BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M20 (985 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 27 0.22 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 26 0.39 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 26 0.39 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 26 0.52 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 25 0.68 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 24 1.6 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 3.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 4.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.3 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 6.3 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 27.1 bits (57), Expect = 0.22 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 451 TVPINSSTLCATRTETGLLCSSRK 522 T+ INS T+C T + G+ C +K Sbjct: 146 TMEINSDTMCVTFSNLGIQCVKKK 169 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 26.2 bits (55), Expect = 0.39 Identities = 14/44 (31%), Positives = 14/44 (31%), Gaps = 1/44 (2%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXP 909 P PP P P P P PP P PPP P Sbjct: 68 PVALPPKREIPSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTP 111 Score = 22.2 bits (45), Expect = 6.3 Identities = 12/47 (25%), Positives = 12/47 (25%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 P P PP P P P P P P P P Sbjct: 65 PIRPVALPPKREIPSPKRSSPILAEKVSVSPTTPPTPSPPPEERLTP 111 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 26.2 bits (55), Expect = 0.39 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P P PP P PP PP PP P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 Score = 25.4 bits (53), Expect = 0.68 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPPXPXPPP 891 P P P P PP PP P PP P P P PP Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLP-PIFPP 191 Score = 25.0 bits (52), Expect = 0.90 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P P P P P PP P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 Score = 24.2 bits (50), Expect = 1.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P P P P PP P P P PP PP Sbjct: 153 PNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPP 191 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P P PP PP P P P PP PP P Sbjct: 155 PSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPI-FPPTMINP 196 Score = 22.6 bits (46), Expect = 4.8 Identities = 14/42 (33%), Positives = 14/42 (33%), Gaps = 3/42 (7%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPX---PXPPXPXPPPPXXPPPXP 771 P P P P P P PP P PP PP P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFP 190 Score = 21.8 bits (44), Expect = 8.4 Identities = 14/48 (29%), Positives = 14/48 (29%), Gaps = 1/48 (2%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP-PXXPXXPPPXPXP 974 P P P P PP P P P P P PP P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.8 bits (54), Expect = 0.52 Identities = 14/52 (26%), Positives = 14/52 (26%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P P P P P P P P P P PP P Sbjct: 71 PLPSDGTTSPEPDPEIPVAPEPAPLASPLVQEPGSSTTSATSGAVMASPPMP 122 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXP 917 P P P P P P P P P Sbjct: 80 PEPDPEIPVAPEPAPLASPLVQEP 103 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 25.4 bits (53), Expect = 0.68 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGG 810 GGG GGG G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -1 Query: 922 GXGXXXXGGXGGGGXGXXGGXGGG 851 G GG GGG G GGG Sbjct: 85 GENNDDSGGGRGGGRDGDRGDGGG 108 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXG 711 G GG GGG G G G G Sbjct: 85 GENNDDSGGGRGGGRDGDRGDGGG 108 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGG 840 GGG G G G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 24.2 bits (50), Expect = 1.6 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPPXPXP 885 P P P P P PP P PP P PP P P Sbjct: 149 PKYEPNPSIIDPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAPTMINP 196 Score = 21.8 bits (44), Expect = 8.4 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P P P P P P P Sbjct: 149 PKYEPNPSIIDPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAPTMINP 196 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPP 786 PP P P P P PP P Sbjct: 250 PPTPKPRPTKVSRRKPRPPRP 270 Score = 22.2 bits (45), Expect = 6.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 137 GVLADDFXSDYSGCDL 184 G++ +D+ S+Y CDL Sbjct: 71 GMVFNDYSSEYEKCDL 86 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 4.8 Identities = 11/42 (26%), Positives = 11/42 (26%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 PP P P P P P P P P P Sbjct: 392 PPEPVPTPEPQPTQTTESEPTQASEQPTESSTTQKPQTTKTP 433 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/29 (34%), Positives = 10/29 (34%) Frame = +2 Query: 887 PPXPXXXPXPPPXPXXPXPPXPXPPXXPP 973 PP P P PP P P P P Sbjct: 231 PPHPGLSPHPPHLSSHPAIVTPGPKQELP 259 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/29 (34%), Positives = 10/29 (34%) Frame = +2 Query: 887 PPXPXXXPXPPPXPXXPXPPXPXPPXXPP 973 PP P P PP P P P P Sbjct: 123 PPHPGLSPHPPHLSSHPAIVTPGPKQELP 151 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP 765 PPP P P P PPP Sbjct: 11 PPPAPQSAATPISSSGMTSPAAAPPP 36 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 712 PXPXPPXPXPPP 747 P P P P PPP Sbjct: 205 PEPVPSTPYPPP 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 226,821 Number of Sequences: 336 Number of extensions: 9474 Number of successful extensions: 83 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27926910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -