BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N06 (955 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97009-1|AAC69030.2| 339|Caenorhabditis elegans Serpentine rece... 36 0.043 U97192-1|AAB52434.2| 986|Caenorhabditis elegans Hypothetical pr... 30 2.1 >U97009-1|AAC69030.2| 339|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 32 protein. Length = 339 Score = 35.9 bits (79), Expect = 0.043 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = -3 Query: 611 TLGSDWCW*ILFLVLFQSPLCLLDYRLHLRNLQLSTPRYPVCIL 480 TLG + +LFL+ F+SP CL Y + L N ++ Y +C L Sbjct: 19 TLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCICFL 62 >U97192-1|AAB52434.2| 986|Caenorhabditis elegans Hypothetical protein C01F4.2a protein. Length = 986 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 568 NTRNRIHQHQSEPRVPLSPYPISLQTTCPLNHH 666 N +++ H+S P V LSP+P +L+ HH Sbjct: 745 NHLSKMDSHESHPGVLLSPFPATLEEDSSPRHH 777 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,978,428 Number of Sequences: 27780 Number of extensions: 434388 Number of successful extensions: 1238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2475644248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -