BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N03 (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0515 - 3864796-3865425 44 1e-04 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 40 0.003 12_02_0299 - 17051570-17052474,17053542-17053755 39 0.006 02_05_0686 - 30900748-30902167,30903442-30904742 39 0.006 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 38 0.009 08_01_0059 - 394001-394708 37 0.020 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 36 0.035 12_02_1174 - 26696869-26698191 36 0.046 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 36 0.046 01_01_0070 - 542603-542686,542803-543441 36 0.046 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 35 0.080 11_06_0610 - 25449085-25453284 35 0.11 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 35 0.11 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 35 0.11 09_02_0543 + 10427321-10428315,10428440-10429154 34 0.14 02_02_0240 + 8196140-8198248,8198381-8198650 34 0.14 06_01_0486 - 3455030-3455770 34 0.18 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 34 0.18 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 33 0.24 01_02_0007 + 10132380-10133201 33 0.24 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 33 0.32 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 33 0.43 07_01_0080 + 587674-588510 33 0.43 03_05_0067 - 20460206-20460703,20461255-20461530 33 0.43 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.43 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 32 0.56 03_02_0765 + 11000724-11002496 32 0.56 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 0.74 02_04_0400 - 22608519-22608844,22609044-22609122 32 0.74 02_04_0382 - 22501041-22501279,22501717-22501810 32 0.74 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 32 0.74 06_03_1326 - 29355467-29355817 31 0.98 06_03_0790 - 24636805-24637770 31 0.98 05_01_0142 - 940421-940701,941262-941574 31 0.98 04_04_1125 + 31085106-31085714 31 0.98 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 31 0.98 03_06_0471 + 34169562-34169892,34170121-34170347 31 0.98 08_01_0388 + 3432177-3433154 31 1.3 07_03_1433 + 26513728-26514135,26525534-26526280 31 1.3 07_03_0177 - 14770777-14772045 31 1.3 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 31 1.3 10_03_0023 - 7151465-7152111,7152222-7152405 31 1.7 09_02_0603 - 11150739-11150746,11150791-11151340 31 1.7 09_01_0037 - 604001-604957 31 1.7 07_03_0560 + 19479597-19480667 31 1.7 07_03_0558 + 19461369-19462448 31 1.7 05_07_0125 + 27861368-27862282 31 1.7 03_01_0023 + 198414-198968 31 1.7 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 1.7 12_02_1219 + 27096477-27096590,27096704-27097078 30 2.3 07_03_1432 - 26508135-26508881,26509301-26509708 30 2.3 07_03_0890 - 22332768-22333382 30 2.3 07_03_0559 + 19475893-19476783 30 2.3 07_01_0479 + 3606663-3607448 30 2.3 01_02_0031 + 10364487-10365407 30 2.3 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 3.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 3.0 03_05_0576 + 25765137-25766420 30 3.0 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 30 3.0 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 3.0 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 30 3.0 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 29 4.0 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 4.0 09_03_0145 - 12749288-12751510 29 4.0 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 29 4.0 06_02_0127 + 12140843-12140966,12141170-12141567 29 4.0 04_03_1022 - 21778315-21779007 29 4.0 04_03_0904 + 20717005-20718087 29 4.0 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 29 5.2 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 29 5.2 09_06_0081 + 20745627-20748144,20748211-20748308 29 5.2 08_02_1258 - 25670092-25670152,25671124-25671327,25671400-256716... 29 5.2 08_02_1084 - 24232968-24234779 29 5.2 08_01_0202 - 1638978-1639571 29 5.2 06_02_0175 - 12624608-12625297 29 5.2 06_01_0008 + 141405-142421 29 5.2 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 29 5.2 02_01_0158 - 1103461-1104186 29 5.2 11_01_0066 - 536281-537196,537397-537452 29 6.9 10_08_0214 - 15915156-15915713 29 6.9 07_03_1751 - 29215074-29216270 29 6.9 07_03_1636 + 28290642-28291574 29 6.9 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 29 6.9 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 29 6.9 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 29 6.9 03_02_0342 - 7645323-7645909,7646323-7646491 29 6.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 6.9 01_06_0146 + 26969011-26969995,26970878-26970930 29 6.9 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 24 7.4 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 28 9.2 11_01_0385 + 2915532-2916482 28 9.2 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 28 9.2 09_04_0180 + 15367737-15367755,15368874-15369739 28 9.2 08_02_1615 + 28257275-28258428,28258523-28259144 28 9.2 07_01_0862 - 7172083-7172931 28 9.2 06_03_0874 - 25580417-25580419,25580504-25580604,25580828-255814... 28 9.2 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 28 9.2 02_03_0388 + 18429538-18430598,18430971-18431081,18431165-184312... 28 9.2 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 28 9.2 >03_01_0515 - 3864796-3865425 Length = 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 S +S PPPP P P P P PP PP PPP P P P Sbjct: 56 SVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 + P G P PPPP P P P P PP PP PPP Sbjct: 57 VTSSPPPPAAGPLMPP-PPPPPSVTSSPPPPPLPPP-----PPPPAASPPPPPPSPPPPS 110 Query: 909 PXXPXP 926 P P Sbjct: 111 PVKSSP 116 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPX 914 P P A P+ PPP P P P P PPP P Sbjct: 31 PSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPP 90 Query: 915 XPXP 926 P P Sbjct: 91 PPPP 94 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 S +S PPPP P P P P PP P PPP P Sbjct: 78 SVTSSPPPPPLPP-----PPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 770 PFIXXXPPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P + PP S P P PPP PP P P PPP Sbjct: 68 PLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPP-PPSPVKSSPPP 118 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 6/70 (8%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPP-----PPGXXPXXPWXPXPX-PXXXXXPPXXXXXXXXPPXXX 896 P P G PS PP PP P P P P P PP PP Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPA 1197 Query: 897 PPPXPXXPXP 926 PPP P P P Sbjct: 1198 PPPLPIQPPP 1207 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXX--PPXXXPPPXPXXP 920 P++ PPPP P P P P P PP PP PPP P P Sbjct: 1166 PATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSP 1217 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPX-PXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P PP P P P P P P PP PP PPP P Sbjct: 1126 PDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPP 1173 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 783 PPPPGXXPXXPWX-PXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PP P P P P P P PP P P P P P P Sbjct: 1123 PPLPDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPP 1171 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 PP S P P P PPP PP PP PPP Sbjct: 1170 PPPPPLSPSLPPPPPPPPL---PSGPPPQPAPPPLPIQPPPIPPPP 1212 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +3 Query: 768 SPSSXPPP--PGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +P S PPP P P PW P P PP PP PPP P P P Sbjct: 251 TPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFS-----PPSPPPPPPPAFPFP 300 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP S PPPP P P+ P PP PP PPP P P Sbjct: 285 SPPSPPPPP--PPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFP 335 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/85 (27%), Positives = 25/85 (29%) Frame = +3 Query: 672 WXPXNPXXXXXXTXXSLXFIXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXX 851 W P P + F+ P P P PP P P P P P Sbjct: 214 WPPI-PFCTPRPWFPPIPFLTPPPPPFLPFPLPPIPFLTPPSPPP--PAFPFPLPPWPWA 270 Query: 852 PPXXXXXXXXPPXXXPPPXPXXPXP 926 PP PP PP P P P Sbjct: 271 PPPAFPFPHLPPIFSPPSPPPPPPP 295 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXP 836 PS PPPP P P P P P Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFP 339 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP+ PPPP P P P PP PP PPP P P Sbjct: 310 SPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGP 362 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P + P PP P P P P P PP PP PPP P Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPP---PPPPP 370 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P++ PPP P P P PP PP PP P P Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P P + P PPPP P P P PP PP PPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPP--PPPP 382 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/49 (30%), Positives = 16/49 (32%), Gaps = 3/49 (6%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXX---PPPXXXXPPRXPXPPXXXPPP 925 PP+ P P P PPP PP P P PPP Sbjct: 318 PPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPP 922 PP + P P P P PP+ P PP PP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXP--XPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PS PPP P P P P PP PP PPP P P P Sbjct: 47 PSQPPPPQAMYQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPP 100 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 Query: 791 PRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P+ S P P PP PP P PP PPP Sbjct: 61 PQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPP 105 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPP 857 P S PPPP P P P P P P Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P S PPPP P P PP PP PPP P P Sbjct: 66 PGSLPPPPPRPPSFA-PENALPPSSPPPP----SPPPPPPSSPPPVPPSP 110 >08_01_0059 - 394001-394708 Length = 235 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXP--PPXPXXP 920 PPPP P P P P P PP PP P PP P P Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHP 51 Score = 36.7 bits (81), Expect = 0.026 Identities = 22/70 (31%), Positives = 24/70 (34%), Gaps = 6/70 (8%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPX-----PXPXXXXXPPXXXXXXXXPPXXXP 899 P P P++ PPPP P P P P P PP PP P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISP 61 Query: 900 P-PXPXXPXP 926 P P P P P Sbjct: 62 PAPVPPPPSP 71 Score = 32.7 bits (71), Expect = 0.43 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P P R SP PPPP P P P PP PP PPP Sbjct: 18 PPPPRRAPPPPSPPIRPPPP-PTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 73 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 821 PXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P P + P PPP PP P PP PPP Sbjct: 40 PRPYAPPPPSHPLAPPPPHISPP-APVPPPPSPPP 73 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 821 PXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P P P PPP P P PP PPP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPP 37 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 787 PPPGKXPXXXGXPXXFPPXXPXPXXXXXXXVXPPXXXXPPXXSXPXP 927 PPP + P P PP P P P PP S P P Sbjct: 19 PPPRRAPPPPSPPIR-PPPPPTPRPYAPPPPSHPLAPPPPHISPPAP 64 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 36.3 bits (80), Expect = 0.035 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 774 SSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 SS PPPP P P P P PP PP PPP Sbjct: 582 SSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 35.9 bits (79), Expect = 0.046 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPP-GXXPXX-PWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 P P P PPPP G P P P P P P PP PPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPL 594 Query: 909 PXXPXP 926 P P Sbjct: 595 PNCLVP 600 Score = 35.5 bits (78), Expect = 0.060 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 777 SXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 S PPPP P P P P PP PP PPP P P Sbjct: 601 SPPPPPPPPPILPNRSVPPP--PPPPPPLPNHSVLPPPPPPPPPPSLP 646 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P + P PPPP P P P P PP PP PPP P Sbjct: 574 PLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP----PPPILPNRSVPPPPPPPPPLP 628 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P R G PS+ PPPP P P PP P PPP Sbjct: 699 PANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPP 753 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P PPPP P + P PP PP PPP P P Sbjct: 565 PPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPP-PPPPPPILP 613 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 7/66 (10%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPP---GXXPXXPWXPXPXPXXXXX----PPXXXXXXXXPPXX 893 P P R G +P+ PPP P P P P PP PP Sbjct: 718 PPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGT 777 Query: 894 XPPPXP 911 PPP P Sbjct: 778 VPPPPP 783 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 821 PXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P P P PPP PP+ P PP PPP Sbjct: 751 PPPPLMTGKKAPAPPPP----PPQAPKPPGTVPPP 781 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPP-RXPXPPXXXPPP 925 PP P P S P PPP P P PP PPP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPP 609 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 787 PPPGKXPXXXGXPXXFPPXXPXPXXXXXXXVXPPXXXXPPXXSXP 921 PPP P PP P P V PP PP S P Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLP 646 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 769 PLHXXXPPPGKXPXXXGXPXXFPPXXPXPXXXXXXXVXPPXXXXPPXXSXPXP 927 P H PPP P P P P P PP PP S P Sbjct: 628 PNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPA-PPPPPPPPRSSSRTP 679 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 821 PXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 P P P PPP P PP PPP Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP P R PP PPP Sbjct: 603 PPPPPPPPILPNRSVPPPPPPPPP 626 >12_02_1174 - 26696869-26698191 Length = 440 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXP---PPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P P R P P PPP P P P P PP PP PPP Sbjct: 161 PPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTL-PPP 219 Query: 906 XPXXPXP 926 P P P Sbjct: 220 SPPPPPP 226 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P S PPPP P P P P P PP PP P P P Sbjct: 149 PPSLPPPPPPPP-----PPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 PP P P + P PPP PP PP PPP Sbjct: 116 PPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPP 161 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP PPPP P P PP PP PPP P P Sbjct: 120 SPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKP 172 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPP--PGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 P P R P PPP P P P P P P P P PPP Sbjct: 125 PPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPS 184 Query: 909 PXXPXP 926 P P Sbjct: 185 LQPPSP 190 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 PS PPPP P P P P PP PPP P Sbjct: 150 PSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPP 199 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXP---PPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P P R P P PPP P P P P P P P PPP Sbjct: 192 PPPPTRPPSVKPPVVQPKPQPPPTLPPPSP--PPPPPTVPPRTPGDTPAVVEPKPQPPPP 249 Query: 906 XPXXP 920 P P Sbjct: 250 PPRAP 254 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 PPR + P P PPP PP P P PP Sbjct: 128 PPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P S PPPP P P P P PP PP P Sbjct: 187 PPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTP 233 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPX----PXPXXXXXPPXXXXXXXX---PPXXXPPPXPXXPXP 926 PS PPPP P P P P PP P PPP P P P Sbjct: 219 PSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPP 277 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 35.9 bits (79), Expect = 0.046 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 I PG A P+ PP P P P P P P PP P Sbjct: 140 ILPGRQAASRAPSPPAPPSPPQDPAPSLPHAPAPPPPQAPAPTPPQAPAPTPPRAPTPTP 199 Query: 909 PXXPXP 926 P P P Sbjct: 200 PQAPLP 205 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPP-PPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP--P 905 P P A +P+ PP P P P P P P PP PP PP P Sbjct: 55 PAPTATPTPPVAPAKAPPVAPAVAPVTP--PPPTPKKAPPPPVTPPPVTPPPVTPPPVSP 112 Query: 906 XPXXPXP 926 P P P Sbjct: 113 PPATPPP 119 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 768 SPSSXPPP-PGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 +P + PPP P P P P P PP PP PP P Sbjct: 78 APVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTP 126 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP 902 +P PPPP P P P P PP PP PP Sbjct: 86 TPKKAPPPPVTPP--PVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 35.1 bits (77), Expect = 0.080 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 759 GXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 G PPPP P P P PP PP PPP P P Sbjct: 75 GPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 31.9 bits (69), Expect = 0.74 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +3 Query: 735 PGPXARXGGXXSPS---SXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 PGP + P PPPP P P P PP PP PPP Sbjct: 74 PGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = +3 Query: 678 PXNPXXXXXXTXXSLXFIXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPP 857 P P + + P P G S PPPP P P P P PP Sbjct: 74 PGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Query: 858 XXXXXXXXPP 887 PP Sbjct: 134 REAQLAPPPP 143 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPX---XXPPP 925 PP+ P P P PPP PP P PP PPP Sbjct: 85 PPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 7/59 (11%) Frame = +3 Query: 771 PSSXPPPP-------GXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P PPPP G P P P P PP PPP P P P Sbjct: 58 PPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSP 116 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PPP G P P P P P PP PPP P P Sbjct: 12 PPPQGGFPPQP--PPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPP 57 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P G P PPP P P P P P P P PPP P Sbjct: 31 PPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPP---PHQPQFNFGPGPPQQQQPPPPP 86 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPP 922 PP P P P PPP PP PP PP Sbjct: 84 PPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P PP P P P PP P PPP P P Sbjct: 20 PQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 783 PPPPGXXPXXPWXPX----PXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 PPPP P P P P P PP PP PPP P Sbjct: 55 PPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPP---PPPPP 98 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/46 (28%), Positives = 16/46 (34%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 PP + P P + P P PP+ PP PPP Sbjct: 11 PPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPP 56 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 I P P + +P PPPP P P P PP PP PP Sbjct: 1175 ISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234 Query: 909 P 911 P Sbjct: 1235 P 1235 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXP-XPXPXXXXXPPXXXXXXXXPPXXXPPP 905 I P P + +P PPPP P P P P PP PP PPP Sbjct: 1191 ILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPP 1250 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXP-XPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P P + P S PPPP P P P P PP PP PPP Sbjct: 1129 PPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPP 1186 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 I P P + +P PPPP P P P P PP P PPP Sbjct: 1159 ILPPPPIKSPPPPAPVISPPPPVKSP-----PPPAPVILPPPPVKSPPPPAPVISPPPPV 1213 Query: 909 PXXPXP 926 P P Sbjct: 1214 KSPPPP 1219 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPP--XXXPP 902 I P P + +P PPPP P P P PP PP PP Sbjct: 1207 ISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPP 1266 Query: 903 PXPXXPXP 926 P P P Sbjct: 1267 PAPVSLPP 1274 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P + +P PPPP P P P PP PP PP P Sbjct: 1145 PPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPP 1203 Score = 32.7 bits (71), Expect = 0.43 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGX--XPXXPWXPXPXPXXXXXPPXXXXXXXXP-PXXXPPP 905 P P A P PPPP P P P P PP P P PPP Sbjct: 1168 PPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPP 1227 Query: 906 XPXXPXP 926 P P Sbjct: 1228 PVKSPPP 1234 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 S SS PPPP P P P PP PP P P P P Sbjct: 689 SESSSPPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPP--PPAPEGHTPSP 739 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +3 Query: 771 PSSXPPPPGX--XPXXPWXPXPXPXXXXXPPXXXXXXXXP-PXXXPPPXPXXPXP 926 P PPPP P P P P PP P P PPP P P Sbjct: 1148 PEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGX--XPXXPWXPXPXPXXXXXPPXXXXXXXXP-PXXXPPP 905 P P A P PPPP P P P P PP P P PPP Sbjct: 1184 PPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP 1243 Query: 906 XPXXPXP 926 P P Sbjct: 1244 PEKSPPP 1250 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGX--XPXXPWXPXPXPXXXXXPPXXXXXXXXP-PXXXPPP 905 P P A P PPPP P P P P PP P P PPP Sbjct: 1152 PPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP 1211 Query: 906 XPXXPXP 926 P P Sbjct: 1212 PVKSPPP 1218 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 S +S PPPP P P P PP PP P P P P Sbjct: 623 SKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPP--PPTPEGHTPSP 673 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/68 (27%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPP--GXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP 902 I P P + +P PPPP P P P PP P PP Sbjct: 1223 ILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPP 1282 Query: 903 PXPXXPXP 926 P P P Sbjct: 1283 PAPVSLPP 1290 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPX 914 P P A G SP PP P P P PP PP PP Sbjct: 628 PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSP----PPPTPEGHTPSPPKSTPPTEKS 683 Query: 915 XPXP 926 P P Sbjct: 684 PPTP 687 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 S +S PPPP P P P PP PP P P P P Sbjct: 656 SKASSPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPP--PPAPEGHMPSP 706 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P +P S PPP G P P PP PP PP P Sbjct: 535 PPTEYSPPATPESSPPPEGKSPPTP------TASHSPPPVPEGHTPSPPKSGPPAGESPP 588 Query: 921 XP 926 P Sbjct: 589 TP 590 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 3/62 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXP-XPXPXXXXXPPXXXXXXXXPP--XXXPPP 905 P P A P PPPP P P PP PP PPP Sbjct: 858 PPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPP 917 Query: 906 XP 911 P Sbjct: 918 TP 919 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP S PPPP P P P PP PP PP P P P Sbjct: 53 SPDSPPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPP---PPLLPTPPPP 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 10/74 (13%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXX----------PWXPXPXPXXXXXPPXXXXXXXXP 884 P P +P+ PPPP P P P P P P P Sbjct: 58 PPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPP 117 Query: 885 PXXXPPPXPXXPXP 926 P PPP P P Sbjct: 118 PAPAPPPTPTPKFP 131 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPX 914 P P A G P PPPP P P P P P P PP PP P Sbjct: 338 PSPSAAGAGSGPP---PPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPP---PPALPG 391 Query: 915 XP 920 P Sbjct: 392 GP 393 Score = 32.7 bits (71), Expect = 0.43 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = +2 Query: 707 HXPFPXXYXXRSXGXGGGXXFPFIXXXPPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXP 886 H P P G G G P P P P + P PPP Sbjct: 300 HHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPA 359 Query: 887 -PRXPXPPXXXPPP 925 PR P P PPP Sbjct: 360 APRPPGPGPGPPPP 373 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXP-PXXXPPPXPXXPXP 926 P S PPPP P P P P PP P P P P P P Sbjct: 31 PESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSPHSPSP 83 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/59 (27%), Positives = 18/59 (30%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P + +P PPP P P P P PP PPP P Sbjct: 50 PAPQSSPAPPPAPDMTPPP---GPGPAAAPSPHSPSPSNAPWVAPAADIPPPPPPPPNP 105 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/63 (28%), Positives = 22/63 (34%) Frame = +1 Query: 739 VRGXGXGGXXPLHXXXPPPGKXPXXXGXPXXFPPXXPXPXXXXXXXVXPPXXXXPPXXSX 918 +R G G P + PPPG+ P G P + P V P PP Sbjct: 606 IRMPGSMGPMPTNIPPPPPGQNPYMPGPPRPYSMPPPPHMPTMATMVNPIGIPQPPPPLP 665 Query: 919 PXP 927 P P Sbjct: 666 PQP 668 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPX 914 PG G P S PPPP P P PP PP PP P Sbjct: 624 PGQNPYMPGPPRPYSMPPPP-HMPTMATMVNPIGIPQPPPP----LPPQPPAEEQPPQPD 678 Query: 915 XPXP 926 P P Sbjct: 679 EPEP 682 >06_01_0486 - 3455030-3455770 Length = 246 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPX 914 P P R P + PP P P P+ P P P P PP PP P Sbjct: 66 PPPSPRCPSCHPPYT-PPTPRPPPTPPYVPSPPPYVPPYIP-PPTPPYVPPYIPPPTPPY 123 Query: 915 XPXP 926 P P Sbjct: 124 VPPP 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 786 PPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PPP P+ P P P P PP P P P P P Sbjct: 105 PPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPP 151 Score = 31.9 bits (69), Expect = 0.74 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPX--PXPXXXXXPPXXXXXXXXPPXXXPPPX 908 P P SP PP P P+ P P P PP PP PPP Sbjct: 84 PRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPS---PPPYVPPPT 140 Query: 909 PXXPXP 926 P P P Sbjct: 141 PPSPPP 146 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 SPS P P P P P P P PP PP PPP P P Sbjct: 337 SPSPRPVQPSNAPPPP--PPPPPPPPPPPPPKLNTAPKPPPP-PPPPPSVP 384 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = +2 Query: 791 PRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPP------RXPXPPXXXPPP 925 P K S P P P PPP PP P PP PPP Sbjct: 330 PDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P A SP PPPP P P P PP P PPP P P Sbjct: 66 PPAGIAVHPSPPPPPPPPPPPPPVP-VPPAYSVTSSVPPYSMTSSLPPSPRPPPPLPFSP 124 >01_02_0007 + 10132380-10133201 Length = 273 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXP-PXXXXXXXXPPXXXPPPXPXXPXP 926 +P++ P P P P P P P P P PP P P P P P Sbjct: 145 NPNNPQPLPQPDPNAPSLPLPQPDPNAPPLPLPQPDPNAPPQPLPQPDPNNPQP 198 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 771 PSSXPPP-PGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P++ P P P P P P P P P PP P P P P Sbjct: 169 PNAPPLPLPQPDPNAPPQPLPQPDPNNPQPLPQPDPNAPPQPLPQPDPNSP 219 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 3/65 (4%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPP---PGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 PGP P P P P P P P P P P P P P Sbjct: 108 PGPQPNPNPQPLPQPNPNPQPLPQPDPNAPPLPLPQPNPNNPQPLPQPDPNAPSLPLPQP 167 Query: 906 XPXXP 920 P P Sbjct: 168 DPNAP 172 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXX-PWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 PGP + P PP PG P P P P P P P P P P Sbjct: 174 PGPKPKPP-KPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFP 232 Query: 912 XXPXP 926 P P Sbjct: 233 KPPCP 237 Score = 31.5 bits (68), Expect = 0.98 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 738 GPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXX 917 GP PS P PG P P P P P P PP P P P Sbjct: 156 GPKPGPKPKPKPSPPKPKPGPKPKPP-KPGPKPKP---PKPGPKPKPKPPKPGPKPKPKP 211 Query: 918 PXP 926 P P Sbjct: 212 PKP 214 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 735 PGPXARXGGXX-SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP 902 PGP + P PP PG P P P P P PP P PP Sbjct: 183 PGPKPKPPKPGPKPKPKPPKPGPKPK-PKPPKPGPKPKPGPPQPWWPIPFPKPPCPP 238 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/64 (28%), Positives = 22/64 (34%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPX 908 + P P + +P + PP P P P P P PP P PPP Sbjct: 558 VMPPPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPP- 616 Query: 909 PXXP 920 P P Sbjct: 617 PAMP 620 >07_01_0080 + 587674-588510 Length = 278 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P PP PPP Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPP 117 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP P P PP PPP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PP PP P PP PPP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 774 SSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +S PP G P P P PP PP PPP P P P Sbjct: 76 TSTPPRLGGDGMFRRPPPPPP-----PPPSSGSPPPPPPPPPPPPPPPPPP 121 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 PPPP P P P PP PP PPP P Sbjct: 15 PPPPQYFQAGPPPPPPQYFQGAHPPAAMWGQPPPPQAAPPPAP 57 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P PP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPP 376 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P PP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPP 887 +P PPPP P P P P P PP PP Sbjct: 348 APKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPP 922 P PPP PP P PP PP Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPP 379 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P P PPP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPP 379 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 PP GP P S P PPP P P PP PPP Sbjct: 40 PPPFAPPGGNGPVPSSIRA---PQAPPPGARPFPGSPPPPSQPPPP 82 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 735 PGPXARX-GGXXSPSSXPPPPGXXPXXPWXPXPXP 836 P P AR G P S PPPP P P P P Sbjct: 62 PPPGARPFPGSPPPPSQPPPPFARPAAPVQQQPPP 96 >03_02_0765 + 11000724-11002496 Length = 590 Score = 32.3 bits (70), Expect = 0.56 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G GG GGG G E G G GG + G Sbjct: 443 GGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGG 494 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 43 GGGGGFGGGGGLGGGGGAGGGFGGGLGHGGGLGGG 77 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 273 GGGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGG 307 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 323 GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 357 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 363 GGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 397 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 403 GGGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAG 437 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 771 PSSXPPPPGXXPXX--PWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P + PPPP P P P P PP PP PPP Sbjct: 277 PQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPP 323 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPPGXXPXXPWXPXPXP--XXXXXPPXXXXXXXXPPXXXPPPXPX 914 P G P PPPP P P P P P PP PPP P Sbjct: 254 PGTLPNGSGGPP-RPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPL 312 Query: 915 XPXP 926 P Sbjct: 313 ANGP 316 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 31.9 bits (69), Expect = 0.74 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKGXXXPP 754 GGG GG G GG GGG G G G GG G PP Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKGXXXPPP 751 GGG GG G GG GGG G G G GG G PP Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKGXXXPPPXP 745 GGG GG G GG GGG G G G GG PP P Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPPGP 106 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 68 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 69 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 70 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 31.9 bits (69), Expect = 0.74 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 2/87 (2%) Frame = +1 Query: 94 KFFMIFVLALLA--MANAQDPVRVVENADSGNGYEPIDNRPYIVNPPKDYNPNGNGYEPI 267 K ++F L L A +A+A+ +N +E P +PP P+ + Y+P Sbjct: 11 KALLVFALLLAAAFVASAEQTHDDGDNPPESPDHEDPPPSPEYYDPP----PSPDYYDPP 66 Query: 268 DNGAYYVDRPQGRPYFKPTPFPGARGG 348 + YY D P Y+ P P P GG Sbjct: 67 HSPDYY-DPPPSPDYYDPPPSPYYGGG 92 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/69 (31%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +1 Query: 148 PVRVVENADSGNGYEPIDNRPYIVNPPKDYNPNGNGYEPI---DNGAYYVDRPQGRPYFK 318 P + + Y P + P V PP Y P +G P N + Y + P GRP Sbjct: 381 PPAAPQQPEEAMSYAPPQSYPPNVRPPSPYMPPPSGPAPPFYGQNQSMY-EPPVGRPNSG 439 Query: 319 PTPFPGARG 345 P P GA G Sbjct: 440 PPPSYGAGG 448 >06_03_1326 - 29355467-29355817 Length = 116 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G E G G Sbjct: 19 GGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSG 53 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G + G G Sbjct: 24 GGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGG 58 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 8 GGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGG 42 >06_03_0790 - 24636805-24637770 Length = 321 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G RGG GGG G G G Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G GG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GG G E G G Sbjct: 130 GGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDG 164 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXG 826 GGG GG G GG GGG G + G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNG 156 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXG 826 GGG GG G GG GGG G + G Sbjct: 127 GGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPP--XXXXXXXXPPXXXPPP 905 P PPPPG P P P P PP P PPP Sbjct: 37 PQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPP 83 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +1 Query: 739 VRGXGXGGXXPLHXXXPPPGKXPXXXGXPXXFPPXXPXPXXXXXXXVXPPXXXXPPXXSX 918 + G G P H PP G P P +PP P PP PP Sbjct: 20 MHGVAGGHGYPPHQGYPPQGYPPP----PGAYPPP-PGAYPPPPGAYPPPPGAYPPQHGY 74 Query: 919 PXP 927 P P Sbjct: 75 PQP 77 >04_04_1125 + 31085106-31085714 Length = 202 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +3 Query: 759 GXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 G P++ PPPP P P P P PP P P P P P P Sbjct: 31 GSNCPTTKPPPPPCQPP---PPTPTPATPTTPPTPWTPPPATP-TPPTPTPWTPTP 82 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPX-PXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P PPPP P P P P P P PPP P P Sbjct: 42 PPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATP 92 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/71 (25%), Positives = 21/71 (29%) Frame = +2 Query: 713 PFPXXYXXRSXGXGGGXXFPFIXXXPPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPR 892 P P Y GG P++ PP + P P PP P Sbjct: 399 PAPPTYPPADPAAGGYTSQPYMGAPPPPPPGSYAPVPWGQPPPYASYPPPPPGSSMYNPP 458 Query: 893 XPXPPXXXPPP 925 P P PPP Sbjct: 459 PPAPGQATPPP 469 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 774 SSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 S PPPPG P P P P PP PP PPP Sbjct: 444 SYPPPPPGSSMYNP--PPPAPGQATPPPYGVQYAP-PPAPIPPP 484 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +1 Query: 187 YEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPFPG 336 Y P P PP Y P+ GY P GAY +P + P +PG Sbjct: 56 YPPAGGYPGAQYPPSGYPPSQGGYPP---GAYPPSGYPQQPGYPPAGYPG 102 >08_01_0388 + 3432177-3433154 Length = 325 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXP 830 P P +R G S SS P PP P P P P Sbjct: 114 PAPTSRRGRRQSSSSNPTPPPPKPSDPIAPPP 145 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +P + P PP P P P PP PP PPP P P Sbjct: 30 TPITYPSPPSLSPSMP---PTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNP 79 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 768 SPSSXP--PPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP 902 SPS P PPP P P P P PP P PP Sbjct: 41 SPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPAPTSPSPP 87 >07_03_0177 - 14770777-14772045 Length = 422 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G F +GG Sbjct: 304 GGGGGLGGGGGLGGGSGLGGGIGKGGGLGGSFGKGGGLGGGFGKGG 349 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG GG GGG G G G F +GG Sbjct: 76 GGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGG 121 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG GG GGG G G G F +GG Sbjct: 294 GGGFGKGGGLGGGGGLGGGGGLGGGSGLGGGIGKGGGLGGSFGKGG 339 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G F +GG Sbjct: 68 GGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLG--GGGGFGKGG 111 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 64 GGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGG 98 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 196 GGGGGLGGGGGLGGGIGKGGGLGGGFGKGGGLGGG 230 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 228 GGGGGLGGGGGLGGGIGKGGGLGGGIGKGGGLGGG 262 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXX--GGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G F +GG Sbjct: 90 GGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGGFGKGGGFGGGFGKGG 137 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 5/57 (8%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPX-----PXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P PPPP P P P P PP P PPP P P P Sbjct: 204 PPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGP 260 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P PP P P P P P P PP PPP P P Sbjct: 207 PSPPSILP--PLTPQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLPPVP 252 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P PPPP P + P P PP P PPP P P Sbjct: 40 PFGFPPPP--PPGSTFVPLPQSGVPPPPPLGSFFVPPPQSRVPPPPPQLGVP 89 >09_01_0037 - 604001-604957 Length = 318 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 5/62 (8%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPP-----GXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P AR GG P PPPP P P P PP PPP Sbjct: 182 PVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPHPDPSTPSEPAVQLQPPPPSQMPPP 241 Query: 906 XP 911 P Sbjct: 242 TP 243 >07_03_0560 + 19479597-19480667 Length = 356 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G GG GGG G G G GG + G Sbjct: 83 GGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGG 134 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G +GG GGG G G G Sbjct: 211 GGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGG 245 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G +GG GGG G G G Sbjct: 135 GGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGG 169 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 110 GGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVGGGG 144 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXG 826 GGG GG G GG GGG G + G Sbjct: 116 GGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGG 148 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G GG GGG G G G GG M G Sbjct: 203 GGGGGMGGGG--GGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGG 252 >07_03_0558 + 19461369-19462448 Length = 359 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G GG GGG G G F GG + G Sbjct: 134 GGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGG 185 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G G GGG G G G F GG + G Sbjct: 170 GGGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGG 221 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG GG GGG G G G F GG + G Sbjct: 202 GGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGG 253 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G G GGG G G G F GG + G Sbjct: 238 GGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGGGGLGG 289 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGGXXXMKG 769 GGG GG G G GGG G G G F GG + G Sbjct: 96 GGGGGFGGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGG 147 >05_07_0125 + 27861368-27862282 Length = 304 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXG 853 GGG GG G RGG GGG G Sbjct: 229 GGGGGGGGDGYRGGDSYRGGGGGG 252 >03_01_0023 + 198414-198968 Length = 184 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXG 853 GGG GG G RGG GGG G Sbjct: 41 GGGGGGGGGGGRGGGGGSGGGSGG 64 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 47 GGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGG 81 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 37 GGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGG 71 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G + GG Sbjct: 57 GGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGG 102 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G RGG Sbjct: 63 GGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGG 108 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -3 Query: 926 GXGXXXXGGXXXXGGXTXXXXXXXGXGXXGGXXXGXPXXXGXXPGGGXXX*RGXXPPXPX 747 G G GG GG G G GG G G GGG R P Sbjct: 73 GGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGGGRDGDWVCPD 132 Query: 746 PR 741 PR Sbjct: 133 PR 134 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GG GG G GG GGG G E G G RGG Sbjct: 95 GGYGQRGGGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGG 140 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +P + P PP P P P PP PP PP P P P Sbjct: 30 TPITYPSPPSLSPSTP---PTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSP 79 >07_03_0890 - 22332768-22333382 Length = 204 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 PPPP P P P P P PP P P P Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTP 117 >07_03_0559 + 19475893-19476783 Length = 296 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G +GG GGG G G G Sbjct: 172 GGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSG 206 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 84 GGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGG 118 >07_01_0479 + 3606663-3607448 Length = 261 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 3/55 (5%) Frame = +3 Query: 771 PSSXPPPPGXXPXXP---WXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P PPPPG P P P PP PP P P P P Sbjct: 198 PGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGP 252 >01_02_0031 + 10364487-10365407 Length = 306 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 PPPP P P P P P PP P PPP Sbjct: 172 PPPPPALPAPP--PPPAPMLPLAPPPTHVTPAMPLSSMPPP 210 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWX-PXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P P G + P PP P P P P P P PP P P Sbjct: 574 PSPPEVTPGPPEITPYPSPPEITPSPPEITPYPSPPEVVPSPPKITPYPSPPEVTPSPPE 633 Query: 912 XXPXP 926 P P Sbjct: 634 ITPYP 638 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/67 (26%), Positives = 19/67 (28%), Gaps = 1/67 (1%) Frame = +3 Query: 729 IXPGPXARXGGXXSPSSXPPPPGXXPXXPWX-PXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 I P P + P PP P P P P P P PP P P Sbjct: 556 IYPSPPEVTPSPPEITPYPSPPEVTPGPPEITPYPSPPEITPSPPEITPYPSPPEVVPSP 615 Query: 906 XPXXPXP 926 P P Sbjct: 616 PKITPYP 622 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWX-PXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P P PP P P P P P P PP P P P P Sbjct: 430 PVVYPSPPEVTPSPPEIAPYPSPPEIVPSPPEITPYPSPPEIVPSPPEITPYP 482 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPP 922 P PPP PP P PP PP Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPPP 451 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 PPPP P P P P P PP PP PPP P Sbjct: 425 PPPP---PLPPPPPPPPPPPPPLPPNM------PPPLPPPPEP 458 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P P PPP Sbjct: 432 PPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P PPP PP P P PPP Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPP 451 >03_05_0576 + 25765137-25766420 Length = 427 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 738 GPXARXGGXXSPSSXPPP-PGXXPXXPWXPXPXPXXXXXPP 857 GP A SPS PPP P P P P P PP Sbjct: 64 GPEAPPSPSPSPSPSPPPQPSSPPPPPPSPPPAAAVSVSPP 104 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = +3 Query: 750 RXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 + GG +P S P P P P P P PP PP P P P P Sbjct: 61 KRGGPEAPPSPSPSPS--PSPPPQPSSPPPPPPSPPPAAAVSVSPP-TQPRPRPELP 114 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 752 GGGXXFPFIXXXPPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPPRXPXPPXXXPPP 925 GG P+ PPR K P P P PPP P PP P P Sbjct: 102 GGRTAKPYRPPPPPRKKPQFQPPPQPPRAWDPSPP--PPPPAPAAPVLVPPPAPAPRP 157 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 756 GGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 G P PPPP P P P PP P PP P P Sbjct: 103 GRTAKPYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRPAP 159 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P S PPP P + P P PP PP PPP P P Sbjct: 415 PQSPPPP---LPSDAFEQPPPPPE-HPPPPESTSPPPPPTSDPPPVPPPP 460 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P P P PP P PP PPP Sbjct: 122 PPPPHPPEDPPPHPPHPPDHPPPP 145 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 821 PXPXSXXXXXXPXXPPPXXXXPP--RXPXPPXXXPPP 925 P P P PPP PP P PP PPP Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPP 153 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 P PPPP P P P P PP PP PPP Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPPP--------PPCRVPPP 153 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 145 GGGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRGGG 179 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 122 GGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGG 156 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 123 GGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGG 157 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 +P S PPPP P P P P P PPP P Sbjct: 78 TPPSPPPPPPPPPPPPPPLSPTPTTTSWTTNSSSISASPILPPPPPPP 125 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 866 PPXXXXPPRXPXPPXXXPPP 925 PP PP P PP PPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPP 92 >09_03_0145 - 12749288-12751510 Length = 740 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 854 PXXPPPXXXXPPRXPXPPXXXPPP 925 P P P PP P PP PPP Sbjct: 20 PFKPKPTNPSPPPPPPPPGIQPPP 43 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 758 GGGGYGGGGGGYGGGGYGGGGGGGGYGGGSSYGGG 792 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 759 GGGYGGGGGGYGGGGYGGGGGGGGYGGGSSYGGGG 793 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRG 790 GGG GG G GG GGG G G G F G Sbjct: 108 GGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGG 152 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 822 PXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P P P PP PP PPP P P Sbjct: 17 PPPPPATRARPPCSSAHLLPPPPPPPPPPPYVP 49 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P P PP P P P P P PP P P P P P Sbjct: 76 PKPTPTPPTYTPT----PKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTP 123 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +P + P P P P+ P P P P PP PP P P Sbjct: 81 TPPTYTPTPKPTPP-PYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKPQPKP 132 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 +P + P P P P+ P P P P P P P P P P Sbjct: 122 TPPTYKPQPKPTPA-PYTPTPTPPTYKPQPKPTPPPTYKPQPKPTPTPYTPTP 173 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 756 GGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPP-PXPXXP 920 GG +P+ P P P P P P PP PP P P P Sbjct: 28 GGGYTPTPTPVKPAPKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPPKPTPTPP 83 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +2 Query: 752 GGGXXFPFIXXXPPRXKXXXSXGPXPXSXXXXXXPXXPPPXXXXPP----RXPXPPXXXP 919 GGG PP + G PPP PP R P PP P Sbjct: 81 GGGKPAKMPDSPPPSLPPPVNTGKKKWKKDKRKEIPPPPPLAETPPPMNERPPTPPPVQP 140 Query: 920 PP 925 PP Sbjct: 141 PP 142 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGP 817 GGG GG G G GGG G G GP Sbjct: 18 GGGGGGGGGGRGNGGGGFGGGGGGGGGNHGYYGRGP 53 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGP 817 GGG GG G GG GGG G G P Sbjct: 20 GGGGGGGGRGNGGGGFGGGGGGGGGNHGYYGRGPQP 55 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +3 Query: 717 SLXFIXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXX 896 SL P P R +P P PP P P P P PP PP Sbjct: 491 SLALRSPAPHLRVRHMPAPP-VPTPPAPAPPVSTLPSPAP-SVHTPPVTAPPATAPPMIA 548 Query: 897 PP 902 PP Sbjct: 549 PP 550 >08_02_1258 - 25670092-25670152,25671124-25671327,25671400-25671611, 25671701-25671749,25671833-25672612,25672696-25672767, 25672907-25672954,25673053-25673127,25673238-25673312, 25673614-25673668,25673931-25674016,25674759-25674988 Length = 648 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 750 RXGGXXSPSSXPPPPGXXPXXP 815 R G SPS PPPPG P P Sbjct: 22 RKRGRSSPSLPPPPPGPPPQVP 43 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PS PPP P P P PP PPP P P P Sbjct: 55 PSQQLPPPSLPPPLP-QKQPPSQQLPPPPQQQQPPPQHSLPPPPPLPQAPPP 105 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +3 Query: 756 GGXXSPSSXPPPPGXXPXXPWXPXP----XPXXXXXPPXXXXXXXXPPXXXPPPXPXXPX 923 G + SS PPP P P P P PP P PPP P Sbjct: 43 GFLHNSSSSQPPPSQQLPPPSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPPPPPLPQA 102 Query: 924 P 926 P Sbjct: 103 P 103 >08_01_0202 - 1638978-1639571 Length = 197 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGG 862 GGG GG G RGG GGG Sbjct: 157 GGGYGGGGGGYRGGGGGGGGG 177 >06_02_0175 - 12624608-12625297 Length = 229 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG GGG G G G GG Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGGGGGRRCWWGCGNGRRRHKGGKEGG 147 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGGGGGGGRRCWWGCG 134 >06_01_0008 + 141405-142421 Length = 338 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/62 (25%), Positives = 19/62 (30%) Frame = +3 Query: 726 FIXPGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 F G G +P+ P P P P+ P P P PP P P Sbjct: 36 FCGGGFVEELGEDINPNPNPNPSPFLPHHPFFPFASPSFDLRNPSDLAAFFGPPSPSPSP 95 Query: 906 XP 911 P Sbjct: 96 SP 97 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGG 74 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGG 77 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 46 GGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 >02_01_0158 - 1103461-1104186 Length = 241 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGG 862 GGG GG G RGG GGG Sbjct: 84 GGGGGGGGFGSRGGGGSGGGG 104 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 P AR P+S PPP P P P PP PPP P Sbjct: 200 PPTIARPPRPLPPASPPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASPTPPPIP 258 >10_08_0214 - 15915156-15915713 Length = 185 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG GG G GG G G G G + RGG Sbjct: 32 GGGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGG 77 >07_03_1751 - 29215074-29216270 Length = 398 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXGPXXXXXFXRGG 787 GGG G G GG GGG G G G GG Sbjct: 226 GGGLGGGAGGGHGGGGGLGGGAGGGAGVGGGAGGGAGAGGGLGAGG 271 >07_03_1636 + 28290642-28291574 Length = 310 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 P+ PPPP P P P PP PP PPP P P Sbjct: 149 PAPPPPPPQLFETAP----PSPPYVPPPPDAYLRKPSPP--SPPPAKLSPPP 194 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPP 857 P P SP PPPP P P P P PP Sbjct: 154 PPPQLFETAPPSPPYVPPPPDAYLRKPSPPSPPPAKLSPPP 194 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 60 GGGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYG 94 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 SP PPPP P P P P P P P P P P Sbjct: 127 SPPPPPPPPARTPMP--TPTPTPTPTPTRPPVPVWAAPLPARTPTPTPSAP 175 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 924 GGGXXXGGXGXRGGXXXXGGGXXGXXXXXXEXGXG 820 GGG GG G GG GGG G G G Sbjct: 156 GGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 PPPP P P P P P P PP P P Sbjct: 174 PPPPPPRPPAPEYKPPTPTLTPIPTPEPSYGPPAPKPPAPPVEDEPQP 221 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +3 Query: 735 PGPXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXP-PXXXXXXXXPPXXXPPPXP 911 PG A+ P PPP P P P P P PP PPP Sbjct: 953 PGGSAQQSEKRPPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPPNSPPPLQ 1012 Query: 912 XXPXP 926 P Sbjct: 1013 PATDP 1017 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP+ P P P P P PP P PPP P P Sbjct: 60 SPNHSGDPSRPIPSQAPAPPPPPTADPSPPLPHDNRTPQPRAAPPPAPAPDQP 112 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 24.2 bits (50), Expect(2) = 7.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 771 PSSXPPPPGXXPXXPWXPXP 830 P + PPPP P P P P Sbjct: 354 PPAPPPPPPFAPTLPPPPPP 373 Score = 22.6 bits (46), Expect(2) = 7.4 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +3 Query: 834 PXXXXXPPXXXXXXXXPPXXXPPPXP 911 P PP PP PPP P Sbjct: 408 PFVQPPPPPTHTHGPPPPPPPPPPPP 433 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 777 SXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPP 905 S PPP P P P P PP PP PPP Sbjct: 19 SAPPPSSSSPSPPVPPDPYGADLSPPP---PPPPKPPPTVPPP 58 >11_01_0385 + 2915532-2916482 Length = 316 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +3 Query: 771 PSSXPPPPGXX-PXXPWXPXPX-----PXXXXXPPXXXXXXXXPPXXX-PPPXPXXPXP 926 PS PP P P W P P P P PP PPP P P P Sbjct: 229 PSHPPPTPAWPQPGNKWPPLPPFPSHPPPTPAWPHPGNQWPPLPPFPFHPPPMPAWPHP 287 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 783 PPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 PP P P P P P PP PPP P P Sbjct: 20 PPELRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGP 65 >09_04_0180 + 15367737-15367755,15368874-15369739 Length = 294 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 741 PXARXGGXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXP 920 P R +PS P PP P P P P PP P P P Sbjct: 132 PPPRPMPIPTPSPRPRPPDPEPKPDPEPDPELEPEPEPEPDPEPEPEPPTPKPIPTPIPS 191 Query: 921 XP 926 P Sbjct: 192 PP 193 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 768 SPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 SP S P P P P P P P PPP P P P Sbjct: 44 SPQSHPQPDAPAAAAP--PPPAPLTPPPPKSPPPPPHIQTTDLPPPKPLPPAP 94 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +2 Query: 788 PPRXKXXXSXGPXPXSXXXXXXPXXPP-PXXXXPPRXPXPPXXXPP 922 PPR K P P P PP P P PP PP Sbjct: 164 PPRKKPLLYPPPLPPKKKPLPPPSPPPQPPLPEKENTPLPPLLLPP 209 >06_03_0874 - 25580417-25580419,25580504-25580604,25580828-25581411, 25581523-25581594,25581667-25581793,25583412-25583516, 25583643-25583676 Length = 341 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +1 Query: 178 GNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 330 G Y+P R PP+ P Y P G Y +PQG+PY P P+ Sbjct: 247 GETYQPQPQRE--TYPPQ---PQVQPYPPKPQGQPYPPQPQGQPY-PPQPY 291 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 6/58 (10%) Frame = +3 Query: 756 GGXXSPSSXPPPP------GXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXP 911 G PS PPPP P P P P P P PPP P Sbjct: 44 GSPPPPSPPPPPPLDEETLAQFPSPPTNPSPPPPPPLDADAAAEAAPSPALTSPPPNP 101 >02_03_0388 + 18429538-18430598,18430971-18431081,18431165-18431237, 18431513-18431695 Length = 475 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +3 Query: 759 GXXSPSSXPPPPGXXPXXPWXPXPXPXXXXXPPXXXXXXXXPPXXXPPPXPXXPXP 926 G + S P PP P P P P P PP P P P P Sbjct: 67 GRQAASRAPSPPAP-PSPPQASAPSPPHAPAPSPPQAPAMTPPQAPAPTPPQAPRP 121 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 866 PPXXXXPPRXPXPPXXXPPP 925 PP PP P PP PPP Sbjct: 282 PPTPHPPPSSPPPPMSPPPP 301 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,266,143 Number of Sequences: 37544 Number of extensions: 527296 Number of successful extensions: 6623 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4200 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -