BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N06 (955 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0360 + 43056226-43057566 29 5.5 01_06_1536 + 38075023-38075359,38075834-38075963,38076204-380764... 28 9.5 01_01_0099 - 751627-752126,752866-753056,753188-753945 28 9.5 >01_07_0360 + 43056226-43057566 Length = 446 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 Query: 176 RECTKHVCGSCYLKSCCATRHHRPRSKQYTLKDLGFPF 289 +EC +C +C L CC H +P K L PF Sbjct: 330 KECGHQMCAACTLAICC---HSKPNPKTLLLHPPACPF 364 >01_06_1536 + 38075023-38075359,38075834-38075963,38076204-38076419, 38076520-38077137,38077226-38078075 Length = 716 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 586 HQHQSEPRVPLSPYPISLQTTCPLNHHLK---AIPXELSLSTVS 708 H Q PR PL+P+ +S++ + L H K A P EL L S Sbjct: 500 HYDQHTPRAPLNPFLLSVRCSIELLDHPKDYTAPPVELVLLPAS 543 >01_01_0099 - 751627-752126,752866-753056,753188-753945 Length = 482 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 191 VLYILVTDVVFYLVR*V*LNTACKMFTCE*YVRNATYP 78 VL +LV D + L C FTC ++RNA+YP Sbjct: 22 VLAVLVPDAGGRRHHQIQLQPECPTFTCGAHLRNASYP 59 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,271,742 Number of Sequences: 37544 Number of extensions: 500516 Number of successful extensions: 1263 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2752963900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -