BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N05 (963 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67430.1 68414.m07675 60S ribosomal protein L17 (RPL17B) simi... 116 3e-26 At1g27400.1 68414.m03340 60S ribosomal protein L17 (RPL17A) simi... 116 3e-26 >At1g67430.1 68414.m07675 60S ribosomal protein L17 (RPL17B) similar to ribosomal protein GI:19101 from [Hordeum vulgare] Length = 175 Score = 116 bits (278), Expect = 3e-26 Identities = 53/72 (73%), Positives = 61/72 (84%) Frame = +1 Query: 325 RWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRINPYMS 504 RWP KSA+F+L LL+NAESNA+ K LDVD L I HIQVN+A RRRTYRAHGRINPYMS Sbjct: 83 RWPAKSAQFVLDLLKNAESNAEVKGLDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMS 142 Query: 505 SPCHIEVCLSER 540 +PCHIE+ LSE+ Sbjct: 143 NPCHIELILSEK 154 Score = 107 bits (258), Expect = 8e-24 Identities = 52/74 (70%), Positives = 60/74 (81%) Frame = +3 Query: 81 MGRYSREPDNPAKSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPF 260 M +YS+EPDN KSCKARGS+LRVHFKNT ETA AIRK+PL +A RYL++VI K+ IPF Sbjct: 1 MVKYSQEPDNQTKSCKARGSDLRVHFKNTRETAHAIRKLPLIKAKRYLEDVIAHKQAIPF 60 Query: 261 RRFNGGVGRCAQAK 302 RF GVGR AQAK Sbjct: 61 TRFCRGVGRTAQAK 74 >At1g27400.1 68414.m03340 60S ribosomal protein L17 (RPL17A) similar to GB:P51413 from [Arabidopsis thaliana]; similar to ESTs gb|L33542 and gb|AA660016 Length = 176 Score = 116 bits (278), Expect = 3e-26 Identities = 53/72 (73%), Positives = 61/72 (84%) Frame = +1 Query: 325 RWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRINPYMS 504 RWP KSA+F+L LL+NAESNA+ K LDVD L I HIQVN+A RRRTYRAHGRINPYMS Sbjct: 83 RWPAKSAQFVLDLLKNAESNAEVKGLDVDALFISHIQVNQAAKQRRRTYRAHGRINPYMS 142 Query: 505 SPCHIEVCLSER 540 +PCHIE+ LSE+ Sbjct: 143 NPCHIELILSEK 154 Score = 107 bits (256), Expect = 1e-23 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = +3 Query: 81 MGRYSREPDNPAKSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPF 260 M +YS+EPDN KSCKARG++LRVHFKNT ETA AIRK+PL +A RYL++VI K+ IPF Sbjct: 1 MVKYSQEPDNITKSCKARGADLRVHFKNTRETAHAIRKLPLNKAKRYLEDVIAHKQAIPF 60 Query: 261 RRFNGGVGRCAQAK 302 RF GVGR AQAK Sbjct: 61 TRFCRGVGRTAQAK 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,102,708 Number of Sequences: 28952 Number of extensions: 282910 Number of successful extensions: 601 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -