BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N14 (845 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 39 0.004 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.041 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 34 0.17 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.17 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 32 0.51 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.67 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 0.67 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 0.89 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 0.89 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 0.89 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.2 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 31 1.2 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 1.2 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 1.3 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.6 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.6 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 31 1.6 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 30 2.1 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 2.7 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 2.7 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 3.6 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 29 3.6 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 3.6 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 29 3.6 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 4.7 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 4.7 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 6.3 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 6.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 6.3 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 6.3 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 6.3 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 28 8.3 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP P PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP P PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P PP P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 P + PP PP PPPP PP A P PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP + P P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPPP PP P PP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP P PP P PP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P P PP P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P P PP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPPP PP P PP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P PP P PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P PP P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP P PP P PP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP PP P PP P PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPPP PP P PP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P P P PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVAC 671 PP PPPP PP P P P+ PP P + +AC Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLAC 438 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 G P PP PPP PP P PP P PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P P PP L PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 P PP PPPP PP P PP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PPPP PP PP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP PP P P P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP PPP PP P P P PP AP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 G PP PP PPPP PP P PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 34.7 bits (76), Expect = 0.095 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPL 613 G P PP PPPP PP P PP PL Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 539 PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PPPP PP P PP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 493 KGXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 +G PP PPPP P PP PP Sbjct: 458 EGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.1 bits (77), Expect = 0.072 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P PP P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP PP PPP PP P PP P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP 202 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PP P PP PP P P P PP Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 509 PPXXPPXXXXPPP-PXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP PP PPP P PP P PP P P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P P P PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPP PP P PP P PP Sbjct: 189 PPPNPPYP--PPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 522 PPXXXXPPPPXX-XPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP PPPP PP P P P PPN P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +2 Query: 485 PKKRGXXXPPXXP--PXXXXPPPPXXXPPXA---XPXXXPPXXGXXPLXEXPP 628 P PP P P PPPP PP A P PP P PP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP P PP PP P P P PPN P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 509 PPXXPPXXXXPP-PPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP PP PP P P P PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP PPPP PP P P P PPN P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPP-----NPPYPPPPNAPNPP 205 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXA-XPXXXPPXXGXXPLXEXPP 628 PP P P PP PP A P PP P PP Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 521 PPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PP PP P PP P PP Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Score = 29.1 bits (62), Expect = 4.7 Identities = 22/90 (24%), Positives = 23/90 (25%), Gaps = 1/90 (1%) Frame = +3 Query: 381 NPXXXXPXXAPHFFXPXXXXPXXXGGXSXKXXXXXQKKGGXXNXXXXPPXXXXPP-PPXX 557 NP P AP+ P P N PP PP PP Sbjct: 129 NPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYP 188 Query: 558 XPPXPXLXXXPXXXGXXPSXSXPPNXXGAP 647 PP P P P P AP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/44 (27%), Positives = 14/44 (31%) Frame = +1 Query: 460 FPXKXXXXPKKKGXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 +P P PP + P PP P PP PP Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP P PP P PP P PP P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P+ + PP PP PP P PP P PP P + PP Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPI--DPPRTQPPP 222 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PP P PP P PP P + PP Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPI--DPPRTQPPP 209 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P P PP PL P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLP 246 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P P PPPP PP + P PP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP P P P PP L E PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP PP PPP PP P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PP PPPP P A PP P PP Sbjct: 222 PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP P PPPP P + P PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 G PP PP P P P + P PP G P PP Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 32.3 bits (70), Expect = 0.51 Identities = 25/92 (27%), Positives = 26/92 (28%) Frame = +2 Query: 353 GGGKKNFXGEPXXXXPXXCPPFFSXXXXKXPXXXGXFX*XXXXXPKKRGXXXPPXXPPXX 532 GG + P P PP P G P G PP PP Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGS---APSQPPPPGGNAPPPPPPPGG 961 Query: 533 XXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PPP PP PP G P PP Sbjct: 962 SAPPPGGGAPP-----LPPPPGGSAPPPPPPP 988 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +3 Query: 486 QKKGGXXNXXXXPPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPP--NXXGAPXVSG 659 Q GG + PP PPPP P P G PS PP N P G Sbjct: 902 QTPGGSESPSASPPGGSVPPPPPP-PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG 960 Query: 660 GVA 668 G A Sbjct: 961 GSA 963 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXP 577 P G P PP PPPP PP P Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 32.3 bits (70), Expect = 0.51 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP P + P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP PP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP P P PP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXE 619 P PP PPPP PP PP P+ + Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQ 718 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 540 PPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGG 662 PPPP PP P P P + P GAP G Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAG 727 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 PP PP PPP PP P P P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 32.3 bits (70), Expect = 0.51 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 629 RGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 RGG+ RG G GG GG G GGGG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.9 bits (69), Expect = 0.67 Identities = 32/120 (26%), Positives = 33/120 (27%), Gaps = 3/120 (2%) Frame = +3 Query: 312 GXP-PQGPRGFXXXGVGXKKIXXGNPXXXXPXXAPHFFXPXXXXPXXXGGXSXKXXXXXQ 488 G P P GP GF G G P P P F P G Sbjct: 43 GPPGPDGPPGFP--GPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVN 100 Query: 489 KKGGXXNXXXXPPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXS--XPPNXXGAPXVSGG 662 G PP PP P P P L P G + PP G P GG Sbjct: 101 GPPGELGDMG-PPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGG 159 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +3 Query: 540 PPPPXXXPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGGVACLXY*GP 689 PPPP PP P P P P G P + G + GP Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGP 80 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/64 (32%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXX-PSXSX-PPNXXGAPXVSGGVACLXY*GPYP 695 PP PP P P P P G P+ PP G +GGV C + G P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGNAGGVGCQGHHG-NP 764 Query: 696 PXSQ 707 SQ Sbjct: 765 AGSQ 768 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P P P P + PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGP--KGPP 66 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXS--XPPNXXGAPXVSGG 662 PP PP P P P L P G + PP G P GG Sbjct: 281 PPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 329 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXS--XPPNXXGAPXVSGG 662 PP PP P P P L P G + PP G P GG Sbjct: 366 PPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 414 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXX-PSXSX-PPNXXGAPXVSGGVAC 671 PP PP P P P P G P+ PP G +GGV C Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGC 842 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 509 PPXXPPXXXXPP---PPXXXPPXAXPXXXPPXXGXXPLXEXP 625 PP PP PP PP PP P P G P+ P Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPP---PPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PP PP PP P P G P P Sbjct: 2180 PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.67 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PPPP PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXL 597 PP PPPP P PP PP + Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPI 121 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P P PPPP PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP PP G P PP Sbjct: 305 PPPPPPGGAPPPPPPPPPP-------PPGDGGAPPPPPPP 337 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPP--PXXXPPXAXPXXXPP 592 PP PP PPP P PP A P PP Sbjct: 77 PPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 509 PPXXPPXXXXPPP-PXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP P PP P PP P PP P + PP Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP P PP A P PP PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.5 bits (68), Expect = 0.89 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +2 Query: 497 GXXXPPXXPPXXXX----PPPPXXXPPXAXPXXXPPXXGXXPLXEXP 625 G PP PP PPPP P A P PP G P P Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 0.89 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG + GG G G GG G G GGGG GG Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 286 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 258 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.5 bits (68), Expect = 0.89 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Frame = +2 Query: 485 PKKRGXXXPPXX----PPXXXXPPPPXXXPPXAXPXXXPPXXGXXP---LXEXPP 628 P RG PP PP PPP PP P PP P L PP Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXX--PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 P + G PP P PPP PP PP G PP GP Sbjct: 319 PARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 520 PPXFXXTPPPPXXXPXXPPXXXPPXLXG 603 PP PPPP P P PP + G Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEG 383 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PPPP P P PP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 G PP P PPP PP P P G P PP Sbjct: 239 GAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPP 282 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXX--PPXAXPXXXPPXXGXXPLXEXPP 628 P G PP P PPP PP + P PP G + PP Sbjct: 63 PGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPP 112 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 629 RGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 RGG G G GG GG G GGGG GG Sbjct: 166 RGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 24.6 bits (51), Expect(2) = 1.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP P PPPP PP Sbjct: 908 PPPPLPLAPEPPPPLPPPP 926 Score = 24.6 bits (51), Expect(2) = 1.3 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +2 Query: 539 PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PPPP P P P PL PP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXP---XXXPPXXGXXPLXEXPP 628 PP PPPP PP P PP G P+ PP Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +2 Query: 509 PPXXPPXXXX--PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 PP PP PPPP P P PP P P GP Sbjct: 1242 PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P R PP PPPP P PP PL PP Sbjct: 198 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 454 GGFPXKXXXXPKKK---GXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 GG P +K G PP F T PPP PP PP Sbjct: 100 GGMPKLRPAGERKAAGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPP 148 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXG--XXPLXEXPP 628 PP PPPP PP + PP G PL PP Sbjct: 332 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 373 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P R PP PPPP P PP PL PP Sbjct: 110 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 454 GGFPXKXXXXPKKK---GXXXTXXXPPXFXXTPPPPXXXPXXPPXXXPP 591 GG P +K G PP F T PPP PP PP Sbjct: 12 GGMPKLRPAGERKAAGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPP 60 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXG--XXPLXEXPP 628 PP PPPP PP + PP G PL PP Sbjct: 244 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 285 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPS 614 PP PPPP PP P P G P+ Sbjct: 83 PPPIYMPPPPVYMPPPPVYMPPPMPMGDVPA 113 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 665 HXPXXXGGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 H GG GG G G GG G G GGGG GG Sbjct: 46 HGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGGVXXXXGG 519 GG GG G G GG G G GGGG GG Sbjct: 66 GGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 P+ R PP PP PPPP PP A P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP--PPPPASSTGSTPGGDKVP 899 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXX-PPPPXXXPPXAXPXXXP 589 P G PP PP PPPP PP P P Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPP--XXXPPXAXPXXXPPXXGXXPLXEXP 625 PP PP PPPP PP P P G P P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSP 496 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 522 PPXXXXPPPPXX--XPPXPXLXXXPXXXGXXPSXSXPPNXXGAPXVSGG 662 PP PPPP PP P P G P + P P S G Sbjct: 460 PPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNG 508 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 680 VXQARHXPXXXGGPXXIRGGTLRGXGPXXXGGXXKGG-XXGXXXGGGGVXXXXGG 519 V QAR GG RGG R G GG GG G GGGG GG Sbjct: 302 VNQARSREQRGGG----RGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 509 PPXXPPXXXXPPPP--XXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P P P PP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 509 PPXXPPXXXX---PPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 PP PP PPPP PP P P P PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 P PP P PPPP P P PP G P PP GP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPP---PTNGPPPPPPPTNGPPP----PPPPTNGP 404 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 485 PKKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP*XXXGP 646 P PP P PPPP P P PP G P PP GP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPP---PTNGPPPPPPPTNGPPP----PPPPTNGP 414 Score = 28.7 bits (61), Expect = 6.3 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +2 Query: 353 GGGKKNFXGEPXXXXPXXCPPFFSXXXXKXPXXXGXFX*XXXXXPKKRGXXXPPXXPPXX 532 GGG N P P PP + P P G PP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNK-----PPPPPPPTNGPPPPPPPTNGP 394 Query: 533 XXPPPP-XXXPPXAXPXXXPPXXG 601 PPPP PP P PP G Sbjct: 395 PPPPPPTNGPPPPPPPTNGPPSEG 418 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXX-KGGXXGXXXGGGGVXXXXGG 519 GG GG RG G GG GG G GGGG GG Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +2 Query: 485 PKKRGXXXPPXX--PPXXXXPPPPXXXPPXAXPXXXPP 592 P G PP PP PPPP P P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 488 KKRGXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXP 610 K G PP PP PPPP PP P PP P Sbjct: 115 KYLGGYVPPP-PPTGTLPPPPVTPPP--GPETPPPPDTPAP 152 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 360 PPPLXXKXPLXPGGGGXXTGXXGSKSNKXAXHGGXP 253 PP L + P+ P GGG G + + GG P Sbjct: 14 PPNLPKQLPIPPAGGGEGDGKDKDDAKREGGKGGKP 49 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +2 Query: 494 RGXXXPPXX--PPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 RG PP PP PPPP PP PP P + P Sbjct: 466 RGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMP 512 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 522 PPXXXXPPPPXXXPPXPXLXXXPXXXGXXPSXSXPP 629 PP PPP PP P P G P PP Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPP 505 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 497 GXXXPPXXPPXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 G PP PP PPP PP P P P PP Sbjct: 175 GILAPPPAPPGVLAPPP---APPGVLPPPPAPPGALIPPPPAPP 215 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPPXXG 601 PP P PPPP PP PP G Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPPG 220 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PPPP P P PP Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP P PPPP P P PP Sbjct: 142 PPIAPATGGPPPPPPIAPATGGPPPPPP 169 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 647 GGPXXIRGGTLRGXGPXXXGGXXKGGXXGXXXGGGG 540 GG +GG G G GG GG G GGGG Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGG 228 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 497 GXXXPPXXPPXXXXP-PPPXXXPPXAXPXXXP 589 G PP PP P PPP PP P P Sbjct: 426 GTATPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 28.7 bits (61), Expect = 6.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 509 PPXXPPXXX--XPPPPXXXPPXA--XPXXXPPXXGXXPLXEXPP 628 PP PP PPPP P A P PP G L PP Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 64 PPTLPPPPPPPPPPLPPPP 82 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 524 PXXXXPPPPXXXPPXAXPXXXPPXXGXXPLXEXPP 628 P PPPP PP P PP P PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPP-PPPFGAPPP 223 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 288 PPTLPPPPPPPPPPLPPPP 306 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXPXXXPP 592 P PP PPP PP P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 1163 PPPPPPSSPSPPPPPPPPP 1181 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPPXAXPXXXPP 592 PP PP PP PP P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PPXXPPXXXXPPPPXXXPP 565 PP PP PPPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPP 1325 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 512 PXXPPXXXXPPPPXXXPPXAXP 577 P PP PPPP PP + P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 488 KKRGXXXPPXXPPXXXXPPPPXXXP 562 ++R PP PP PPPP P Sbjct: 417 RRRSLVQPPPPPPPAPLPPPPPPPP 441 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,185,256 Number of Sequences: 59808 Number of extensions: 281905 Number of successful extensions: 2862 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1380 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -