BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N05 (963 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 113 2e-25 SB_5916| Best HMM Match : R3H (HMM E-Value=2.9e-10) 30 2.4 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 113 bits (272), Expect = 2e-25 Identities = 50/74 (67%), Positives = 63/74 (85%) Frame = +3 Query: 81 MGRYSREPDNPAKSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPF 260 M RY+ +P+NP KSCKARGSNLRVH+KNT+E AMAI+ M +R+A RYLK+V KK+ +PF Sbjct: 1 MTRYATDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVRKANRYLKDVCAKKQLVPF 60 Query: 261 RRFNGGVGRCAQAK 302 R++NGGVGR AQAK Sbjct: 61 RKYNGGVGRKAQAK 74 Score = 99.1 bits (236), Expect = 5e-21 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 325 RWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRIN 492 RWPKKSAE LLQLL+NAESNA+ K LDVD LV++HIQVN AP +RRRTYRAHGRIN Sbjct: 84 RWPKKSAEILLQLLKNAESNAEFKGLDVDSLVVEHIQVNEAPSMRRRTYRAHGRIN 139 >SB_5916| Best HMM Match : R3H (HMM E-Value=2.9e-10) Length = 798 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 362 NCKRNSADFLGQRXLCCAKLLCLS 291 +CK+N + LGQ+ +CC ++ CLS Sbjct: 712 SCKQNIS-LLGQKCVCCTRVFCLS 734 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,139,540 Number of Sequences: 59808 Number of extensions: 408346 Number of successful extensions: 903 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2836293838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -