BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N03 (928 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 4.5 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 7.8 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 7.8 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 7.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 227 PKTTTLMETATNLSTTVHITWTV 295 P TT +T T STT T TV Sbjct: 1177 PSTTNHWQTKTTTSTTTRPTTTV 1199 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 175 SGNGYEPIDNR--PYIVNPPKDYNPNGNGYE 261 S +G++ D P+IV P++ NP+ Y+ Sbjct: 179 SHSGFQRSDGTFGPFIVRVPEEDNPHAKLYD 209 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 768 SPSSXPPPPG 797 SPSS P PPG Sbjct: 273 SPSSGPAPPG 282 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +1 Query: 760 GXXPLHXXXPPPGKXPXXXGXPXXFPP 840 G P H PP G P FPP Sbjct: 59 GIPPHHYGGPPSGGQPPQGMPYPRFPP 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,946 Number of Sequences: 336 Number of extensions: 3610 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25961683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -