G + GG+ G G GG GG G GGGG Sbjct: 146 GAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGG 181 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +2 Query: 539 PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PPPP PP P PP + PP Sbjct: 38 PPPPPPPPPYVPPHLLPPSPAPQQWYDHPP 67 >01_06_0046 + 25943183-25943590 Length = 135 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGG 662 P PPPP PP P P P PP GG Sbjct: 44 PVLYPSPPPPALPPPPPYYYYSPPPPAYYPGSYCPPPPAAYVQFGGG 90 >12_01_0838 - 7830944-7831444 Length = 166 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGGXXXV 507 GG GG+ +G G G KGG G GG G GG V Sbjct: 116 GGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGGGGGSAYV 162 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 148 PPPPPPQESTPPPPPPPPP 166 >10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 Length = 190 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPP 550 PK RG P PP PPPP Sbjct: 4 PKTRGRRSAPAPPPPPTPPPPP 25 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVA 668 P PPPP PP P L P + PP P G A Sbjct: 21 PELRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPPGAA 69 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 75 PPQTPPSPPPPPPPPPPPP 93 >06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935, 1506186-1506276,1506616-1506674,1506764-1506884, 1506959-1507027,1507321-1507373,1507688-1507796, 1507895-1508065,1508148-1508306,1508561-1508650, 1508751-1508933,1509837-1510027,1510340-1510787 Length = 713 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -1 Query: 626 GGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 G RG G GG +GG G GGGG Sbjct: 665 GSRGRGRGRGGGGGRGRGGGGGGGRGGGG 693 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PPPP PP A P PP Sbjct: 48 PPPPPQPHTAPPPP---PPNAEPEAPPP 72 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 543 PPPPPPRNMLPPPPKSMPP 561 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXP 589 PP P PPPP PP P P Sbjct: 360 PPPFAPTLPPPPPPRRKPPSPSPPSSP 386 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP P PPPP P PP G P Sbjct: 614 PPPPPRPPGAPPPPPPPGKPGGPPPPPPRPGSLP 647 >10_08_0343 - 16960764-16960895,16961166-16961171,16961272-16961640, 16962118-16962304,16962567-16962759,16962864-16963137, 16963215-16963374,16963985-16964199,16964784-16964876, 16965192-16965260,16965293-16965445,16965534-16965737, 16966416-16966691,16967336-16967431,16967585-16967788, 16967877-16968069,16968229-16968374,16968771-16969425, 16971462-16971774,16971989-16972139,16972602-16973815, 16973933-16974182,16974784-16975035 Length = 1934 Score = 28.3 bits (60), Expect = 8.1 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -1 Query: 689 RALVXQARHXPXXXGGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 RAL + GG RGG G GP G +GG GGGG Sbjct: 836 RALAPVSASAMSYRGGGGGRRGG---GGGPNSQRGRGRGGGGAGRGGGGG 882 >08_02_1334 - 26224546-26225337 Length = 263 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 Query: 491 KRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXG 601 +R P PPPP PP P PP G Sbjct: 110 RRAVSLPAPVTATPPPPPPPPETPPRQLPSVSPPTVG 146 >08_02_1256 + 25645085-25645396 Length = 103 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP P PP PP PP Sbjct: 61 PPPPPPPPPLPSPPPPPPPQQQEEQSPP 88 >08_02_1084 - 24232968-24234779 Length = 603 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPP 629 PP PP P PP L P P S PP Sbjct: 60 PPPSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPP 95 >08_02_0743 - 20647440-20647927,20647997-20648426,20650127-20650570, 20650639-20650692 Length = 471 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P KRG PP P PPP P P PP Sbjct: 86 PPKRGRGRPP--KPRDPNAPPPPPKPSSPRPRGRPP 119 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP P PL PP Sbjct: 48 PNPNPSPTLPPPPMSTPPVVAPPMHSFAPSFRPLGAPPP 86 >08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572, 4605800-4606390 Length = 300 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 591 GGXXXGXAXGGXXXGGGGXXKXGG 520 GG G A GG GGGG + GG Sbjct: 101 GGGGGGGAAGGGGRGGGGDEEMGG 124 >07_03_1533 + 27523811-27524710 Length = 299 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG GG G G GG GG G GGGG Sbjct: 86 GGDDDGGGGGGGGGGGGGGGGDDSGGDDGGGGGGGG 121 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GGP GG G GP G GG G GGGG Sbjct: 180 GGPGRAPGGGGGGGGPGRAPGG--GGGGGGLGGGGG 213 >07_01_0788 - 6140512-6140659,6140744-6140808,6141691-6141799, 6142630-6142775,6142978-6143043,6144131-6144223, 6144771-6144851,6144950-6145043,6145532-6145608, 6147283-6147543 Length = 379 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 626 GGTLRGXGPXXXGGXXKGGXXGXXXGGGGV 537 GG P G +GG G GGGGV Sbjct: 21 GGVASAAAPLSDGAGGRGGGGGGGGGGGGV 50 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PPPP P P PP Sbjct: 1926 PPPHAPPPPPPPPPVEGKPKPPPHAPPP 1953 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 486 QKKGGXXNXXXXPPXXXXPPPPXXXPP 566 Q +G N PP PPPP PP Sbjct: 15 QPEGSNHNHQGNPPPPPPPPPPPPPPP 41 >03_06_0297 - 32924162-32924605 Length = 147 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 494 RGXXXPPXXPPXXXXP-PPPXXXPPXAXPXXXPP 592 R PP PP P PPP P P PP Sbjct: 110 RNPDVPPPKPPELDPPRPPPEVVPEPTPPDVEPP 143 >02_04_0021 + 18975992-18976408 Length = 138 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PP P PP P PP Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PPPP PP PP P PP Sbjct: 420 PPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPP 459 >01_02_0031 + 10364487-10365407 Length = 306 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP--XXGXXPLXEXPP 628 PP PP PPPP P P PP PL PP Sbjct: 171 PPPPPPALPAPPPP---PAPMLPLAPPPTHVTPAMPLSSMPP 209 >01_01_0570 - 4231100-4232560 Length = 486 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG + GG G G GG GG G GG G Sbjct: 66 GGGVGVGGGVGGGTGGGAAGGLGGGGGGGGGLGGSG 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,214,935 Number of Sequences: 37544 Number of extensions: 390496 Number of successful extensions: 5536 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 1242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3314 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -