BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M23 (967 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.04c |mmf1|pmf1|YjgF family protein Mmf1|Schizosaccharomy... 49 1e-06 SPAC1039.10 |mmf2|hpm1, SPAC922.01|homologous Pmf1p factor 1|Sch... 44 3e-05 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 35 0.020 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 35 0.020 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 35 0.020 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 34 0.026 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 33 0.046 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 33 0.046 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.077 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 31 0.18 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 31 0.18 SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|c... 31 0.32 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 30 0.56 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 1.3 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 29 1.3 SPBC800.08 |gcd10||translation initiation factor eIF-3 gamma sub... 27 3.0 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 27 3.0 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 27 5.2 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 26 6.9 >SPBC2G2.04c |mmf1|pmf1|YjgF family protein Mmf1|Schizosaccharomyces pombe|chr 2|||Manual Length = 162 Score = 48.8 bits (111), Expect = 1e-06 Identities = 29/77 (37%), Positives = 44/77 (57%) Frame = +1 Query: 130 TIITSPEIYQPVGPYSQAILADKTLYISGILGLDRDAQMVCGGAEAXTRQALDXLRHVLE 309 T I SP++ GPY+QAI A+ +Y SG + + + +++ G TRQ L L+ VL Sbjct: 40 TPINSPKL-SSAGPYNQAIKANGVIYCSGQIPV-ANGKVIEGTVGDQTRQCLLNLQEVLT 97 Query: 310 AGGASLESVVKTTVLLA 360 G+SL +VK + LA Sbjct: 98 EAGSSLNKIVKVNIFLA 114 Score = 28.3 bits (60), Expect = 1.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 365 MDDFXTFNKVYAEYFPKACPA 427 MDDF NKVY E P PA Sbjct: 116 MDDFAAVNKVYTEVLPDPKPA 136 >SPAC1039.10 |mmf2|hpm1, SPAC922.01|homologous Pmf1p factor 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 126 Score = 44.0 bits (99), Expect = 3e-05 Identities = 22/64 (34%), Positives = 35/64 (54%) Frame = +1 Query: 166 GPYSQAILADKTLYISGILGLDRDAQMVCGGAEAXTRQALDXLRHVLEAGGASLESVVKT 345 GPY+QA+ + ++ SG + +D V G + TR ++ L VL G+SLE +VK Sbjct: 15 GPYNQAVKSGGLIFCSGQAAV-KDGNFVPGTIQEQTRLTIENLAEVLRVAGSSLEKLVKV 73 Query: 346 TVLL 357 + L Sbjct: 74 NIFL 77 Score = 25.8 bits (54), Expect = 9.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 365 MDDFXTFNKVYAEYFPKACPA 427 +DDF N+VY E P PA Sbjct: 80 IDDFAAMNEVYKEMLPDPMPA 100 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 34.7 bits (76), Expect = 0.020 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXP-PPXPRXXPPP 962 +PP + PPPPP P P P P P PPP Sbjct: 1698 APPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 31.1 bits (67), Expect = 0.24 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPPXXG 906 P P P P P P P P PP P PP P P G Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPSAP--PPPLPASSAPSVPNPG 1747 Score = 31.1 bits (67), Expect = 0.24 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 858 SPPXPAXXXPPPP--PXXXPXXPXPXPPPXPRXXPP 959 +PP P PPPP P P PPP P P Sbjct: 1706 TPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 29.5 bits (63), Expect = 0.74 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 808 APXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 AP PPP PP P +PP PP Sbjct: 1704 APTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXP--PP 962 S P P PPP P P PP P P PP Sbjct: 1696 SAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 28.3 bits (60), Expect = 1.7 Identities = 13/36 (36%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 858 SPPXPAXXXPP-PPPXXXPXXPXPXPPPXPRXXPPP 962 +P P P P P P PPP P PPP Sbjct: 1682 APAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPP 1717 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 893 PPXXXXXXPXPXPPPXPTXPP--PPXP 967 PP P P PP P PP PP P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 27.1 bits (57), Expect = 4.0 Identities = 12/29 (41%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 887 PXPPXXXXXXPXPXPPPX--PTXPPPPXP 967 P PP P P P P+ PPPP P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 26.6 bits (56), Expect = 5.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 917 PXPXPPPXPTXPPPPXP 967 P P PPP PPP P Sbjct: 1705 PTPPPPPMSVPPPPSAP 1721 Score = 23.0 bits (47), Expect(2) = 2.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 770 PPPPPPSPXXXXPPP 814 P PPPP P PPP Sbjct: 1705 PTPPPP-PMSVPPPP 1718 Score = 22.6 bits (46), Expect(2) = 2.8 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = +2 Query: 887 PXPPXXXXXXPXPXPPPXPTXPPPPXP 967 P P P PPP P P P Sbjct: 1718 PSAPPMPAGPPSAPPPPLPASSAPSVP 1744 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 34.7 bits (76), Expect = 0.020 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -2 Query: 924 GXGXXXXXXGGXGXXXXXXXGGRXX--GGGGGXGRGXXXGGGXXXXGEGGGGGG 769 G G GG GGR GGG G RG G G G GG GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 33.1 bits (72), Expect = 0.060 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -2 Query: 924 GXGXXXXXXGGXGXXXXXXXGGRXXGGGGGXG-RGXXXGG-GXXXXGEGGGGGG 769 G G GG G GG G GG G RG GG G G GG GG Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 31.1 bits (67), Expect = 0.24 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 897 GGXGXXXXXXXGGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 GG G G GG G GRG GGG G GG G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRG 51 Score = 31.1 bits (67), Expect = 0.24 Identities = 23/69 (33%), Positives = 25/69 (36%) Frame = -3 Query: 896 GGXGXXXRXXXGGEXGXGGGXXGGGXXXGAXGXXXGRGXGXGXXGXGWVERVGG*NXXXG 717 GG GG G GGG GG G G GRG G G GG + G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGR-GGARGGGRGGARGGRGGRGGARGGR-----GGSSGGRG 65 Query: 716 GEXEGRKAV 690 G G K + Sbjct: 66 GAKGGAKVI 74 Score = 29.9 bits (64), Expect = 0.56 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 967 RXGGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGG 860 R G G G GG G G G GGG G G GG Sbjct: 15 RGGRGGFNGGRGGFGGGRGG-ARGGGRGGARGGRGG 49 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 864 GGRXXGGGGGXGRGXXXGG-GXXXXGEGGGGGG 769 G R GG GRG GG G G GG GG Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGG 38 Score = 28.7 bits (61), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = -1 Query: 961 GGGXXRGXGGGXG--XGXXGXXXG--GGGGXXXAGXGGEKXG 848 GGG GGG G G G G GG G G GG K G Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 26.6 bits (56), Expect = 5.2 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEKXGXXXXXXXXXXXXGRXXXGGGGG 782 G RG G G G G GGG A GG GR GG G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Query: 781 XGXG 770 G Sbjct: 66 GAKG 69 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEK 854 GGG GG G G GG G GG K Sbjct: 37 GGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAK 72 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 34.7 bits (76), Expect = 0.020 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = +2 Query: 770 PPPPPPSPXXXXPPPXXXXXXXXXXXXXXXXXXSXXXXXPXPPXXXXXXPXPXPPPXPTX 949 PPPPPPS PP S P PP P PP + Sbjct: 312 PPPPPPSRRNRGKPP-----------IGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSA 360 Query: 950 PPPPXP 967 PPPP P Sbjct: 361 PPPPPP 366 Score = 31.1 bits (67), Expect = 0.24 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPP 864 P PLP P AP P PPP P P Sbjct: 454 PIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 29.9 bits (64), Expect = 0.56 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPPXXGXPXXP 921 P P LP P + PP P P +PP P G P P Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAP 467 Score = 29.1 bits (62), Expect = 0.98 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSP 861 P P +P P P PP P P P +P Sbjct: 458 PLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXP 944 +PP P PP P P PPP P Sbjct: 229 APPIPPSIPSSRPPERVPSLSAPAPPPIP 257 Score = 27.5 bits (58), Expect = 3.0 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Frame = +1 Query: 778 PXPLPXXXPXAPXXXPPPXXPPP----XPXSPPXXXRXXXPXPPXXGXPXXP 921 P LP P AP P PP P +PP P P P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 P P+ PP P P P P PP P P P Sbjct: 448 PLPPSAPIAPPLPAGMPAAP-PLPPAAPAPPPAP 480 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPP 959 +PP PA PP P P P P P P P Sbjct: 456 APPLPAGMPAAPP--LPPAAPAPPPAPAPAPAAP 487 Score = 27.1 bits (57), Expect = 4.0 Identities = 17/68 (25%), Positives = 17/68 (25%), Gaps = 2/68 (2%) Frame = +2 Query: 770 PPPPPPSPXXXXPPPXXXXXXXXXXXXXXXXXXSXXXXXPXPPXXXXXXPX--PXPPPXP 943 PP P P PP P P P P PP P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Query: 944 TXPPPPXP 967 PP P P Sbjct: 475 APPPAPAP 482 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXP 894 P PLP P AP PP P + P P P Sbjct: 444 PAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 26.2 bits (55), Expect = 6.9 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 3/69 (4%) Frame = +2 Query: 770 PPPPPPS-PXXXXP--PPXXXXXXXXXXXXXXXXXXSXXXXXPXPPXXXXXXPXPXPPPX 940 P P PPS P P PP S P P P P P Sbjct: 416 PVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPA 475 Query: 941 PTXPPPPXP 967 P P P P Sbjct: 476 PPPAPAPAP 484 Score = 26.2 bits (55), Expect = 6.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 778 PXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 P P P P + PP PP P S P P PP Sbjct: 416 PVPTPPSLPPSA----PPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXP--PP 962 +PP P P PP P P PP P P PP Sbjct: 414 TPPVPTP--PSLPPSAPPSLPPSAPPSLPMGAPAAPP 448 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 34.3 bits (75), Expect = 0.026 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -2 Query: 924 GXGXXXXXXGGXGXXXXXXXGGRXXGGGGGXGRGXXXGG-GXXXXGEGGGGGG 769 G G GG G GG GGG G G GG G G GGG GG Sbjct: 215 GEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGG 267 Score = 32.7 bits (71), Expect = 0.080 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -1 Query: 958 GGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEKXGXXXXXXXXXXXXGRXXXGGGGGX 779 GG G GGG G G G GG G GGE G GG GG Sbjct: 187 GGGFGGFGGGSG----GPPPGPGGFGGFGGFGGE--GHHHGGHGGFGGGPGGFEGGPGGF 240 Query: 778 GXGXXXXGGWRG 743 G G GG G Sbjct: 241 GGGPGGFGGGLG 252 Score = 32.3 bits (70), Expect = 0.11 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = -3 Query: 920 GXXGXPXXGGXGXXXRXXXGGEXGXGGGXXGGGXXXGA-XGXXXGRGXGXGXXGXGWVER 744 G G P G G GGE GG G G G G G G G G G G Sbjct: 195 GGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGF 254 Query: 743 VGG*NXXXGG 714 GG GG Sbjct: 255 GGGPGGFGGG 264 Score = 30.7 bits (66), Expect = 0.32 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 897 GGXGXXXXXXXGGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 GG GG G GG G G G G G GG GGG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGG 229 Score = 30.7 bits (66), Expect = 0.32 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -3 Query: 896 GGXGXXXRXXXGGEXGXGGG--XXGGGXXXGAXGXXXGRGXG-XGXXGXGW 753 GG G GG G GGG GGG G G G G G G G GW Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGGFGGG-LGGFGGGPGGFGGGPGGHGGPGW 273 Score = 30.3 bits (65), Expect = 0.42 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 897 GGXGXXXXXXXGGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 GG G G GGG G G G G G GGG GG Sbjct: 211 GGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGG 253 Score = 27.5 bits (58), Expect = 3.0 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEKXGXXXXXXXXXXXXGRXXXGGGGG 782 G G G GG G G GG G GG G GG GG Sbjct: 189 GFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGH--GGFGGGPGGFEGGPGGFGGGPGG 246 Query: 781 XGXGXXXXGGWRG 743 G G GG G Sbjct: 247 FGGGLGGFGGGPG 259 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGG 860 G G G GG G G G GGG G G GG Sbjct: 229 GPGGFEGGPGGFGGGPGGF--GGGLGGFGGGPGG 260 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGG 860 G G G GG G G G GGG G G GG Sbjct: 236 GPGGFGGGPGGFGGGLGGF--GGGPGGFGGGPGG 267 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 958 GGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGG 860 GG G GGG G G G G GGG G G Sbjct: 241 GGGPGGFGGGLG-GFGGGPGGFGGGPGGHGGPG 272 Score = 26.6 bits (56), Expect = 5.2 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 924 GXGXXXXXXGGXGXXXXXXXGGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 G G GG G G GG GG G GG G GG GGG Sbjct: 196 GSGGPPPGPGGFGGFGGFGGEGHHHGGHGGF--GGGPGG--FEGGPGGFGGG 243 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 33.5 bits (73), Expect = 0.046 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 967 RXGGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEKXG 848 R GGG G GG G G G GG GG G GG + G Sbjct: 444 RTGGGSRGGRGGFGGRGGFG-GRGGFGGGRGRGRGGARSG 482 Score = 31.1 bits (67), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 864 GGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 GG G GG GRG G G G G G GG Sbjct: 447 GGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 845 GGGXXGGGXXXGAXGXXXGRGXGXGXXGXG 756 GGG GG G G GRG G G G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRG 475 Score = 27.5 bits (58), Expect = 3.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 849 GGGGGXGRGXXXGGGXXXXGEGGGGGG 769 GGG GRG GG G GG GGG Sbjct: 446 GGGSRGGRG-GFGGRGGFGGRGGFGGG 471 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 33.5 bits (73), Expect = 0.046 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 PP P PPPPP P PPP P PPP Sbjct: 753 PPAPIMGGPPPPPP-PPGVAGAGPPPPP--PPPP 783 Score = 30.7 bits (66), Expect = 0.32 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 PP PA P P P P P PPP P PP Sbjct: 734 PPPPAVIVPTPAP-----APIPVPPPAPIMGGPP 762 Score = 30.3 bits (65), Expect = 0.42 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 P P P+P P PPP PPP P P PP Sbjct: 744 PAPAPIPVPPPAPIMGGPPP--PPPPPGVAGAGPPPPPPPPP 783 Score = 29.9 bits (64), Expect = 0.56 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 887 PXPPXXXXXXPXPXPPPXPTXPPPP 961 P PP P P P P P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAP 756 Score = 29.9 bits (64), Expect = 0.56 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 864 PXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 P PA PPP P P PPP PP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPP 776 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 885 PPPPPXXXPXXPXPXPPPXPRXXP 956 PPPPP P P P P P P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAP 756 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 SPP P P P P P P P P PPP Sbjct: 731 SPPPPPPAVIVPTPAPAP-IPVPPPAPIMGGPPPP 764 Score = 27.9 bits (59), Expect = 2.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +1 Query: 772 PXPXPLP-XXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 P P P P P AP PP PPP P P PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPP--PPPPPPGVAGAGPPPPPPPP 782 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 864 PXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 P P PPP P P P PP PPP Sbjct: 746 PAPIPV-PPPAPIMGGPPPPPPPPGVAGAGPPP 777 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/19 (57%), Positives = 11/19 (57%), Gaps = 2/19 (10%) Frame = +2 Query: 917 PXPXPPPXPT--XPPPPXP 967 P P PPP P PPPP P Sbjct: 748 PIPVPPPAPIMGGPPPPPP 766 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 5/32 (15%) Frame = +2 Query: 887 PXPPXXXXXXPXPXPPP-----XPTXPPPPXP 967 P P P P PPP P PPPP P Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 27.1 bits (57), Expect = 4.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 770 PPPPPPSPXXXXPPP 814 PPPPPP PPP Sbjct: 763 PPPPPPGVAGAGPPP 777 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +1 Query: 802 PXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 P P P P P P PP P PP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPP 765 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 784 PLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPPXXGXP 912 P P P PPP PPP P R P P P Sbjct: 762 PPPPPPPGVAGAGPPPP-PPPPPAVSAGGSRYYAPAPQAEPEP 803 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 30.7 bits (66), Expect(2) = 0.077 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 770 PPPPPPSPXXXXPPPXXXXXXXXXXXXXXXXXXSXXXXXPXPPXXXXXXPXPXPPPXPTX 949 PPPPPP P S P P P PPP PT Sbjct: 189 PPPPPPPPPAVEDQAADANEPDDYYSSGRAV--SPEIPPTYTPKQADPLPAPPPPPPPTL 246 Query: 950 PP 955 PP Sbjct: 247 PP 248 Score = 20.6 bits (41), Expect(2) = 0.077 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 929 PPPXPTXPPPPXP 967 PPP T PP P Sbjct: 273 PPPPATPSQPPRP 285 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 31.5 bits (68), Expect = 0.18 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPP 938 PP PPPP P P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.9 bits (64), Expect = 0.56 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPPPXP 944 P PPPPP P PPP P Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.3 bits (60), Expect = 1.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPPPXP 944 P PPPPP P PPP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 826 PPXXPPPXPXSPPXXXRXXXPXPPXXG 906 PP PPP P P P PP G Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPPG 31 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Frame = +2 Query: 917 PXPXPPPX---PTXPPPPXP 967 P P PPP P+ PPPP P Sbjct: 10 PPPPPPPGFEPPSQPPPPPP 29 Score = 26.6 bits (56), Expect = 5.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 885 PPPPPXXXPXXPXPXPPPXPRXXPPP 962 PP P P P PP P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.5 bits (68), Expect = 0.18 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 +PP P+ PPP P P P PP P PPP Sbjct: 143 APPRPSI--PPPSPASAPPIP-SKAPPIPSSLPPP 174 Score = 31.1 bits (67), Expect = 0.24 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPP-PXXPPPXPXSPPXXXRXXXPXPPXXGXPXXP 921 P P P P P PP P PPP P S P P P P P Sbjct: 128 PAP-PTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP 177 Score = 30.3 bits (65), Expect = 0.42 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 784 PLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXPP 897 P+P P P PPP P SPP PP Sbjct: 159 PIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPP 196 Score = 29.5 bits (63), Expect = 0.74 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 PP P P P P PP P+ PPP Sbjct: 172 PPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 27.1 bits (57), Expect = 4.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXP 956 S P P+ PP P P P PPP P Sbjct: 148 SIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 873 AXXXPPPPPXXXPXXPXPXPP 935 A PPPPP P P PP Sbjct: 2 APAPPPPPPAPAPAAAAPAPP 22 Score = 26.2 bits (55), Expect = 6.9 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +1 Query: 778 PXPLPXXXPXAPXXXPP--PXXPPPXPXSPPXXXRXXXPXPPXXGXPXXP 921 P P P P P PP PPP + P P P P P Sbjct: 150 PPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPP 199 Score = 25.8 bits (54), Expect = 9.1 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = +1 Query: 679 PHTLTALRPSXSPPXXXFXXXXXXXXXXXXXPXPXPL-PXXXPXAPXXXPP--PXXPPPX 849 P T RPS PP P P L P P AP PP P P Sbjct: 139 PPTSAPPRPSIPPPSPA----SAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAV 194 Query: 850 PXSPPXXXRXXXPXPPXXGXP 912 P PP P PP P Sbjct: 195 PPMPP-----KVPPPPLSQAP 210 >SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 606 Score = 30.7 bits (66), Expect = 0.32 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +1 Query: 163 VGPYSQAILADKTLYISGILGL 228 +GPYSQ+I A+ ++ISG +GL Sbjct: 421 IGPYSQSICANGVVFISGQIGL 442 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 29.9 bits (64), Expect = 0.56 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 958 GGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGGEKXG 848 GG G GG G G G GG GG G GG G Sbjct: 141 GGFRGGRGGSRG-GFGGNSRGGFGGGSRGGFGGGSRG 176 Score = 28.7 bits (61), Expect = 1.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = -1 Query: 910 GXXXGGGGGXXXAGXGGEKXGXXXXXXXXXXXXGRXXXGGGGGXGXGXXXXGGWRG 743 G GG G G GG + G R GGG G GG RG Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRG 188 Score = 27.9 bits (59), Expect = 2.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 924 GXGXXXXXXGGXGXXXXXXXGGRXXGGGGGXGRGXXXGGGXXXXGEGGGGGG 769 G G GG G G G GGG RG GGG GG GG Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGG-SRG-GFGGGSRGGSRGGFRGG 185 Score = 27.9 bits (59), Expect = 2.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 958 GGXXRGXGGGXGXGXXGXXXGG-GGGXXXAGXGGEKXG 848 GG G GG G G GG GGG GG + G Sbjct: 148 GGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -1 Query: 961 GGGXXRGXGGGXGXGXXGXXXGGGGGXXXAGXGG 860 GG G GGG G G GG G G G Sbjct: 155 GGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRG 188 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPP 959 P P PP P P P P PP P P Sbjct: 115 PEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Score = 27.5 bits (58), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 861 PPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPP 959 P P PP P P P P PP P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVP 131 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 +P PPPPP P P P P P P Sbjct: 348 TPQVQGSRPPPPPPMPAPIYNVPNVPTVPTVSPNP 382 >SPBC800.08 |gcd10||translation initiation factor eIF-3 gamma subunit Gcd10|Schizosaccharomyces pombe|chr 2|||Manual Length = 462 Score = 27.5 bits (58), Expect = 3.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 250 CGGAEAXTRQALDXLRHVLEAGGASLESVVK 342 C G + T++ +D LR ++AGG E +K Sbjct: 88 CRGNQLMTQEEIDELRANIKAGGLRAEEAIK 118 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 27.5 bits (58), Expect = 3.0 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +2 Query: 776 PPPPSPXXXXPPPXXXXXXXXXXXXXXXXXXSXXXXXPXPPXXXXXXPXPXPPPXPTXPP 955 PP P P PP PP P PP T PP Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Query: 956 PPXP 967 P P Sbjct: 1219 VPTP 1222 Score = 26.6 bits (56), Expect = 5.2 Identities = 15/51 (29%), Positives = 15/51 (29%), Gaps = 1/51 (1%) Frame = +1 Query: 772 PXPXPLPXXXPXAPXXXPPPXXPPPXPXSPPXXXRXXXPXP-PXXGXPXXP 921 P P P P P PP P P P P P G P P Sbjct: 1180 PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 25.8 bits (54), Expect = 9.1 Identities = 11/35 (31%), Positives = 12/35 (34%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 +PP P PP P P P PPP Sbjct: 1031 APPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPP 1065 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXP----XPPPXPRXXPPP 962 S P P+ P P P P P P P P P PP Sbjct: 1075 SIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPP 1113 Score = 25.8 bits (54), Expect = 9.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 858 SPPXPAXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 +PP PA PP P P P P P P P Sbjct: 1149 APPVPAPSGAPPVPKPSVAAP-PVPAPSSGIPPVP 1182 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 4/35 (11%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPP----PXPRXXPPP 962 P PPPP P P PP P PPP Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 4/35 (11%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPP----PXPRXXPPP 962 P PPPP P P PP P PPP Sbjct: 229 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 4/35 (11%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPP----PXPRXXPPP 962 P PPPP P P PP P PPP Sbjct: 255 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 4/35 (11%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPP----PXPRXXPPP 962 P PPPP P P PP P PPP Sbjct: 281 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 26.6 bits (56), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 4/35 (11%) Frame = +3 Query: 870 PAXXXPPPPPXXXPXXPXPXPP----PXPRXXPPP 962 P PPPP P P PP P PPP Sbjct: 307 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +3 Query: 873 AXXXPPPPPXXXPXXPXPXPPPXPRXXPPP 962 A P P P P P P P + PPP Sbjct: 717 AVNSPAIKPQVTPAPPTPAPTPAVKHHPPP 746 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,954,102 Number of Sequences: 5004 Number of extensions: 54215 Number of successful extensions: 659 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 495302128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -