BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M20 (985 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 126 4e-29 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 114 1e-25 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 111 8e-25 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-22 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 100 4e-21 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 97 1e-20 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 95 8e-20 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 91 2e-18 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 6e-17 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 81 1e-15 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 79 5e-15 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 79 7e-15 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 7e-15 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 77 2e-14 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 77 2e-14 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 75 7e-14 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 75 1e-13 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 74 2e-13 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 73 4e-13 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 73 5e-13 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 73 5e-13 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 72 6e-13 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 70 3e-12 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 66 5e-11 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 63 4e-10 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 62 5e-10 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 62 7e-10 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 62 9e-10 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 62 9e-10 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 60 2e-09 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 60 4e-09 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 60 4e-09 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 59 5e-09 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 59 5e-09 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 59 5e-09 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 59 5e-09 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 59 6e-09 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 59 6e-09 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 58 8e-09 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 58 8e-09 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 58 1e-08 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 58 1e-08 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 58 1e-08 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 57 3e-08 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 57 3e-08 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 56 3e-08 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 56 6e-08 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 55 8e-08 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 55 8e-08 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 55 8e-08 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 55 8e-08 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 55 1e-07 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 54 1e-07 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 52 7e-07 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 52 7e-07 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 52 7e-07 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 52 9e-07 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 51 1e-06 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 51 1e-06 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 51 2e-06 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 51 2e-06 SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) 51 2e-06 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) 50 2e-06 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 50 3e-06 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 50 3e-06 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 49 5e-06 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_43730| Best HMM Match : Drf_FH1 (HMM E-Value=0.74) 49 7e-06 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 49 7e-06 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 49 7e-06 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 45 7e-06 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 48 9e-06 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) 48 1e-05 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 47 2e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20117| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 47 2e-05 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 47 2e-05 SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) 47 2e-05 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 47 3e-05 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 47 3e-05 SB_1366| Best HMM Match : Collagen (HMM E-Value=6.2e-05) 47 3e-05 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 46 4e-05 SB_27662| Best HMM Match : Pentapeptide_2 (HMM E-Value=6.4) 46 4e-05 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 46 4e-05 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 46 4e-05 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 46 5e-05 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 46 5e-05 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 45 8e-05 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) 45 8e-05 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 45 1e-04 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) 45 1e-04 SB_14418| Best HMM Match : GRP (HMM E-Value=1.8) 45 1e-04 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 44 2e-04 SB_504| Best HMM Match : GRP (HMM E-Value=2.8) 44 2e-04 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 44 2e-04 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 44 3e-04 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 44 3e-04 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 44 3e-04 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 44 3e-04 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 43 4e-04 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 43 4e-04 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 43 4e-04 SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 43 4e-04 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 42 6e-04 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15136| Best HMM Match : Peptidase_S13 (HMM E-Value=0.27) 42 6e-04 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 42 8e-04 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 42 8e-04 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 42 8e-04 SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) 42 8e-04 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 42 8e-04 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 42 8e-04 SB_33262| Best HMM Match : DOMON (HMM E-Value=2.7e-28) 42 0.001 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 42 0.001 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 42 0.001 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 42 0.001 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 42 0.001 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 42 0.001 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) 41 0.001 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 41 0.001 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 41 0.001 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 41 0.001 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 41 0.001 SB_10888| Best HMM Match : Collagen (HMM E-Value=7.5) 41 0.001 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 41 0.002 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 40 0.002 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 40 0.002 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 40 0.002 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 40 0.002 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 40 0.002 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 40 0.002 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 40 0.002 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 40 0.003 SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 40 0.003 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 40 0.003 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 40 0.003 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 40 0.004 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 40 0.004 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 40 0.004 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) 39 0.005 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 39 0.005 SB_22690| Best HMM Match : Collagen (HMM E-Value=0.042) 39 0.005 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 39 0.005 SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 39 0.005 SB_59310| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_10235| Best HMM Match : Coiled (HMM E-Value=6) 39 0.007 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) 38 0.009 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 38 0.009 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 38 0.009 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 38 0.009 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 38 0.009 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 38 0.012 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 38 0.012 SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 38 0.012 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 38 0.012 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 38 0.017 SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14) 38 0.017 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_51223| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 38 0.017 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 38 0.017 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 38 0.017 SB_64| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 38 0.017 SB_54760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_1557| Best HMM Match : Keratin_B2 (HMM E-Value=5) 37 0.022 SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_55828| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_52954| Best HMM Match : VacA2 (HMM E-Value=9.3) 37 0.029 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 37 0.029 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 37 0.029 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_41234| Best HMM Match : CASP_C (HMM E-Value=0.79) 36 0.038 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 36 0.038 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 36 0.038 SB_19205| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 36 0.038 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 36 0.038 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_25012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 36 0.050 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 36 0.050 SB_51860| Best HMM Match : ShTK (HMM E-Value=1.5e-09) 36 0.067 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 36 0.067 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 36 0.067 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 36 0.067 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 36 0.067 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 36 0.067 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 36 0.067 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_5763| Best HMM Match : Cadherin (HMM E-Value=0) 36 0.067 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 36 0.067 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 35 0.088 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 35 0.088 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 35 0.088 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) 35 0.088 SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) 35 0.088 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 35 0.088 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 35 0.088 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 35 0.12 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) 35 0.12 SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_23371| Best HMM Match : SRCR (HMM E-Value=0) 35 0.12 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 34 0.15 SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) 34 0.15 SB_30346| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 34 0.20 SB_39039| Best HMM Match : Drf_FH1 (HMM E-Value=6.4) 34 0.20 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 34 0.20 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 34 0.20 SB_18199| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 34 0.20 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 34 0.20 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 33 0.27 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.27 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 33 0.27 SB_50351| Best HMM Match : I-set (HMM E-Value=0.00016) 33 0.27 SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_45790| Best HMM Match : SERTA (HMM E-Value=2.8e-07) 33 0.27 SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) 33 0.27 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 33 0.36 SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 33 0.36 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.36 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_59449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.47 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 33 0.47 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.47 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 33 0.47 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 33 0.47 SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) 33 0.47 SB_1489| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.77) 33 0.47 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 33 0.47 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 33 0.47 SB_31893| Best HMM Match : I-set (HMM E-Value=2e-22) 33 0.47 SB_31849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 33 0.47 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 28 0.50 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 32 0.62 SB_48595| Best HMM Match : Transposase_29 (HMM E-Value=3.5) 32 0.62 SB_41215| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 32 0.62 SB_20539| Best HMM Match : VWA (HMM E-Value=5.1848e-44) 32 0.62 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 32 0.62 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.62 SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_24637| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 32 0.62 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 32 0.62 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 32 0.62 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 32 0.82 SB_48656| Best HMM Match : Extensin_2 (HMM E-Value=0.0009) 32 0.82 SB_48645| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.17) 32 0.82 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 32 0.82 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 32 0.82 SB_23713| Best HMM Match : Disintegrin (HMM E-Value=6.6e-05) 32 0.82 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 32 0.82 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_33702| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_30249| Best HMM Match : Extensin_2 (HMM E-Value=0.035) 32 0.82 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 32 0.82 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 31 1.1 SB_50981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 31 1.1 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 31 1.1 SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) 31 1.1 SB_14574| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11360| Best HMM Match : PDZ (HMM E-Value=0) 31 1.1 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 31 1.1 SB_8600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 31 1.1 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 31 1.1 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 31 1.1 SB_24023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_17748| Best HMM Match : DUF1312 (HMM E-Value=0.0024) 31 1.1 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 31 1.4 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 31 1.4 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 31 1.4 SB_32103| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 31 1.4 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 31 1.4 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 31 1.4 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 31 1.4 SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) 31 1.4 SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_12099| Best HMM Match : DUF1220 (HMM E-Value=4.3) 31 1.4 SB_5925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_58845| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) 31 1.9 SB_25010| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_23868| Best HMM Match : Gal_Lectin (HMM E-Value=1.4e-05) 31 1.9 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_5479| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_1015| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 31 1.9 SB_59678| Best HMM Match : Lectin_C (HMM E-Value=3.3e-19) 31 1.9 SB_59068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 31 1.9 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 31 1.9 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_30003| Best HMM Match : DUF906 (HMM E-Value=0) 30 2.5 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) 30 2.5 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 30 2.5 SB_28937| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-08) 30 2.5 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 30 3.3 SB_24760| Best HMM Match : PT (HMM E-Value=0.17) 30 3.3 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_2651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 30 3.3 SB_46326| Best HMM Match : Scramblase (HMM E-Value=0) 30 3.3 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 30 3.3 SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 30 3.3 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 3.3 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_16879| Best HMM Match : Stig1 (HMM E-Value=1) 30 3.3 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 30 3.3 SB_11167| Best HMM Match : Mucin (HMM E-Value=4.9) 30 3.3 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 29 4.4 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 4.4 SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_41099| Best HMM Match : VWA (HMM E-Value=0) 29 4.4 SB_38797| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 29 4.4 SB_21829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_55417| Best HMM Match : Kelch_2 (HMM E-Value=4.8e-23) 29 4.4 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_34739| Best HMM Match : DUF360 (HMM E-Value=0.39) 29 4.4 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 29 4.4 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_15610| Best HMM Match : DUF1174 (HMM E-Value=7.8) 29 4.4 SB_54430| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 5.2 SB_56163| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_40091| Best HMM Match : CNH (HMM E-Value=8.5e-07) 29 5.8 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 126 bits (303), Expect = 4e-29 Identities = 63/126 (50%), Positives = 63/126 (50%), Gaps = 4/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXPPXP-XPPPPXXP-PPXPXPPPP 786 PP PP P P P PPP P PP PPP P P PP P PPPP P PP P P P Sbjct: 92 PPYPPP--PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP-XPXXPPP 963 PP PPP PP PPP P PPP P PPP P P PP PPP P PPP Sbjct: 150 -PPPNPPYPPPLYPPPPNPPPPNAPYPPP-PYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Query: 964 XPXXPP 981 P PP Sbjct: 208 NPPYPP 213 Score = 122 bits (295), Expect = 3e-28 Identities = 61/128 (47%), Positives = 61/128 (47%), Gaps = 6/128 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P PPP P PPPP P P P P P PPPP P P P PPP P Sbjct: 110 PPPNPPYPPPPNAPYPPP-PNPPYPPPPNAPYP-PSPNAPYPPPPNPPYPPPLYPPPPNP 167 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPP--XPXPPPXXXXXPXXPXPPXXPPP----XPXXP 957 P P P PP PPP PP PPP P PPP P P PP PPP P P Sbjct: 168 PPPNAPYPP---PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Query: 958 PPXPXXPP 981 PP PP Sbjct: 225 PPNAPNPP 232 Score = 118 bits (285), Expect = 6e-27 Identities = 59/120 (49%), Positives = 59/120 (49%), Gaps = 2/120 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX-PPXPXPPPPXXP-PPXPXPPPPX 789 PP PP P P P PP P PPPP P P P PP P PPPP P PP P PPPP Sbjct: 126 PPPNPPYPPPPNAPYPPS-PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP PP PP P P PP P PPP P P PP P P P PPP P Sbjct: 185 PP---YPPPPNPPYPP-PPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP-PYPPPPNP 239 Score = 104 bits (250), Expect = 1e-22 Identities = 52/116 (44%), Positives = 52/116 (44%), Gaps = 10/116 (8%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP PP PP P P PP P PPPP P PP P P P P PPP PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 841 P---------PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP PPP PP P PPP P P PP PP P PPP P PP Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP--PPNPPYPPPPNPPYPP 197 Score = 99.5 bits (237), Expect = 4e-21 Identities = 54/153 (35%), Positives = 56/153 (36%), Gaps = 2/153 (1%) Frame = +3 Query: 531 SAQQXXXRCLLXTPCGSX*XXXXXXXXXPXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXX 710 S + CL+ CG P PP PP P P P PPP Sbjct: 66 SVEHPDAPCLVSAKCGGH-PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPY 124 Query: 711 XPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXP-PXXPXPP 887 PP P P P P PP P P PPP P PP P P P PP Sbjct: 125 PPPPNP---PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Query: 888 PPXPPXXXXP-XPXPXPPXXPXXPPPXPXPPPP 983 PP PP P P P PP P PPP P PPP Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 91.1 bits (216), Expect = 1e-18 Identities = 50/124 (40%), Positives = 50/124 (40%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P P PPPP PP P PP P P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN--PPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP-XPXPXPPXXPXXPPPXPX 971 PP P P PPP P PPP P P PPPP PP P P P P P P P P Sbjct: 181 PPPNPPYP----PPPNPPYPPP--PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP-PY 233 Query: 972 PPPP 983 PPPP Sbjct: 234 PPPP 237 Score = 68.5 bits (160), Expect = 8e-12 Identities = 40/117 (34%), Positives = 40/117 (34%), Gaps = 10/117 (8%) Frame = +2 Query: 662 PXPXXXXXXPPPPPXXXPXPXPXXPXPPPPXXP-PPXXXPPXPXXXPXXPXXPXPPXXXX 838 P P PPPP P P P PPPP P PP PP P P P PP Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Query: 839 XXXXXXXXXXXXXXXPP----PXPXXXPXPPPX-----PXXPXPPXPXPPXXPPXPP 982 PP P P P PPP P P P P PP PP P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 114 bits (274), Expect = 1e-25 Identities = 56/108 (51%), Positives = 56/108 (51%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G GGG GG G G GGG G GGG G G GGG GG GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG-GGGGGGGGGGGDG 827 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GGG G GGG G G G GG G G G GGGGG G GGG G Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 113 bits (272), Expect = 2e-25 Identities = 59/111 (53%), Positives = 59/111 (53%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG GG G G GGG G GGG GGG GGG GG G G GG GGGG G Sbjct: 769 GGGGGGDGGDGGGGGDG--GGGGGGGGGGGGGGGGGDGGGYGDGDG-GGGGGGGGGGGGG 825 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GGG G GG G G GGGGG G GGG G G G GG GG Sbjct: 826 DGGGYGDGGGFGDGG-GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 111 bits (266), Expect = 1e-24 Identities = 52/98 (53%), Positives = 52/98 (53%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG G G G GGG GGG GGG GG GGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG G G G GGG GGGG G GG G G G GGGGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 108 bits (260), Expect = 6e-24 Identities = 57/108 (52%), Positives = 57/108 (52%), Gaps = 1/108 (0%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G GGG G GGG GG G G GGG G G G GGG GGG GG GGG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG-GGGGGGGGGDGGGYG 831 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGG G G GGGG G GG G G G GGGGG G GGG Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGG 876 Score = 81.4 bits (192), Expect = 1e-15 Identities = 47/108 (43%), Positives = 47/108 (43%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G GG G G G GG GGGG G GG G G G GGG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGG---GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXG 662 GG G G GG G G GG GGGGG G G Sbjct: 826 DGG-GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 111 bits (267), Expect = 8e-25 Identities = 48/79 (60%), Positives = 48/79 (60%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P PPPPP P P P PP P PPPP PPP P PPPP PP PPP P Sbjct: 365 PPPPPPP----PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP----PPP---PP 413 Query: 835 PXPPPXPPPXPPPXPXPPP 891 P PPP PPP PPP P PPP Sbjct: 414 PPPPPAPPPPPPPPPPPPP 432 Score = 103 bits (247), Expect = 2e-22 Identities = 46/85 (54%), Positives = 46/85 (54%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPPP P P P PP P PPPP PPP P PPPP PP PP PPP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP-----------PPPPPPPPPPPP 414 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P PPP P PP PPP Sbjct: 415 PPPPAPPP-------PPPPPPPPPP 432 Score = 102 bits (245), Expect = 4e-22 Identities = 45/78 (57%), Positives = 45/78 (57%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PPP P PPPPP P P P PP P PPPP PPP P PPPP PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSP-PPPPQPPPPPPPPPPPPPPPPPPPP----PP--- 416 Query: 826 XXPPXPPPXPPPXPPPXP 879 PP PPP PPP PPP P Sbjct: 417 --PPAPPPPPPPPPPPPP 432 Score = 102 bits (244), Expect = 5e-22 Identities = 47/82 (57%), Positives = 47/82 (57%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXX 903 PP P PPPP PPP P PPPP PP PPP PP PPP PPP PPP P PPP Sbjct: 365 PPPPPPPPP--PPPSPPPPPPPPPPS---PPP----PPQPPPPPPPPPPPPPPPPP---- 411 Query: 904 XPXXPXPPXXPPPXPXXPPPXP 969 P P PP PPP P PPP P Sbjct: 412 -PPPPPPPAPPPPPPPPPPPPP 432 Score = 101 bits (241), Expect = 1e-21 Identities = 40/77 (51%), Positives = 40/77 (51%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P PPP P PPPPP P P P PP P PPPP PPP P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 796 PXXXXPPPXXXXPPXPP 846 P PPP PP Sbjct: 425 PPPPPPPPALRLACAPP 441 Score = 94.3 bits (224), Expect = 1e-19 Identities = 38/69 (55%), Positives = 38/69 (55%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP P P PPP P PPP PP P PPPP PP P P P PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP--PPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 957 PPXPXPPPP 983 PP P PPPP Sbjct: 424 PPPPPPPPP 432 Score = 77.8 bits (183), Expect = 1e-14 Identities = 32/68 (47%), Positives = 32/68 (47%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P PPP P PPPPP P P P PP P PPPP PPP P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 Query: 796 PXXXXPPP 819 P P Sbjct: 441 PRLRFTSP 448 Score = 76.2 bits (179), Expect = 4e-14 Identities = 37/91 (40%), Positives = 37/91 (40%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPPPP PP P PP P P P P P PPP P PPP PP Sbjct: 366 PPPPPPPPPPPSPP---------------PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P PPPP PP P P P P PP Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 75.4 bits (177), Expect = 7e-14 Identities = 38/95 (40%), Positives = 38/95 (40%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXX 868 PPPPP P P P P PPPP PPP PP P P P P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP-------------- 411 Query: 869 XXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPP 973 PPP P P PPP P P PP PP Sbjct: 412 -----PPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 68.5 bits (160), Expect = 8e-12 Identities = 40/96 (41%), Positives = 40/96 (41%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P P PPPPP PP P PP P P Sbjct: 365 PPPPPPPPPPP-----PSP----PPPPPPPPPSPPPPP---------------QPPPPPP 400 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P PPP P PPP PP P PPPP PP Sbjct: 401 PPPPPPPP----PPPPPPPPPPAPPPPPPPPPPPPP 432 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 102 bits (244), Expect = 5e-22 Identities = 59/125 (47%), Positives = 59/125 (47%), Gaps = 8/125 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXG--XXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG G GGG GG G G GGG G GG GG GGG GG GGG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG-GGATGGGGGA 302 Query: 806 XXXGG---XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG---GGGXXXXGXGGGXGXXG 645 GG GGG G GGG GGG GG G G GG GGG G GGG G G Sbjct: 303 TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Query: 644 XGXXG 630 G G Sbjct: 363 CGEDG 367 Score = 95.1 bits (226), Expect = 8e-20 Identities = 53/117 (45%), Positives = 53/117 (45%), Gaps = 2/117 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXXXXGGXX 786 GGG G GGG GG G G GG G GGG GGG G GG GGG GG Sbjct: 243 GGGATGGGGGATGGGG--GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G GGG G GG G G G GGG G GGG G G GG G Sbjct: 301 GATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 88.6 bits (210), Expect = 7e-18 Identities = 52/118 (44%), Positives = 52/118 (44%), Gaps = 5/118 (4%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GG GG G G GG G GG GG GGG G GG GG GGG Sbjct: 239 GRLGGGGATGGGGGATG------GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Query: 776 G--XGXGGGXXGGGGXGXGGXGXGXGXGG---GGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GGG GGGG G G G GG GGG G GGG G G GG G Sbjct: 293 GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 87.0 bits (206), Expect = 2e-17 Identities = 48/109 (44%), Positives = 48/109 (44%), Gaps = 2/109 (1%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G GG G G GGG GG GG GGG GG GGG G GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 755 XXGGGGXGXGGXGXGXG-XGGGGGXXXXGXGG-GXGXXGXGXXGGXXGG 615 G G G G G G G GGGGG G G G G G GG GG Sbjct: 299 GGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 84.6 bits (200), Expect = 1e-16 Identities = 52/116 (44%), Positives = 52/116 (44%), Gaps = 7/116 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGGGX 807 GG G GGG G GGG GG G G GG G GGG GG GG G GG GGG Sbjct: 265 GGATGGGGGATGGGGGATGGGG--GATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG 322 Query: 806 XXXGGXX----GGGGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GGG G GGG GGGG GG G G G G G G G Sbjct: 323 ATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSLEFGSG 378 Score = 82.2 bits (194), Expect = 6e-16 Identities = 46/111 (41%), Positives = 46/111 (41%), Gaps = 3/111 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GG G G G GG GGG G GG GGG GG GGG G G Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG--GGGATGGG 285 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG---GXXXXGXGGGXGXXGXGXXGGXXG 618 GG GGGG GG G G GGG G G GGG G G GG G Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGG 336 Score = 75.8 bits (178), Expect = 5e-14 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 3/127 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG--GGGXGXXGGXGGGXGXXGGG-XXXXG 815 GGGG G GGG G GG G G GG G GGG G GG GG G GG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G GG GG GGGGG G G G GG Sbjct: 302 ATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG----VTGGGGGATGGGGG 357 Query: 634 XXGGXXG 614 G G Sbjct: 358 PGSGGCG 364 Score = 63.3 bits (147), Expect = 3e-10 Identities = 45/125 (36%), Positives = 45/125 (36%), Gaps = 3/125 (2%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXXGX 803 GG G GG G G G GGG G GG GGG G GGG G G Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG--GG 285 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG--GXXXXXXGXGXXXXXGXGGXX 629 GG G GG G G GG GGGG G G G G GG Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVT 345 Query: 628 GGXXG 614 GG G Sbjct: 346 GGGGG 350 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 99.5 bits (237), Expect = 4e-21 Identities = 55/124 (44%), Positives = 55/124 (44%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG GG G GGG G GG GG GGG GG GGG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG-GGATGDGGGATG 98 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXXGG 627 GG GGG G GG G G G G G G GG G G GG G G G GG Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGG 158 Query: 626 XXGG 615 GG Sbjct: 159 ATGG 162 Score = 93.5 bits (222), Expect = 2e-19 Identities = 53/124 (42%), Positives = 53/124 (42%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG G GG GG G G GGG GG GGG GG GG GGG Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGG--GGGATGGHGGATGGGGGATG 91 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XGXXGG 627 GG GGG G GG G G G G G G GG G G GG G G G GG Sbjct: 92 DGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGG 151 Query: 626 XXGG 615 GG Sbjct: 152 ATGG 155 Score = 92.7 bits (220), Expect = 4e-19 Identities = 54/121 (44%), Positives = 54/121 (44%), Gaps = 3/121 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX---GGGXGGGXGGXXXXGGG 810 GG GGG G GGG GG G G GG G GGG GGG GG GG GGG Sbjct: 52 GGGGATGGGATGGGGGATGGGG--GATGGHGGATGGGGGATGDGGGATGGGGGATGGGGG 109 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GGG G GG GG G GG G G GGG G GGG G G G Sbjct: 110 ATGGHGGATGGGVGATGG-HGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 Query: 629 G 627 G Sbjct: 169 G 169 Score = 90.2 bits (214), Expect = 2e-18 Identities = 49/123 (39%), Positives = 49/123 (39%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G GG G GG G GG GG G G G GG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGG 106 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGXXGGX 624 GG GG G GGG GG G G G GG GG G G G G G GG Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGA 166 Query: 623 XGG 615 GG Sbjct: 167 TGG 169 Score = 69.7 bits (163), Expect = 3e-12 Identities = 46/128 (35%), Positives = 46/128 (35%), Gaps = 4/128 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG--GXXXXGX 812 G GG G GG G GG G GG GGG G GG GG G GG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGAT 97 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG--GXXXXXXGXGXXXXXGXG 638 G GG G GG G G GG G GG G G G G G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Query: 637 GXXGGXXG 614 G GG G Sbjct: 158 GATGGGGG 165 Score = 69.3 bits (162), Expect = 4e-12 Identities = 43/121 (35%), Positives = 43/121 (35%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG GG G G G G G G GG G G GGG GGG G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G GG G G GG GG G G G G GG G Sbjct: 111 TGGHGGATGGGVGATGGHGGATGGHGGATGG--HGGATGGGGGATGGGGGATGGGGGATG 168 Query: 625 G 623 G Sbjct: 169 G 169 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 97.5 bits (232), Expect = 1e-20 Identities = 55/107 (51%), Positives = 55/107 (51%), Gaps = 3/107 (2%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXGGXXXXGGGXXXXGGXXGG-GGXGXGGG 756 GG G G GGG G GGG GGG GG GG GGG G GG GG G GGG Sbjct: 123 GGGGRRGGGY--GGGRGGGGGYRSGGGYRGG-GGYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG G GG G G GGGGG G GGG G G G GG GG Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 94.7 bits (225), Expect = 1e-19 Identities = 53/109 (48%), Positives = 53/109 (48%), Gaps = 1/109 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G GGG GG G GGG G GG GG G G GG GGG Sbjct: 123 GGGGRRGG--GYGGGRGGGGGYRSGGGYRGGG-GYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Query: 797 G-GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG G GGG GGGG G GG G G G G GGG G GG G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 91.9 bits (218), Expect = 7e-19 Identities = 46/96 (47%), Positives = 46/96 (47%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG GG GG G G G G GG GGG GGG G GGG Sbjct: 133 GGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG 192 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GGGG G G GGGG G GG G G GGG Sbjct: 193 GGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 70.5 bits (165), Expect = 2e-12 Identities = 36/71 (50%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXX-GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGG G GGG G GG G G G GG GGGG G G GGG G GGG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG 209 Query: 808 GXGGXGXGXGG 776 G GG G G G Sbjct: 210 GGGGYGGGGYG 220 Score = 69.7 bits (163), Expect = 3e-12 Identities = 44/109 (40%), Positives = 44/109 (40%), Gaps = 1/109 (0%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGG G G GG G GG G G GG GGG G G GG G GGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG---YGGG 179 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXG 662 G GG G G GG G G GG GGGG G G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 95.1 bits (226), Expect = 8e-20 Identities = 45/121 (37%), Positives = 45/121 (37%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP P PPPP PP P P PP P P P Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 PPP P PPP PP PP P PP PP PPP PPP P Sbjct: 350 SMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMI 409 Query: 976 P 978 P Sbjct: 410 P 410 Score = 64.5 bits (150), Expect = 1e-10 Identities = 41/129 (31%), Positives = 41/129 (31%), Gaps = 8/129 (6%) Frame = +3 Query: 615 PXXPPXX---PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPX 785 P PP PP P P P PPPPP P PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP-----PPP 341 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP-----XPXPXPPXXPX 950 PP P P PPP PP PPPP PP P P P PP Sbjct: 342 SRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRG 401 Query: 951 XPPPXPXPP 977 PPP P P Sbjct: 402 APPPGPMIP 410 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/106 (27%), Positives = 29/106 (27%) Frame = +2 Query: 662 PXPXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXX 841 P P PPPP P P P PPP P P P P P Sbjct: 307 PPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP---PSMGMAPPPVGGAAP 363 Query: 842 XXXXXXXXXXXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 PPP P P P PP P PP P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP--PPGP 407 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 91.9 bits (218), Expect = 7e-19 Identities = 48/96 (50%), Positives = 48/96 (50%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GGG G GGG GG GG GG GGG G GGGG GGG G Sbjct: 1756 GGFGGGGG----GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G GG G G G GGG G GGG G G G Sbjct: 1812 GGGGGMGGGGEGMG-AAGGGMGAGGEGGGAGGGGGG 1846 Score = 90.6 bits (215), Expect = 2e-18 Identities = 50/98 (51%), Positives = 50/98 (51%), Gaps = 1/98 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXX 804 G G GGG G GGG GG G G GGG GGG GGG G G GG GGG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMG-----GGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGGG G G GGG G GG G G G GGGG Sbjct: 1812 GGGGGMGGGGEGMGA---AGGGMGAGGEGGGAGGGGGG 1846 Score = 89.8 bits (213), Expect = 3e-18 Identities = 47/90 (52%), Positives = 47/90 (52%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G GGG GGG GG GG GGG GG GGG G GGG GGG G GG G G Sbjct: 1759 GGGGGGGGMGGG-GGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G G G G G G GG G Sbjct: 1818 G-GGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 88.2 bits (209), Expect = 9e-18 Identities = 46/95 (48%), Positives = 46/95 (48%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG GG G G GGG G GGG GG GG GGG G GGGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG----GMAGGGGGMG 1811 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GGG GGGG G G G G G GG GG G GG Sbjct: 1812 GGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 83.0 bits (196), Expect = 3e-16 Identities = 44/87 (50%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGG 696 GG GGG GGG GG GGG GG GGGG GGG GGG G G GG G G G Sbjct: 1756 GGFGGGGGGGGMGG----GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Query: 695 GGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G G G G GG Sbjct: 1812 GGGGGMGGGGEGMGAAGGGMGAGGEGG 1838 Score = 68.1 bits (159), Expect = 1e-11 Identities = 45/101 (44%), Positives = 45/101 (44%), Gaps = 2/101 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 GGGGG G GGG G GG G G G GG GGG G GG GGG G GGG G Sbjct: 1762 GGGGGMGGGGGMAGGGGGMG-GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG----GG 1816 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G GG GGGGG Sbjct: 1817 MGGGGEGMGAAG-----------GGMGAGGEGGGAGGGGGG 1846 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 90.6 bits (215), Expect = 2e-18 Identities = 47/125 (37%), Positives = 47/125 (37%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX--PXPPPPX 789 PP P P P P PPPP P P PPPP P P PPPP Sbjct: 86 PPLVPAGVEAPT-PTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPI 144 Query: 790 XPPXXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P PPP P PP PPP P P P P PP PP P PPP Sbjct: 145 APATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Query: 967 PXXPP 981 P PP Sbjct: 205 PPPPP 209 Score = 81.8 bits (193), Expect = 8e-16 Identities = 45/120 (37%), Positives = 45/120 (37%), Gaps = 2/120 (1%) Frame = +1 Query: 616 PPXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P PP P PPPPP P P PPPP P PPPP Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATG--GPPPPPPIAPATGGPPPPPP 169 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P PPP P PPP PP PP PP P Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP----------PPPPPPILELAAPPPP 219 Score = 81.4 bits (192), Expect = 1e-15 Identities = 43/124 (34%), Positives = 43/124 (34%), Gaps = 4/124 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPXPPX---PXPPPPXXPPPXPXPPPP 786 P P P PPP P P P P P P P P PPPP P PPPP Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P PPP P P P PPP P P PP PPP P Sbjct: 156 PIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAA 215 Query: 967 PXXP 978 P P Sbjct: 216 PPPP 219 Score = 57.2 bits (132), Expect = 2e-08 Identities = 37/121 (30%), Positives = 37/121 (30%), Gaps = 3/121 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXX---PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P P PPPPP P P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAP--------ATGGPPPPPPIAPAT 161 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPX 965 P PP P P P P P PP PPP PP P P P PP PP Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPP---PPPPPPPPPILELAAPPP 218 Query: 966 P 968 P Sbjct: 219 P 219 Score = 52.0 bits (119), Expect = 7e-07 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P PP P P P P P PPP P P PP Sbjct: 76 PTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPP--------RAPETPSQAPSPP 127 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXPPPXPXXPP 981 PPP P PPP P PP PP P PPP P P Sbjct: 128 --PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 85.4 bits (202), Expect = 6e-17 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P P PPP P P Sbjct: 433 PPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXP 957 P P PPP P PPP P P P P P P P PP P P P Sbjct: 493 PPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 552 Query: 958 PPXPXXP 978 PP P Sbjct: 553 PPGASHP 559 Score = 83.4 bits (197), Expect = 3e-16 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 11/127 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-------PPXPXPXPXPPXPXPPPPXXPPPXPX 774 P PP P P P PP P PPP PP P P P P P P PPP Sbjct: 479 PRVPPPGAPHPRVP-PPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Query: 775 PP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--P 942 P PP P PPP P PPP P P P P P P P PP P Sbjct: 538 HPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Query: 943 XPXXPPP 963 P PPP Sbjct: 598 HPKVPPP 604 Score = 82.2 bits (194), Expect = 6e-16 Identities = 47/127 (37%), Positives = 47/127 (37%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P P PPP P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 482 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXP 957 P P PPP PPP P P P P P P P PP P P P Sbjct: 483 PPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 542 Query: 958 PPXPXXP 978 PP P Sbjct: 543 PPGAPHP 549 Score = 81.4 bits (192), Expect = 1e-15 Identities = 50/136 (36%), Positives = 50/136 (36%), Gaps = 14/136 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXPPPXPXPP--- 780 P PP P P P PP P PPP P P P P P P PPP P P PP Sbjct: 439 PRFPPPGAPHPRVP-PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Query: 781 ----PPXXPPXXXXPPPXXXXPPXPPPXPP-----PXPPPXPXPPPXXXXXPXXPXPPXX 933 PP P PPP P PPP P P P P PP P P P Sbjct: 498 HQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAS 557 Query: 934 PPPXPXXPPPXPXXPP 981 P P P P PP Sbjct: 558 HPRVPPPGAPHPRVPP 573 Score = 81.4 bits (192), Expect = 1e-15 Identities = 49/136 (36%), Positives = 49/136 (36%), Gaps = 14/136 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-------PPXPXPXPXPPXPXPPPPXXPPPXPX 774 P PP P P P PP P PPP PP P P P P P P PPP Sbjct: 469 PRVPPPGAPHPRVP-PPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Query: 775 PP--PPXXPPXXXXPPPXXXXPPXPPPXP-----PPXPPPXPXPPPXXXXXPXXPXPPXX 933 P PP P PPP P PPP PP P P PP P P P Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Query: 934 PPPXPXXPPPXPXXPP 981 P P P P PP Sbjct: 588 HPRVPPPGAPHPKVPP 603 Score = 79.0 bits (186), Expect = 5e-15 Identities = 47/131 (35%), Positives = 47/131 (35%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P PPP P P Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVP 512 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPP-----PXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PPP P PPP P P P P PP P P P P P Sbjct: 513 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVP 572 Query: 949 XXPPPXPXXPP 981 P P PP Sbjct: 573 PPGAPHPRVPP 583 Score = 79.0 bits (186), Expect = 5e-15 Identities = 46/127 (36%), Positives = 46/127 (36%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P PPP P P Sbjct: 463 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVP 522 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXP 957 P P PPP P PPP P P P P P P PP P P P Sbjct: 523 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVP 582 Query: 958 PPXPXXP 978 PP P Sbjct: 583 PPGTPHP 589 Score = 76.6 bits (180), Expect = 3e-14 Identities = 44/124 (35%), Positives = 44/124 (35%), Gaps = 3/124 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P P P PP P P P P P P PPP P P PP Sbjct: 399 PRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPP---G 455 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXPPPX 966 P PPP P PPP P P P P P P PP P P PPP Sbjct: 456 APHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPG 515 Query: 967 PXXP 978 P Sbjct: 516 APHP 519 Score = 75.8 bits (178), Expect = 5e-14 Identities = 46/131 (35%), Positives = 46/131 (35%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P P PPP P P Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVP 562 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPP-----PXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PPP P PPP P P P P PP P P P Sbjct: 563 PPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLP 622 Query: 949 XXPPPXPXXPP 981 PP PP Sbjct: 623 PPGPPYQRVPP 633 Score = 72.5 bits (170), Expect = 5e-13 Identities = 43/125 (34%), Positives = 43/125 (34%), Gaps = 4/125 (3%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P PPP P P Sbjct: 513 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVP 572 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PPP P PPP P P P P P PP P P Sbjct: 573 PPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVP 632 Query: 964 XPXXP 978 P P Sbjct: 633 PPGAP 637 Score = 70.1 bits (164), Expect = 3e-12 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 3/126 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXP-PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP P P P P P P PP P P P Sbjct: 429 PRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 488 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP--PPPXPPXXXXPXPXPXPPXXPXXPPPX 965 P P P P PPP P P PP P P PPP P P P P P P Sbjct: 489 PRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 548 Query: 966 PXPPPP 983 P PPP Sbjct: 549 PRVPPP 554 Score = 66.9 bits (156), Expect = 2e-11 Identities = 44/128 (34%), Positives = 44/128 (34%), Gaps = 11/128 (8%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXPPPXPXPPP------ 783 PP P PP P PPP P P P P PPP P P PP Sbjct: 363 PPDGPYTRA-LPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRV 421 Query: 784 -PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXX 954 P P PPP P PPP P P P P P P P PP P P Sbjct: 422 RPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 481 Query: 955 PPPXPXXP 978 PPP P Sbjct: 482 PPPGAPHP 489 Score = 66.5 bits (155), Expect = 3e-11 Identities = 41/122 (33%), Positives = 41/122 (33%), Gaps = 1/122 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P PP P PPP P P P P PP P P PP Sbjct: 389 PRVPSPGASHPRVP-PPGAPHPRVPPPGASHQRVRPPGAPHPRVP--PPGAPHPRFPPPG 445 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P PPP P PPP P P P P P P P PP P P P Sbjct: 446 APHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPG 505 Query: 973 XP 978 P Sbjct: 506 AP 507 Score = 65.3 bits (152), Expect = 7e-11 Identities = 39/118 (33%), Positives = 39/118 (33%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P PPP P P P P P P P PPP Sbjct: 529 PRVPPPGAPHPRVP-PPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP-GT 586 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP P PPP P P P P PP P P P Sbjct: 587 PHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLP 644 Score = 64.1 bits (149), Expect = 2e-10 Identities = 48/141 (34%), Positives = 48/141 (34%), Gaps = 19/141 (13%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXP--PPPPXPXPXPXPPX--------PXPPPPXXP 759 PP P P P P P P P PPP P P PP P P P P Sbjct: 373 PPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVP 432 Query: 760 PPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPX--PPP---XPXPPPXXXXXPXXP 918 PP P PP P PPP P PPP P PPP P PP P P Sbjct: 433 PPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Query: 919 XPPXXPPPXPXXPPPXPXXPP 981 P P P P PP Sbjct: 493 PPGAPHQRVPPPGAPHPRVPP 513 Score = 60.5 bits (140), Expect = 2e-09 Identities = 44/131 (33%), Positives = 44/131 (33%), Gaps = 14/131 (10%) Frame = +1 Query: 628 PPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPX----PPP----PXXPPPX---P 771 PP P PP P PPP P PP PPP P P P P Sbjct: 340 PPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHP 399 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PX 945 PPP P PP PP P P PP P P P P P PP P Sbjct: 400 RVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPP-PGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 946 PXXPPPXPXXP 978 P PPP P Sbjct: 459 PRVPPPGAPHP 469 Score = 59.3 bits (137), Expect = 5e-09 Identities = 36/117 (30%), Positives = 36/117 (30%), Gaps = 5/117 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P P P PP P P PP PPPP P PP P P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGS 356 Query: 826 XXPPXPPPXPP-----PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P P P PP P P P P P P P PP Sbjct: 357 HYSRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPP 413 Score = 54.8 bits (126), Expect = 1e-07 Identities = 44/138 (31%), Positives = 44/138 (31%), Gaps = 17/138 (12%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP-----PPPXXPPPXPXPP 780 PP P P P P PP PP PP P PPP P PP Sbjct: 317 PP--PGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPP 374 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPX------PPPXPPPXPXPPP----XXXXXPXXPXPPX 930 P PPP P P P PPP P PPP P P P Sbjct: 375 ---GEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRV 431 Query: 931 XPP--PXPXXPPPXPXXP 978 PP P P PPP P Sbjct: 432 PPPGAPHPRFPPPGAPHP 449 Score = 54.0 bits (124), Expect = 2e-07 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPX-PX 791 P PP P P P P P PP PP P Sbjct: 519 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPH 578 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P PPP P P PP P P P P PP PP P Sbjct: 579 PRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPI 638 Query: 972 PPPP 983 P Sbjct: 639 QRVP 642 Score = 47.6 bits (108), Expect = 2e-05 Identities = 38/127 (29%), Positives = 38/127 (29%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--P 783 PP P P P P P P P P P PP P P P P P P P P Sbjct: 563 PPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLP 622 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP-XPPXXP-PPXPXXP 957 P PP PPP P P P P P P P P P Sbjct: 623 PPGPPYQRVPPPGAPIQRVPLPETHHQRVPYSRATHHGEPSPRIPTVTPRVPISPLAESP 682 Query: 958 PPXPXXP 978 P P Sbjct: 683 QKSPLEP 689 Score = 45.2 bits (102), Expect = 8e-05 Identities = 51/195 (26%), Positives = 54/195 (27%), Gaps = 13/195 (6%) Frame = +1 Query: 436 SMMPKTVPINSSTLCATRTETGLLCSSRKAA*VLSKXXXDVY*XLH-VDRXDXAXXXXXX 612 S P + S L T T S AA V + Y H D + Sbjct: 239 SAYPSSYTAASVYLSETTTAASAYPPSYTAASVSTSTEPYYYYDPHQAPESDMSYQTAPG 298 Query: 613 XPPXXPPXXPXPXXPXPPPXPXXXXPP---PPPXPXPXPXPPXPXPPPPXXPPPXPXPP- 780 PP P P P P PP PPP P P P PP P Sbjct: 299 YPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHY 358 Query: 781 ---PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP- 948 PP P PP PPP P P P P P PP Sbjct: 359 SRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASH 418 Query: 949 --XXPP--PXPXXPP 981 PP P P PP Sbjct: 419 QRVRPPGAPHPRVPP 433 Score = 44.4 bits (100), Expect = 1e-04 Identities = 38/140 (27%), Positives = 38/140 (27%), Gaps = 17/140 (12%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPP----PXXXPPXXPXXXXXXXXXXXXXXXXPP 782 P PP P P P P PPP P PP P P Sbjct: 529 PRVPPPGAPHPRV---PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPG 585 Query: 783 XPXPXPPXPXXPXXXXPPPXXPX-------------PPPXPPXXPXPPPPXPPXXXXPXP 923 P P P P P PPP P PPP PP PPP P P P Sbjct: 586 TPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPP-GAPIQRVPLP 644 Query: 924 XPXPPXXPXXPPPXPXPPPP 983 P P P Sbjct: 645 ETHHQRVPYSRATHHGEPSP 664 Score = 37.1 bits (82), Expect = 0.022 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 7/124 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPP 783 P PP P PP P P P P P P P P P P Sbjct: 619 PRLPPPGPPYQRVPPPGAPIQRVPLPETHHQRVPYSRATHHGEPSPRIPTVTPRVPISPL 678 Query: 784 PXXPPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P PP P PPP P P P P PP P Sbjct: 679 AESPQKSPLEPVTATQMTPPVAPRVPPPSPRMQPPASGFLRMHPPASGFPRMHPPASGFP 738 Query: 958 PPXP 969 P Sbjct: 739 RMHP 742 Score = 35.5 bits (78), Expect = 0.067 Identities = 29/125 (23%), Positives = 29/125 (23%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP-PPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP P P P P PP P P Sbjct: 589 PRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLPETHH 648 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P PP P PPP P Sbjct: 649 QRVPYSRATHHGEPSPRIPTVTPRVPISPLAESPQKSPLEPVTATQMTPPVAPRVPPPSP 708 Query: 969 XPPPP 983 PP Sbjct: 709 RMQPP 713 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P PPP P PP PP Sbjct: 671 PRVPISPLAESPQKSPLE-PVTATQMTPPVAPRVPPPSPRMQPPASGFLRMHPPASGFPR 729 Query: 835 PXPPPXP-PPXPPPXPXPP 888 PP P PP PP Sbjct: 730 MHPPASGFPRMHPPASGPP 748 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 3/67 (4%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP---PXPPXXXXPXPXPXPPXXPXXP 956 P P P PP PPP P P PP P P P Sbjct: 682 PQKSPLEPVTATQMTPPVAPRVPPPSPRMQPPASGFLRMHPPASGFPRMHPPASGFPRMH 741 Query: 957 PPXPXPP 977 PP PP Sbjct: 742 PPASGPP 748 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 81.8 bits (193), Expect = 8e-16 Identities = 39/78 (50%), Positives = 39/78 (50%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP PPPP P P PP PPPP PPP PPPP PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPP--PPPTNGPPPP--PPPTNGPPP----P 397 Query: 835 PXPPPXPPPXPPPXPXPP 888 P P PPP PPP PP Sbjct: 398 PPPTNGPPPPPPPTNGPP 415 Score = 73.3 bits (172), Expect = 3e-13 Identities = 36/77 (46%), Positives = 36/77 (46%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P PPP PPPPP P P PP PPP PPP PPPP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPP-PPPPTNGPPPP--PPPTN 402 Query: 808 XPPPXXXXPPXPPPXPP 858 PPP PP P PP Sbjct: 403 GPPP----PPPPTNGPP 415 Score = 71.7 bits (168), Expect = 8e-13 Identities = 35/73 (47%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP---XPPPXPPP--XPXPPPXXXX 903 PPPP PP P PP PP PPP PP PPP PPP PPP P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPP----PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 402 Query: 904 XPXXPXPPXXPPP 942 P P PP PP Sbjct: 403 GPPPPPPPTNGPP 415 Score = 70.5 bits (165), Expect = 2e-12 Identities = 34/70 (48%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP---XPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PP P P PPP P PPPPP P P P PP PPPP PPP PPPP Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP--PPPTNGPPPP 407 Query: 787 XXPPXXXXPP 816 PP PP Sbjct: 408 --PPPTNGPP 415 Score = 70.1 bits (164), Expect = 3e-12 Identities = 31/69 (44%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXP--XPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P PP P P PPP P PPP PP PPPP PP P P P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 951 XPPPXPXPP 977 PPP PP Sbjct: 407 PPPPTNGPP 415 Score = 65.7 bits (153), Expect = 5e-11 Identities = 31/72 (43%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPX-PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 P PPP PP PPP PP PPP PP PPP PP P PP P Sbjct: 346 PPPPPTNNPPSP--PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 403 Query: 946 PXXPPPXPXXPP 981 P PPP PP Sbjct: 404 PPPPPPPTNGPP 415 Score = 46.4 bits (105), Expect = 4e-05 Identities = 30/91 (32%), Positives = 30/91 (32%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P PPPPP PP P PP P Sbjct: 347 PPPPTNNPP------SPPPPTNNTPPPPPPTNKPPPPP----------------PPTNGP 384 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP 887 PP P PPP PPP PP PP Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 45.2 bits (102), Expect = 8e-05 Identities = 31/97 (31%), Positives = 31/97 (31%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P PP P P PPPP PP PP P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPP-------------------PPPPTNGPPP 386 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 P PP PPP PP PPPP PP P Sbjct: 387 P--------PPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPP 786 P P PPPP PP P PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPP 902 P P PPP PP P PP PP Sbjct: 72 PSTPAPPP-PPPPPSSGPPLPP 92 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPP 888 P PPP PPP P PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 81.0 bits (191), Expect = 1e-15 Identities = 38/85 (44%), Positives = 38/85 (44%), Gaps = 6/85 (7%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPX--PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 P P PPPPP P P PP P PPP PPP PP PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 829 XPPXPPP----XPPPXPPPXPXPPP 891 PP PPP PPP PPP P PPP Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 80.6 bits (190), Expect = 2e-15 Identities = 38/95 (40%), Positives = 38/95 (40%), Gaps = 5/95 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PP PPPP P P PP P PPP PPP PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Query: 799 XXXXPPPXXXXPPXPPPX-----PPPXPPPXPXPP 888 PPP PP PPP PPP PPP P PP Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 79.8 bits (188), Expect = 3e-15 Identities = 35/85 (41%), Positives = 35/85 (41%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P PP PPPP P PP PP PPP PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPP 870 PPP PP PPP PPP PP Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 72.9 bits (171), Expect = 4e-13 Identities = 36/88 (40%), Positives = 36/88 (40%), Gaps = 4/88 (4%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX----PPPXPPPXPXPPPX 894 P PP PPP PPPP PPP P PPP PPP PPP PP Sbjct: 910 PSASPPGGSVPPP---PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Query: 895 XXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P PP P P PPP P P Sbjct: 967 GGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 56.0 bits (129), Expect = 4e-08 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX---PXPPPXXXXXPXXP 918 P PP PPP PP P P PP P PPP P PPP P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPP---PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Query: 919 ---XPPXXPPPXPXXPPPXPXXPP 981 PP PPP PPP P PP Sbjct: 967 GGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 50.4 bits (115), Expect = 2e-06 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 6/89 (6%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P P P PP PP PPP P PPP PP PPP P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPP---PPPPGGNAPLPPP--PPGGSAPSQPPPPGGNAPP 954 Query: 913 XPXPPXX--PPP----XPXXPPPXPXXPP 981 P PP PPP P PPP PP Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPP 983 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 2/84 (2%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXX--PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX 797 PP PP P P PPPP PP P PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP----------PPGGSAPPPGGGA 970 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPP 869 PP P P PPP P PPP PP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PPP PPP PPP P P PP P Sbjct: 894 PRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAP 953 Query: 943 XPXXPPPXPXXPP 981 P PP PP Sbjct: 954 PPPPPPGGSAPPP 966 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P P P P P P PPPP PP P Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 81.0 bits (191), Expect = 1e-15 Identities = 46/127 (36%), Positives = 46/127 (36%), Gaps = 6/127 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP--XPXPPPPXXPPPXPXPPPPXX 792 P PP P P P PP P PP P P P P P PP P P PP P Sbjct: 191 PPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPET 250 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP----XXPP 960 P P P P P P PP PP P P P P P PP P P Sbjct: 251 PLPPATPNP-FIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAP 309 Query: 961 PXPXXPP 981 P P PP Sbjct: 310 PNPHIPP 316 Score = 80.6 bits (190), Expect = 2e-15 Identities = 46/122 (37%), Positives = 46/122 (37%), Gaps = 5/122 (4%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX---PPPPXXPPPXPXPPPPXXPPX 801 P P P P PP P PP P P P PP P PP P P P P P PP Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 802 XXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P PP PP PP P PP P PP P PP P P PP Sbjct: 303 LFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPP---APPNPSIPPAPPNPSIPPAPPNLFI 359 Query: 976 PP 981 PP Sbjct: 360 PP 361 Score = 79.4 bits (187), Expect = 4e-15 Identities = 52/137 (37%), Positives = 52/137 (37%), Gaps = 16/137 (11%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P PP P PP P P P PP P PP P P P P Sbjct: 200 PTAPPTPPMPETPLPPGSPHI--PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATP 257 Query: 799 XXXXPP--PXXXXPPXPP----PXPP----PXPPPXP--XPPPXXXXXPXXPXPPXXP-- 936 PP P PP PP P PP P PP P P P P P P P Sbjct: 258 NPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPA 317 Query: 937 PPXPXXP--PPXPXXPP 981 PP P P PP P PP Sbjct: 318 PPNPYIPTAPPNPSIPP 334 Score = 79.0 bits (186), Expect = 5e-15 Identities = 48/130 (36%), Positives = 48/130 (36%), Gaps = 8/130 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP-PPXXP--PPXPX---- 774 P PP P P PP P PP PP P P PP P P PP P PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPA--PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHI 229 Query: 775 -PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P PP P P P PP P P PP P P P P P P P Sbjct: 230 PPAPPNPSKAIATPNPPMPETPLPPATPNPFIPP-ASPNPSIPPAPPNPSIPAPPNPSIP 288 Query: 952 XPPPXPXXPP 981 PP P PP Sbjct: 289 LAPPNPYIPP 298 Score = 77.0 bits (181), Expect = 2e-14 Identities = 50/136 (36%), Positives = 50/136 (36%), Gaps = 15/136 (11%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPP----PXXPPPXPX 774 P PP P P PP P PP P P P P P P PP P PP P Sbjct: 218 PHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLP-PATPNPFIPPASPNPSIPPAPPN 276 Query: 775 PPPPXXP-PXXXXPPPXXXXPPXPP----PXPPPXP--PPXPXPPPXXXXXPXXPXPPXX 933 P P P P PP PP PP P PP P PP P P P PP Sbjct: 277 PSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAP 336 Query: 934 PPPXPXXPPPXPXXPP 981 P P PP P PP Sbjct: 337 PNPSIPPAPPNPSIPP 352 Score = 75.4 bits (177), Expect = 7e-14 Identities = 49/130 (37%), Positives = 49/130 (37%), Gaps = 13/130 (10%) Frame = +1 Query: 619 PXXPPXXPXPXXPXP---PPXPXXXXPPPPPXPXPXPXPPXPX----PPPPXXPPPXPXP 777 P PP P P PP P PP P P P P P PP P P P P P Sbjct: 227 PHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAP-PNP 285 Query: 778 PPPXXPPXXXXP--PPXXXXPPXPP-PXPPPXPPP--XPXPPPXXXXXPXXPXPPXXP-P 939 P PP P PP P PP P PP PP P PP P P P P P Sbjct: 286 SIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAP 345 Query: 940 PXPXXPPPXP 969 P P PP P Sbjct: 346 PNPSIPPAPP 355 Score = 73.7 bits (173), Expect = 2e-13 Identities = 46/128 (35%), Positives = 46/128 (35%), Gaps = 7/128 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 PP P P P P PP P P P PP P PP P P PP P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAP-PSPPIPTAPPTPPMPETPLPPGSPHI 220 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXP-PPXPXXP 957 PP P PP P P P P P PP P P P P P PP P P Sbjct: 221 PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Query: 958 -PPXPXXP 978 PP P P Sbjct: 281 APPNPSIP 288 Score = 72.9 bits (171), Expect = 4e-13 Identities = 40/106 (37%), Positives = 40/106 (37%), Gaps = 6/106 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX---PPPXPXPPPPX 789 P PP P P P PP P PP P P P P P PP PP P PP Sbjct: 259 PFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAP 318 Query: 790 XPPXXXXPPPXXXXPPXPP-PXPPPXPPP--XPXPPPXXXXXPXXP 918 P PP PP PP P PP PP P PP P P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 60.9 bits (141), Expect = 2e-09 Identities = 38/119 (31%), Positives = 38/119 (31%), Gaps = 5/119 (4%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXP-PXXXX 810 P P PP P P P P PP PP P P PP P P Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPL 213 Query: 811 PPPXXXXPPXP--PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P P PP P P P P PP P P P P PP Sbjct: 214 PPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPP 272 Score = 56.0 bits (129), Expect = 4e-08 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 14/98 (14%) Frame = +1 Query: 616 PPXXP----PXXPXPXXPXPPPXPXXXXPPP-------PPXPXPXPXPPXP-XPPPPXXP 759 PP P P P P P PP P PP PP P P PP P P P P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNP 330 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPP--XPPPXP 867 P PP P PP PP PP PP PP P Sbjct: 331 SIPPAPPNPSIPP----APPNPSIPPAPPNLFIPPATP 364 Score = 55.2 bits (127), Expect = 8e-08 Identities = 40/125 (32%), Positives = 40/125 (32%), Gaps = 3/125 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P P P PP PP P P P Sbjct: 172 PETKPPKPPAP--STIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPH- 228 Query: 795 XPPXPXXPXXXXPPPXXPXP-PPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXP-PPX 965 PP P P P P P P PP P P PP P P P P P P P P Sbjct: 229 IPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIP-PAPPNPSIPAPPNPSI 287 Query: 966 PXPPP 980 P PP Sbjct: 288 PLAPP 292 Score = 55.2 bits (127), Expect = 8e-08 Identities = 39/130 (30%), Positives = 39/130 (30%), Gaps = 8/130 (6%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P PP PP P P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNP-P 246 Query: 795 XPPXPXXPXXXXP--PPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP----X 950 P P P P PP P P PP PP P PP P P PP P Sbjct: 247 MPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIP 306 Query: 951 XPPPXPXPPP 980 PP P PP Sbjct: 307 SAPPNPHIPP 316 Score = 48.0 bits (109), Expect = 1e-05 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 7/121 (5%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX- 797 P P P P P P P PP P P PP P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLF 304 Query: 798 -PPXPXXPXXXXPP--PXXPXPPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPX 965 P P P P P P PP P P PP P PP P P PP PP Sbjct: 305 IPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNL-FIPPAT 363 Query: 966 P 968 P Sbjct: 364 P 364 Score = 44.0 bits (99), Expect = 2e-04 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 2/109 (1%) Frame = +2 Query: 662 PXPXXXXXXPPPP-PXXXPXPX-PXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXX 835 P P P P P P P P P P P PP PP P P P P Sbjct: 257 PNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNL-FIPSAPPNPHIP 315 Query: 836 XXXXXXXXXXXXXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PP P PP P PP P PP P Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 79.0 bits (186), Expect = 5e-15 Identities = 49/125 (39%), Positives = 49/125 (39%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GGG G G G G G GGG G G G G G G G Sbjct: 229 GPGIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGS 288 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG---GGXXXXGXGGGXGXXGXGXXG 630 GG G G G G GG G GG G G G G G GG G GGG G G G Sbjct: 289 GGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 348 Query: 629 GXXGG 615 GG Sbjct: 349 RMQGG 353 Score = 77.8 bits (183), Expect = 1e-14 Identities = 57/136 (41%), Positives = 57/136 (41%), Gaps = 14/136 (10%) Frame = -3 Query: 980 GGXXGXG--GGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GGG G G G G G G GGG G G GGG G G G Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Query: 809 XXXXGG---XXGGGGXGXGG--GXXGGGGXGXG-GXGXGXGXGGG-----GGXXXXGXGG 663 GG GG G G GG G GGG G G G G G G GGG GG G G Sbjct: 302 RGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQ 361 Query: 662 GXGXXGXGXXGGXXGG 615 G G G G G G Sbjct: 362 GWGCRGMGCGWGCGNG 377 Score = 58.4 bits (135), Expect = 8e-09 Identities = 42/104 (40%), Positives = 42/104 (40%), Gaps = 6/104 (5%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGX---GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G G G G GGG G G G GG G GGG G G G G G Sbjct: 223 GNDLAQGPGIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGP---GGGWGRGQGRGMGRG 279 Query: 737 XGXGGXGXGXGXGGG---GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G G G G G GG G GGG G G G GG Sbjct: 280 PG-GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGG 322 Score = 54.8 bits (126), Expect = 1e-07 Identities = 42/99 (42%), Positives = 42/99 (42%), Gaps = 3/99 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGX 807 GG GG G G G G G GGG G GGG G G GGG G GGG Sbjct: 290 GGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLG--RGPGGGW 347 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGG 693 G GGG G G G G G G G G G G G GG Sbjct: 348 ----GRMQGGGMGRGPG-QGWGCRGMGCGWGCGNGRFGG 381 Score = 51.6 bits (118), Expect = 9e-07 Identities = 37/100 (37%), Positives = 37/100 (37%), Gaps = 1/100 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGG G G GGG G G G G G G G GGG G G G G G GG G Sbjct: 257 GGGWGQGPGGG-WGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGM 315 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G GG GGG Sbjct: 316 GR-GPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGG 354 Score = 49.6 bits (113), Expect = 4e-06 Identities = 32/72 (44%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGGXGXXGGGXXXXGXX 809 GGG G G GGG GG G G G GGG G G GG G G G G G G Sbjct: 297 GGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG-GGWGRMQGGGM 355 Query: 808 GXG-GXGXGXGG 776 G G G G G G Sbjct: 356 GRGPGQGWGCRG 367 Score = 47.2 bits (107), Expect = 2e-05 Identities = 44/125 (35%), Positives = 44/125 (35%), Gaps = 5/125 (4%) Frame = -1 Query: 985 GGGGGXGXGGG-XXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXG---GGXGXXGGGXXX 821 GGG G G G G G GG G G G GGG G G GG G GG G GG Sbjct: 265 GGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGG--G 322 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G GG G G GG G G G G G G G G G Sbjct: 323 WGRMQGGGMGRGPGG------GLGRGPGGGWGRMQGGGMGRGPGQGWGCRGMGCGWGCGN 376 Query: 640 GGXXG 626 G G Sbjct: 377 GRFGG 381 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 78.6 bits (185), Expect = 7e-15 Identities = 45/110 (40%), Positives = 45/110 (40%), Gaps = 1/110 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G G G G G G G G G G G G G G G G G G Sbjct: 258 GDGGGGGGGGDGDGDGDGDGDGD-GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGD 316 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGGXG 654 G G G G GGG GGG G G G G G G G G G G G G Sbjct: 317 GDGDGDGDGDGDGGGGDGGGDDGGDGDGDGDGDGDGDGDGDRDGDGDGDG 366 Score = 74.5 bits (175), Expect = 1e-13 Identities = 50/123 (40%), Positives = 50/123 (40%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G GGG GGG G G G G G Sbjct: 228 GDGDGDGDGD-GDGDGDGDGDGD-GDGDGDGDGDGGGGG-GGGDGDGDGDGDGDGDGDGD 284 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G G G G G G G G G G G G G G G G G G G G G G G GG Sbjct: 285 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG---DGDGDGGGGDGGGDDGGD 341 Query: 623 XGG 615 G Sbjct: 342 GDG 344 Score = 46.4 bits (105), Expect = 4e-05 Identities = 30/75 (40%), Positives = 30/75 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G GGG GGG GG G G G Sbjct: 297 GDGDGDGDGD-GDGDGDGDGDGD-GDGDGDGDGDG-GGGDGGGDDGGDGDGDGDGDGDGD 353 Query: 800 XGGXXGGGGXGXGGG 756 G G G G G G Sbjct: 354 GDGDRDGDGDGDGDG 368 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/79 (37%), Positives = 30/79 (37%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G G G GGG GGG G G G Sbjct: 293 GDGDGDGDGD-GDGDGDGDGDGD-GDGDGDGDGDGDGDG-GGGDGGGDDGGDGDGDGDGD 349 Query: 800 XGGXXGGGGXGXGGGXXGG 744 G G G G G G Sbjct: 350 GDGDGDGDRDGDGDGDGDG 368 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 78.6 bits (185), Expect = 7e-15 Identities = 54/128 (42%), Positives = 54/128 (42%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG--GXGXGGGXGGGXG---GGXGGXXXXG 816 GG G G G G G GG G G GG G G GGG G G GG G G Sbjct: 46 GGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGG 105 Query: 815 GGXXXXGGXXGG-GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG G G G G G G G GG G G GGGG G GGG G G G Sbjct: 106 GGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMA-GEGMGGGG-MAGEGMGGG-GMAGEG 162 Query: 638 XXGGXXGG 615 GG G Sbjct: 163 MGGGGIAG 170 Score = 74.1 bits (174), Expect = 2e-13 Identities = 52/127 (40%), Positives = 52/127 (40%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G G GG G G G GG G G GG G G Sbjct: 56 GGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSR 115 Query: 800 XG----GXXGGGGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGXGX 636 G G GG G G G G G G GG G G G GGGG G GGG G G G Sbjct: 116 GGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGM-GGGGMAGEGMGGG-GIAGEGI 173 Query: 635 XGGXXGG 615 GG G Sbjct: 174 SGGAIFG 180 Score = 68.1 bits (159), Expect = 1e-11 Identities = 46/122 (37%), Positives = 46/122 (37%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G GG GG G G G G GG G G GGG G G Sbjct: 26 GGMAGEGMGRGGIAGGRMGGGGMAGE------GMGRGGMAGEGMGGGGMAGEGMGRGGMA 79 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GGG G G G G G G GG G GG G G G G G G G Sbjct: 80 GEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRG-GMAGEGMGRGGM 138 Query: 620 GG 615 G Sbjct: 139 AG 140 Score = 65.7 bits (153), Expect = 5e-11 Identities = 44/119 (36%), Positives = 44/119 (36%), Gaps = 3/119 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXG---GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 GGG G G G G G G G GG GG GGG G G G Sbjct: 3 GGGMAGEGNNSNSTHGWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEG 62 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G G G GG G G GG G GGG G G G G G Sbjct: 63 MGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGG-GMAGEGMSRGGIAG 120 Score = 50.8 bits (116), Expect = 2e-06 Identities = 41/126 (32%), Positives = 41/126 (32%), Gaps = 2/126 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG-XXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 G GG GGG G G G G GG G G G G G G G G G Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRG 96 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXGXXXXXGXGGX 632 G G G G GG G G G G GG G G G GG Sbjct: 97 GIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGG- 155 Query: 631 XGGXXG 614 GG G Sbjct: 156 -GGMAG 160 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/92 (38%), Positives = 35/92 (38%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G G G GG G G G GGG G G G GG G Sbjct: 2 GGGGMAGEGNNSNSTHGWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMA-G 60 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG G G G G G G GG G Sbjct: 61 EGM-GGGGMAGEGMGRG-GMAGEGMGGGGMAG 90 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 77.4 bits (182), Expect = 2e-14 Identities = 39/84 (46%), Positives = 39/84 (46%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G GGG GGG G G G GG GG GG G G G GGGG G GG Sbjct: 36 GGGVGGGGGNGGGAGNGVGA-----GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGA 90 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G GG G G G Sbjct: 91 AGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 76.6 bits (180), Expect = 3e-14 Identities = 41/88 (46%), Positives = 41/88 (46%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GGG GG G GG G GGG GG GGG G GGG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAG----NGVGAGGCGCGGGNDGGNGGG-GAGNGGGGGGAG 83 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GG G G G GG GGG G GG G Sbjct: 84 NGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 76.2 bits (179), Expect = 4e-14 Identities = 43/91 (47%), Positives = 43/91 (47%), Gaps = 1/91 (1%) Frame = -3 Query: 887 GGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G G GG G GGG GG G G G G GG GG GGGG G GG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGG----GAGNGVGAGGCGCGGGNDGGN--GGGGAGNGGGGGG 81 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G GG G G G GG G Sbjct: 82 AGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 73.3 bits (172), Expect = 3e-13 Identities = 38/88 (43%), Positives = 38/88 (43%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G GGG G GGG G G G G G GGG G G G G GGG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCG---CGGGNDGGNGGGGAGNGGGGGGAGN 84 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG G G G G GGGG G GG Sbjct: 85 GGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 69.3 bits (162), Expect = 4e-12 Identities = 43/98 (43%), Positives = 43/98 (43%), Gaps = 1/98 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXGGXX 786 GG G GGG GG GGG G G G G G GG G GG G G G Sbjct: 28 GGVGVGVGGGGVGG----------GGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGG 77 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GGGG G GG G G G GG G G GG GG G Sbjct: 78 GGGGAG-NGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 68.1 bits (159), Expect = 1e-11 Identities = 34/80 (42%), Positives = 34/80 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GGG G G G G G G GG G GG GG GGG G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 800 XGGXXGGGGXGXGGGXXGGG 741 GG GGGG G GG G G Sbjct: 95 AGGNVGGGGSGGVGGNGGSG 114 Score = 66.9 bits (156), Expect = 2e-11 Identities = 37/81 (45%), Positives = 37/81 (45%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXX 678 GG G G GG GGG G GG G G G G G GG GG G G G G GGG Sbjct: 28 GGVGVGVGGGGVGGGG-----GNGGGAGNGVGAGGCGCGGGNDGGNG-GGGAGNGGGGGG 81 Query: 677 XGXGGGXGXXGXGXXGGXXGG 615 G GG G G G G GG Sbjct: 82 AGNGGAAGAAGAGAGGNVGGG 102 Score = 61.3 bits (142), Expect = 1e-09 Identities = 35/73 (47%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG-GXGXXGG--GXXXXG 815 G GGG G GGG G G G G GG GGGG G GG GG G G G G G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Query: 814 XXGXGGXGXGXGG 776 G GG G G GG Sbjct: 98 NVGGGGSG-GVGG 109 Score = 60.9 bits (141), Expect = 2e-09 Identities = 32/70 (45%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG- 806 GG G G GGG G GG G G G G G G G GG GGG GGG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 805 XGGXGXGXGG 776 G G G GG Sbjct: 88 AGAAGAGAGG 97 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG G G G G G GG G G G GGGG GG G G GG G G Sbjct: 46 GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Query: 805 XGGXGXGXG 779 G G G Sbjct: 106 GVGGNGGSG 114 Score = 56.8 bits (131), Expect = 3e-08 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG GGG G G G G G G GGG G GG G G G GGG G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGC---GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Query: 805 XGGXGXG 785 G G G Sbjct: 90 AAGAGAG 96 Score = 56.4 bits (130), Expect = 3e-08 Identities = 30/72 (41%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GG G G G G G GG G G G GGG G GG G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 805 XGG--XGXGXGG 776 GG G G GG Sbjct: 95 AGGNVGGGGSGG 106 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 77.0 bits (181), Expect = 2e-14 Identities = 47/127 (37%), Positives = 47/127 (37%), Gaps = 18/127 (14%) Frame = +1 Query: 655 PXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP---- 813 P P P P PPPP P P PP PPPP P PPP PP Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Query: 814 --PPXXXXPPXPPPX----PPPXPPPX---PXPPPXXXXXPXXPXPPXXPPPXPXX--PP 960 PP P PPP PPP PP P PPP P PP PP PP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 358 Query: 961 PXPXXPP 981 P P P Sbjct: 359 PPPGRAP 365 Score = 73.7 bits (173), Expect = 2e-13 Identities = 47/140 (33%), Positives = 47/140 (33%), Gaps = 19/140 (13%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP--------PP-PPXPXPXPXPPXPXPPPPXXPPPX 768 PP P P PPP P P PP PP P PP P P PPP Sbjct: 265 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPS 324 Query: 769 ----PXPPPPXX------PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P PPPP PP PP P PPP P P P PPP P Sbjct: 325 RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGK 384 Query: 919 XPPXXPPPXPXXPPPXPXXP 978 P PPP P P Sbjct: 385 INPPPPPPPAMDKPSFTNGP 404 Score = 72.5 bits (170), Expect = 5e-13 Identities = 44/129 (34%), Positives = 44/129 (34%), Gaps = 15/129 (11%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-PXXPPXX 804 PP P PP P PPPP P P PPP P P PPP PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Query: 805 XXPPPXXXXPPXPPPXPP--------PXPPPXPXPPPXXXXXPXXPXP------PXXPPP 942 P PP P PP P PPP PP P P P PPP Sbjct: 254 MRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 Query: 943 XPXXPPPXP 969 PPP P Sbjct: 314 LNATPPPPP 322 Score = 70.5 bits (165), Expect = 2e-12 Identities = 46/135 (34%), Positives = 46/135 (34%), Gaps = 19/135 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP P PP P PP P PPP PPP Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 275 Query: 796 PXXXXPPPXXXXPP------XPPPXPP-----PXPPP-----XPXPPPXXXXXPXXPXP- 924 PPP PP PP PP P PPP P PPP P P P Sbjct: 276 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPL 335 Query: 925 --PXXPPPXPXXPPP 963 PPP P PP Sbjct: 336 RGQIAPPPPPISKPP 350 Score = 70.1 bits (164), Expect = 3e-12 Identities = 51/145 (35%), Positives = 51/145 (35%), Gaps = 27/145 (18%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP-----PXPXPXPXPP--------XPXPP----PPXX 756 PP P PP P PPP P P P PP P PP P Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 310 Query: 757 PPP---XPXPPPPXXPPXXXXPPP--XXXXPPXPPPXPPP-----XPPPXPXPPPXXXXX 906 PPP P PPPP PPP PP PP PP PPP P P Sbjct: 311 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGG 370 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP PPP P PP Sbjct: 371 PPPPPPGRRPPSGKINPPPPP--PP 393 Score = 62.9 bits (146), Expect = 4e-10 Identities = 43/137 (31%), Positives = 43/137 (31%), Gaps = 15/137 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP----PXPXXXXPPPPP------XPXPXPXPPXPXPPPPXXPPP 765 PP P P P P PPPPP P P P PPPP P Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 225 Query: 766 XP--XPPPPXXPPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPX 930 PPP PPP PP P P PPP PPP P PP Sbjct: 226 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPT 285 Query: 931 XPPPXPXXPPPXPXXPP 981 PP P PP Sbjct: 286 RGPPSNSFTTQGPPLPP 302 Score = 58.8 bits (136), Expect = 6e-09 Identities = 39/132 (29%), Positives = 39/132 (29%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP--------XP 771 PP P P PPP P P PP PPPP P Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTN 192 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP--PPX 945 PPPP PPP PPP P P PP P PP PP Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 252 Query: 946 PXXPPPXPXXPP 981 P P PP Sbjct: 253 PMRGPTSGGEPP 264 Score = 56.8 bits (131), Expect = 3e-08 Identities = 39/136 (28%), Positives = 39/136 (28%), Gaps = 13/136 (9%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXP-- 788 P PP P P P PPP P P PP P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 275 Query: 789 ---XPXPPXPXXP--------XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P PP P PP P P PP PPPP P P P P P Sbjct: 276 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-PPP 334 Query: 936 PXXPXXPPPXPXPPPP 983 PPP P PP Sbjct: 335 LRGQIAPPPPPISKPP 350 Score = 55.6 bits (128), Expect = 6e-08 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP-XX 792 PP P P PPP PPPP P PP PPP PPPP Sbjct: 125 PPGFRTTAPPPKNSSPPPP--FGAPPPPDRGGQLAKKPSQGSFPP--PPPMGKPPPPSGN 180 Query: 793 PPXXXXPPPXXXXPPXPP-------PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP- 948 P PP PP P PP P PPP PP P Sbjct: 181 KPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPL 240 Query: 949 XXPPPXPXXPP 981 PPP PP Sbjct: 241 PAPPPGENRPP 251 Score = 46.4 bits (105), Expect = 4e-05 Identities = 28/94 (29%), Positives = 28/94 (29%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P PPP PPPP P PP PP P P Sbjct: 118 PRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKP--P 175 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 176 PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPP 209 Score = 36.7 bits (81), Expect = 0.029 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPP 786 P PP P PPPP P P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXP 924 PPP PPP P PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPP 765 PPP P P P PP P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPP 893 PPP P PPP P P PPP Sbjct: 5 PPPPGPPPPPSAPSGPVKPPP 25 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPP 819 PPP PPP PPPP P PPP Sbjct: 2 PPP--PPPPGPPPPPSAPSGPVKPPP 25 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PP P P P P P PPP PP PP P P Sbjct: 430 PPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PPPP PP P P P P P PPP Sbjct: 2 PPPPPPP---GPPPPPSAPSGPVKPPP 25 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXP 909 PPP PPP PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPP 798 P PPPP PPP P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXP 923 PPP PP P PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGG 813 GGG G GG GG GGG G GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GGG GGGG GG G G GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PPP P PPP P P P PPP Sbjct: 2 PPPPPPPGPPP----PPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GGG GGG G GGG GG G G G G G Sbjct: 77 GGGGFSGGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAGPRG 120 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPP 783 P P PP PPPP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 PPP P PP PP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GGGG GG G G GG GG G Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG GGGG GGG GG G GG G Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAG 100 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P PPP P PPPPP P P P Sbjct: 2 PPPPPPPG---PPPPPSAPSGPVKPPP 25 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXP 952 PPP P P PP P P P P Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPX--------PXPXPPXPXPPPPXXPPPXPXPPPP 786 PPP P P P P P PPP P P PPPP Sbjct: 429 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP 699 PP P P P PP P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P PPPP PP PP P PPP Sbjct: 2 PPPPPPPGPP---PPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPP PP PP PPP P P PP Sbjct: 2 PPPPP--PPGPP--PPPSAPSGPVKPP 24 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 914 PPPXPXXPXPPXPXPPXXPPXPP 982 PPP P PP P P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXG 906 G GGG G GGG GG G G Sbjct: 76 GGGGGFSGGGGGSMGGGGLGG 96 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 740 PPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 PPPP PPP PP P P P P P Sbjct: 2 PPPP--PPPG--PPPPPSAPSGPVKPPP 25 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 908 PXPPPXPXXPXPP-XPXPPXXPP 973 P PPP P P PP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPP 798 P P PPP PPP P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PPP P P PP P P PPP Sbjct: 2 PPPPP-----PPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +1 Query: 811 PPPXXXXPPXPPPXP--PPXPPP 873 PPP PP PP P P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 892 GGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GG GGG G GGG G G GG G Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAG 100 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 77.0 bits (181), Expect = 2e-14 Identities = 47/127 (37%), Positives = 47/127 (37%), Gaps = 18/127 (14%) Frame = +1 Query: 655 PXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP---- 813 P P P P PPPP P P PP PPPP P PPP PP Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Query: 814 --PPXXXXPPXPPPX----PPPXPPPX---PXPPPXXXXXPXXPXPPXXPPPXPXX--PP 960 PP P PPP PPP PP P PPP P PP PP PP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 270 Query: 961 PXPXXPP 981 P P P Sbjct: 271 PPPGRAP 277 Score = 73.7 bits (173), Expect = 2e-13 Identities = 47/140 (33%), Positives = 47/140 (33%), Gaps = 19/140 (13%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP--------PP-PPXPXPXPXPPXPXPPPPXXPPPX 768 PP P P PPP P P PP PP P PP P P PPP Sbjct: 177 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPS 236 Query: 769 ----PXPPPPXX------PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P PPPP PP PP P PPP P P P PPP P Sbjct: 237 RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGK 296 Query: 919 XPPXXPPPXPXXPPPXPXXP 978 P PPP P P Sbjct: 297 INPPPPPPPAMDKPSFTNGP 316 Score = 72.5 bits (170), Expect = 5e-13 Identities = 44/129 (34%), Positives = 44/129 (34%), Gaps = 15/129 (11%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-PXXPPXX 804 PP P PP P PPPP P P PPP P P PPP PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Query: 805 XXPPPXXXXPPXPPPXPPPX--------PPPXPXPPPXXXXXPXXPXP------PXXPPP 942 P PP P PPP PPP PP P P P PPP Sbjct: 166 MRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 Query: 943 XPXXPPPXP 969 PPP P Sbjct: 226 LNATPPPPP 234 Score = 70.5 bits (165), Expect = 2e-12 Identities = 46/135 (34%), Positives = 46/135 (34%), Gaps = 19/135 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP P PP P PP P PPP PPP Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 187 Query: 796 PXXXXPPPXXXXPP------XPPPXPP-----PXPPP-----XPXPPPXXXXXPXXPXP- 924 PPP PP PP PP P PPP P PPP P P P Sbjct: 188 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPL 247 Query: 925 --PXXPPPXPXXPPP 963 PPP P PP Sbjct: 248 RGQIAPPPPPISKPP 262 Score = 70.1 bits (164), Expect = 3e-12 Identities = 51/145 (35%), Positives = 51/145 (35%), Gaps = 27/145 (18%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP-----PXPXPXPXPP--------XPXPP----PPXX 756 PP P PP P PPP P P P PP P PP P Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 222 Query: 757 PPP---XPXPPPPXXPPXXXXPPP--XXXXPPXPPPXPPP-----XPPPXPXPPPXXXXX 906 PPP P PPPP PPP PP PP PP PPP P P Sbjct: 223 PPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGG 282 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP PPP P PP Sbjct: 283 PPPPPPGRRPPSGKINPPPPP--PP 305 Score = 62.9 bits (146), Expect = 4e-10 Identities = 43/137 (31%), Positives = 43/137 (31%), Gaps = 15/137 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP----PXPXXXXPPPPP------XPXPXPXPPXPXPPPPXXPPP 765 PP P P P P PPPPP P P P PPPP P Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 137 Query: 766 XP--XPPPPXXPPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPX 930 PPP PPP PP P P PPP PPP P PP Sbjct: 138 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPT 197 Query: 931 XPPPXPXXPPPXPXXPP 981 PP P PP Sbjct: 198 RGPPSNSFTTQGPPLPP 214 Score = 58.8 bits (136), Expect = 6e-09 Identities = 39/132 (29%), Positives = 39/132 (29%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP--------XP 771 PP P P PPP P P PP PPPP P Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTN 104 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP--PPX 945 PPPP PPP PPP P P PP P PP PP Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPP 164 Query: 946 PXXPPPXPXXPP 981 P P PP Sbjct: 165 PMRGPTSGGEPP 176 Score = 56.8 bits (131), Expect = 3e-08 Identities = 39/136 (28%), Positives = 39/136 (28%), Gaps = 13/136 (9%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXP-- 788 P PP P P P PPP P P PP P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 187 Query: 789 ---XPXPPXPXXP--------XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P PP P PP P P PP PPPP P P P P P Sbjct: 188 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLP-PPP 246 Query: 936 PXXPXXPPPXPXPPPP 983 PPP P PP Sbjct: 247 LRGQIAPPPPPISKPP 262 Score = 55.6 bits (128), Expect = 6e-08 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP-XX 792 PP P P PPP PPPP P PP PPP PPPP Sbjct: 37 PPGFRTTAPPPKNSSPPPP--FGAPPPPDRGGQLAKKPSQGSFPP--PPPMGKPPPPSGN 92 Query: 793 PPXXXXPPPXXXXPPXPP-------PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP- 948 P PP PP P PP P PPP PP P Sbjct: 93 KPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPL 152 Query: 949 XXPPPXPXXPP 981 PPP PP Sbjct: 153 PAPPPGENRPP 163 Score = 46.4 bits (105), Expect = 4e-05 Identities = 28/94 (29%), Positives = 28/94 (29%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P PPP PPPP P PP PP P P Sbjct: 30 PRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKP--P 87 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 88 PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPP 121 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PP P P P P P PPP PP PP P P Sbjct: 342 PPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 390 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 8/50 (16%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPX--------PXPXPPXPXPPPPXXPPPXPXPPPP 786 PPP P P P P P PPP P P PPPP Sbjct: 341 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 390 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 75.4 bits (177), Expect = 7e-14 Identities = 45/110 (40%), Positives = 45/110 (40%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG G G G G G G GGG G G GGG G G G GG G G G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G GG G G G GGG G G G G G G G Sbjct: 64 WGRMQGGGMGRGPGG-GLGRGPGGGWGRMQEGGMGRGPGQGWGCRGMGCG 112 Score = 72.9 bits (171), Expect = 4e-13 Identities = 49/119 (41%), Positives = 49/119 (41%), Gaps = 1/119 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GG G GGG G G GG G G GGG G G GGG G G G GG Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GG G G GG G G GG G G G G G G G G G Sbjct: 64 WGRMQGGGMGRGPGGGLGRGPGG-GWGRMQEGGMG---RGPGQGWGCRGMGCGWGCGNG 118 Score = 72.9 bits (171), Expect = 4e-13 Identities = 49/125 (39%), Positives = 49/125 (39%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGG-XXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G GGG G GGG G G G G G G GGG G GGG G G G Sbjct: 7 GWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Query: 806 XXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG G G G G G GG G GG G G G G G G G G G G G Sbjct: 67 MQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRGMGCGWGCGNGRFGEGCLD 126 Query: 629 GXXGG 615 G Sbjct: 127 SMCSG 131 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/75 (44%), Positives = 33/75 (44%), Gaps = 6/75 (8%) Frame = -1 Query: 985 GGGGGXGXGGG-XXGXXGGXGXGXGXXXXGGXGGG-----GXGXXGGXGGGXGXXGGGXX 824 GGG G G GGG G GG G G G G GGG G G G GGG G GG Sbjct: 13 GGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGM 72 Query: 823 XXGXXGXGGXGXGXG 779 G G G G G G Sbjct: 73 GRGPGGGLGRGPGGG 87 Score = 50.8 bits (116), Expect = 2e-06 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGG-GXXXXG 815 G GGG G G GG G G G G G G G GGG G G G G G GG G G Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGG 70 Query: 814 XXG---XGGXGXGXGG 776 G GG G G GG Sbjct: 71 GMGRGPGGGLGRGPGG 86 Score = 48.8 bits (111), Expect = 7e-06 Identities = 39/119 (32%), Positives = 39/119 (32%), Gaps = 3/119 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G G G G G G G G GG G G G G G GGG G GG G G Sbjct: 4 GPGGWGRGSG-GGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGG 62 Query: 805 XGG--XGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G G G G GG G G G G G G G Sbjct: 63 GWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRGMGCGWGCGNGRFG 121 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 2/71 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXG-XXGGGXXXXGX 812 GGG G GG G G G G G GG G G G G G GGG G GG Sbjct: 45 GGGWGRMQGG---GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPG 101 Query: 811 XGXGGXGXGXG 779 G G G G G Sbjct: 102 QGWGCRGMGCG 112 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 74.9 bits (176), Expect = 9e-14 Identities = 40/113 (35%), Positives = 40/113 (35%), Gaps = 5/113 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP---PPX 789 P P P P P P PPP P P P P P P P PP P PP P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPV 1085 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP--XXPXPPXXPPP 942 PP P P P PP P P P P P P P PP P P Sbjct: 1086 PPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKPKP 1138 Score = 72.9 bits (171), Expect = 4e-13 Identities = 44/124 (35%), Positives = 44/124 (35%), Gaps = 6/124 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--- 783 PP P P P P P P P P P P PP P PPP Sbjct: 995 PPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAV 1054 Query: 784 PXXPPXXXXPPPXXXXPPXPPPX-PPPXPPPXPXPPP-XXXXXPXXPXPPXXPPPXPXXP 957 P PP PPP P PPP PPP P PPP P P P PPP P Sbjct: 1055 PIPPPRKPSPPPSE---PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKP 1111 Query: 958 PPXP 969 P P Sbjct: 1112 TPAP 1115 Score = 71.7 bits (168), Expect = 8e-13 Identities = 43/111 (38%), Positives = 43/111 (38%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P PP P PP PP P P P P PPP P P P P P PP Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSP--PPSEPA 1070 Query: 811 PPPXXXXPPXPPPXPPPXPPP-XPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP P PP P PPP P P P P P PP P P P P Sbjct: 1071 PPPRQ---PPPPSTSQPVPPPRQPDPIPTNPAHPTEP-PPRQPKPTPAPRP 1117 Score = 66.1 bits (154), Expect = 4e-11 Identities = 42/121 (34%), Positives = 42/121 (34%), Gaps = 6/121 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P PPP P P P P P P P PP P PPP P Sbjct: 1019 PPGPTEQPVPPKRKASP-PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Query: 796 P---XXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP 960 P PPP P P P P PP P P P P PP P P Sbjct: 1078 PPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKPK 1137 Query: 961 P 963 P Sbjct: 1138 P 1138 Score = 64.9 bits (151), Expect = 1e-10 Identities = 42/118 (35%), Positives = 42/118 (35%), Gaps = 5/118 (4%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP---PXXPPXXXX 810 P P P P P P P PP P P PP PP P PP Sbjct: 991 PHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQP--VPPKRKASPPSAQPLPPPRKPS 1048 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXX--PPPXPXXPPPXPXXP 978 PPP P PPP P PP P PPP P PP P P P P P P P Sbjct: 1049 PPPSAV--PIPPPRKPSPPPSEPAPPPRQ------PPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 60.5 bits (140), Expect = 2e-09 Identities = 43/126 (34%), Positives = 43/126 (34%), Gaps = 10/126 (7%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXX---PPP---PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P PP P P PP P P PP PP P P P P Sbjct: 991 PHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQP-LPPPRKPSP 1049 Query: 793 PPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPP---XXXXXPXXPXPPXXPPPXPXXPP 960 PP PP P P P P P PPP PPP P P P P P PP Sbjct: 1050 PPSAVPIPP----PRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Query: 961 PXPXXP 978 P P Sbjct: 1106 PRQPKP 1111 Score = 59.3 bits (137), Expect = 5e-09 Identities = 32/93 (34%), Positives = 32/93 (34%), Gaps = 1/93 (1%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP-XPX 882 P P P PP PP P P P P PP P PPP P Sbjct: 989 PIPHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPS 1048 Query: 883 PPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP P P P P P P PP Sbjct: 1049 PPPSAVPIP----PPRKPSPPPSEPAPPPRQPP 1077 Score = 56.8 bits (131), Expect = 3e-08 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 5/125 (4%) Frame = +3 Query: 624 PPXXPPXPXXXXXPX-----PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P PP P P P PPP PP PP Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PP P PPP P P P P P PPP P P P P P P Sbjct: 1075 QPPPPSTSQP---VPPPRQPDPIPTNPAHPTEPPPRQP---KPTPAPRPRSWVESQPELH 1128 Query: 969 XPPPP 983 PPPP Sbjct: 1129 RPPPP 1133 Score = 55.6 bits (128), Expect = 6e-08 Identities = 35/110 (31%), Positives = 35/110 (31%), Gaps = 1/110 (0%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P PP P P PP P P PP P Sbjct: 979 PVPASRQSKAPIPHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPV---PPKRKASP 1035 Query: 835 PXPPPXPPPX-PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PPP P P P P P PP P P P PPP P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSP-PPSEPAPPPRQPPPPSTSQP 1084 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/120 (25%), Positives = 31/120 (25%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P PPP P P PP P Sbjct: 1022 PTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPST 1081 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P PP P P P P P PP P P Sbjct: 1082 SQPVPP-PRQPDPIPTNPAHPTEPP--PRQPKPTPAPRPRSWVESQPELHRPPPPIKPKP 1138 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 74.5 bits (175), Expect = 1e-13 Identities = 41/121 (33%), Positives = 41/121 (33%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P PPP P PPPPP P PPP P PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PPP P P P PP P P P P P P Sbjct: 153 CHQTQVVHSVQLHASPPGPPPAPMPAP-PPMVVPSHRHVFHHVTHPAPPPMQMAPAPCMP 211 Query: 979 P 981 P Sbjct: 212 P 212 Score = 37.1 bits (82), Expect = 0.022 Identities = 34/129 (26%), Positives = 34/129 (26%), Gaps = 7/129 (5%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPPPP PP P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPP--PPPPPPI-------TLHHEQHVVSHVMHPAPPPPPP 143 Query: 795 XPPXPXXPXXXXPPPXXP----XPPPXPPXXPXPPPP---XPPXXXXPXPXPXPPXXPXX 953 PP P P PP PP P P PP P P P Sbjct: 144 PPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVPSHRHVFHHVTHPAPPPMQ 203 Query: 954 PPPXPXPPP 980 P P PP Sbjct: 204 MAPAPCMPP 212 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 74.5 bits (175), Expect = 1e-13 Identities = 36/64 (56%), Positives = 36/64 (56%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GGG GGG GG GGG GG GGGG G GGG GGGG G GG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDD 712 Query: 698 GGGG 687 G G Sbjct: 713 DGDG 716 Score = 71.7 bits (168), Expect = 8e-13 Identities = 37/66 (56%), Positives = 37/66 (56%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G GGG GGG GGG GG GGG GG GGGG G GGG GGGG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGG----GGG----GGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Query: 710 XGXGGG 693 G G Sbjct: 711 DDDGDG 716 Score = 68.1 bits (159), Expect = 1e-11 Identities = 33/60 (55%), Positives = 33/60 (55%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG G GGG GGGG G GG G G G GGGGG G GGG G G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGAGGAGAGAGDDDG 714 Score = 68.1 bits (159), Expect = 1e-11 Identities = 30/52 (57%), Positives = 30/52 (57%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GG GGGG G GGG GGGG G GG G G G GGGGG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 67.7 bits (158), Expect = 1e-11 Identities = 30/52 (57%), Positives = 30/52 (57%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G GGG GGGG G GG G G G GGGGG G GGG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/54 (55%), Positives = 30/54 (55%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG GGGG G GGG GGGG G GG G G G GGGGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 67.3 bits (157), Expect = 2e-11 Identities = 37/68 (54%), Positives = 37/68 (54%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GGG GG GGG GG GGGG G GGG GGGG G GG G G G G G Sbjct: 659 GGDGGGGGGGGGG----GGG----GG--GGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Query: 689 GXXXXGXG 666 G G Sbjct: 709 AGDDDGDG 716 Score = 65.3 bits (152), Expect = 7e-11 Identities = 30/60 (50%), Positives = 30/60 (50%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GGG G GGG GGG GGG GG GGG GG G GG G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 65.3 bits (152), Expect = 7e-11 Identities = 30/60 (50%), Positives = 30/60 (50%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GGG GG GGGG G GGG GGGG G GG G G G G GG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 65.3 bits (152), Expect = 7e-11 Identities = 29/52 (55%), Positives = 29/52 (55%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GG G GGG GGGG G GG G G G GGGGG G GGG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 64.5 bits (150), Expect = 1e-10 Identities = 29/54 (53%), Positives = 29/54 (53%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GGG GGGG G GG G G G GGGGG G GGG G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGGG G GGG G GG G G G GG GGGG G GG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 62.5 bits (145), Expect = 5e-10 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GG G GGG G GG G G G GG GGGG G GG GGG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 62.5 bits (145), Expect = 5e-10 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GGGG G GG G G G GGGGG G GGG G G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 61.7 bits (143), Expect = 9e-10 Identities = 31/62 (50%), Positives = 31/62 (50%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG G GGG GG G G GGG G GGG GGG GGG GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGAGGAGAGAGDD 712 Query: 797 GG 792 G Sbjct: 713 DG 714 Score = 61.7 bits (143), Expect = 9e-10 Identities = 31/62 (50%), Positives = 31/62 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GGG G GG G G G GG GGGG G GG GGG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Query: 805 XG 800 G Sbjct: 715 DG 716 Score = 61.7 bits (143), Expect = 9e-10 Identities = 30/58 (51%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGG 810 GG G GGG G GGG GG G G GGG G GGG GGG GG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 60.9 bits (141), Expect = 2e-09 Identities = 31/64 (48%), Positives = 31/64 (48%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G GG G GGG G GG G G G GG GGGG G GG GGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDD 712 Query: 802 GGXG 791 G G Sbjct: 713 DGDG 716 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/82 (36%), Positives = 32/82 (39%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWSX 564 G G GG G G G GGGGG G GGG G G G GG GG A + Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Query: 563 Q*TSXXXLLSTQAAFRDEQSNP 498 S L Q R Q+ P Sbjct: 717 DVDSNNNLSDLQLTVRYLQTGP 738 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 73.7 bits (173), Expect = 2e-13 Identities = 33/58 (56%), Positives = 33/58 (56%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG G GGG GGG GGG GG G G GG GGGG G GGG GGGG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 67.7 bits (158), Expect = 1e-11 Identities = 31/58 (53%), Positives = 31/58 (53%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GGG GGG GG GGG G GG G G GGG GGGG G GG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/60 (55%), Positives = 33/60 (55%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GG GGGG G GGG G GG G GG G G G GGGGG G GGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG---GGGGGGVGRARFG 119 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/53 (56%), Positives = 30/53 (56%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GGGG G GGG GGGG G G G G GGGGG G GGG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 67.3 bits (157), Expect = 2e-11 Identities = 38/62 (61%), Positives = 38/62 (61%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GGG GGG GG GGG GG GGG G GGG GGGG G GG G G G GGG Sbjct: 62 GGGGGGGGGGGGGG----GGG----GG--GGGDDGDGGGGDGGGG-GGGGDGGGGGGGGG 110 Query: 692 GG 687 GG Sbjct: 111 GG 112 Score = 64.9 bits (151), Expect = 1e-10 Identities = 33/73 (45%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXGGXXGGXX 609 GGGG G GGG GGGG G GG G G GG GGG G GGG G G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFGST 121 Query: 608 XXXXXAXSXRSTW 570 R W Sbjct: 122 YTKIGTIQRRLAW 134 Score = 63.7 bits (148), Expect = 2e-10 Identities = 29/56 (51%), Positives = 29/56 (51%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GGGG G G G GGGGG G GGG G G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 63.3 bits (147), Expect = 3e-10 Identities = 30/52 (57%), Positives = 30/52 (57%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG G GGG G GG G G G GG G GG G GG GGG G GGG Sbjct: 62 GGGGGGGGGGG--GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 62.9 bits (146), Expect = 4e-10 Identities = 28/50 (56%), Positives = 28/50 (56%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 GG G GGG G GGG GG G G GG G GGG GGG GGG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 62.1 bits (144), Expect = 7e-10 Identities = 29/57 (50%), Positives = 29/57 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGGG G GGG G GG G G G GGGG G GG GGG G G G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/58 (50%), Positives = 29/58 (50%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 G GGG G GGG GG G G GGG GGG GGG GGG GG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 58.8 bits (136), Expect = 6e-09 Identities = 31/65 (47%), Positives = 31/65 (47%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G GGG G GGG GG G G GG GGG GG GGGG G G Sbjct: 62 GGGGGGGGGG-------GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Query: 761 GGXXG 747 G Sbjct: 115 RARFG 119 Score = 54.0 bits (124), Expect = 2e-07 Identities = 31/66 (46%), Positives = 31/66 (46%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGX 794 G G GGG G GG G G G GG G G G GG GGG G GGG G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGG----GGDDGDGGGGDGGGGGGGGDGGGG----GGGGGGGV 113 Query: 793 GXGXGG 776 G G Sbjct: 114 GRARFG 119 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 72.9 bits (171), Expect = 4e-13 Identities = 42/96 (43%), Positives = 42/96 (43%), Gaps = 9/96 (9%) Frame = +1 Query: 688 PPPPPXPXPXPX-----PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PPPPP P PP P PPPP P PPPP PP PPP P PPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPP--PP----PPPGCAGLPPPPPS 731 Query: 853 PPPX----PPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PPP P PPP P P PP P P Sbjct: 732 PQPGCAGLPPPPPPPPPGCAGLP-PPPPPIDVPMKP 766 Score = 72.1 bits (169), Expect = 6e-13 Identities = 40/93 (43%), Positives = 40/93 (43%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PPPP P P PPP PPP PPPP PPP PP PPP PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPP--PPP---PPPPLLSGTLPMPPP----PPPPPPGCAGLPP 727 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P PP PP PPP P Sbjct: 728 PPPSPQPGCAGLP--PPPPPPPPGCAGLPPPPP 758 Score = 70.1 bits (164), Expect = 3e-12 Identities = 37/87 (42%), Positives = 37/87 (42%), Gaps = 10/87 (11%) Frame = +1 Query: 655 PXPPPXPXXXX------PPPPPXPXPXPXPPXPXPPPPXXPPP----XPXPPPPXXPPXX 804 P PPP P PPPPP P P P PPPP PPP P PPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCA 737 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PPP PP PPP PPP P Sbjct: 738 GLPPPPPPPPPGCAGLPPP-PPPIDVP 763 Score = 66.1 bits (154), Expect = 4e-11 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPP P PPP P P P PPPP P PPP PP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP----PPG 749 Query: 820 XXXXPPXPPPXPPPXPP 870 PP PPP P P Sbjct: 750 CAGLPPPPPPIDVPMKP 766 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/72 (41%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP---XXXXPXPXPXP-PXX 944 PP P P P PPP P PP P PPPP PP P P P P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 945 PXXPPPXPXPPP 980 PPP P PPP Sbjct: 737 AGLPPPPPPPPP 748 Score = 58.8 bits (136), Expect = 6e-09 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 6/74 (8%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPP------PXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPP P PP PPP PP P PPP P PPP P P PP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLP--PPPPSPQP 734 Query: 940 PXPXXPPPXPXXPP 981 PPP P PP Sbjct: 735 GCAGLPPPPPPPPP 748 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP PPP P PP P PP P P P P P PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 957 PPXPXPPPP 983 PP PPPP Sbjct: 754 PP---PPPP 759 Score = 56.8 bits (131), Expect = 3e-08 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = +1 Query: 616 PPXXPPXXPX-----PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 PP PP P P P PPP P PPP P P P PPPP PP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP P P P P P Sbjct: 755 PPPPPIDVPMKPLFWKRIQLKKPQPEP 781 Score = 55.2 bits (127), Expect = 8e-08 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 3/70 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP-PXPPXXXXPXPXPXPPXX--PX 950 P P P PP P PP P PPP P PPP P P P P P PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 951 XPPPXPXPPP 980 PPP P P Sbjct: 754 PPPPPPIDVP 763 Score = 53.2 bits (122), Expect = 3e-07 Identities = 35/111 (31%), Positives = 35/111 (31%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP PP P PPPPP PP P P PP Sbjct: 677 PPPPPPLPV-----IEGSSLSVPPPPPPPPPPLLSG----------------TLPMPPPP 715 Query: 804 XPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P P P PPPP PP P P P P P Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 50.8 bits (116), Expect = 2e-06 Identities = 32/98 (32%), Positives = 32/98 (32%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXX 868 PPPPP PPPP PPP P P P P PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPP---PLLSGTLPMPPPPPPPP-------------P 720 Query: 869 XXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P P P PP P PP PP Sbjct: 721 GCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 38.7 bits (86), Expect = 0.007 Identities = 32/93 (34%), Positives = 32/93 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P PPPPP PP PP P P Sbjct: 694 PPPPPPPPPPLLSGTLPMP------PPPPP---PP------------PGCAGLPPPPPSP 732 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P P PPP P PPP P PPPP Sbjct: 733 QPGCAGLP----PPP--PPPPPGCAGLPPPPPP 759 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 72.5 bits (170), Expect = 5e-13 Identities = 41/89 (46%), Positives = 41/89 (46%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G GG G G G G G G G G G G GGG GG GG GG G Sbjct: 122 GGVQRGGRGGWRGRGGGEGN----GAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEG 177 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GGG G G GGG G GG G G G GG Sbjct: 178 GGGRGRG---TGGGSRGGGGDGRGRGRGG 203 Score = 71.7 bits (168), Expect = 8e-13 Identities = 38/77 (49%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G G GGG G G GG GGG GG G GG G GG GGG G GG G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGR-GGGEGGGGRGRGT 185 Query: 707 GXGG-GGGXXXXGXGGG 660 G G GGG G G G Sbjct: 186 GGGSRGGGGDGRGRGRG 202 Score = 67.3 bits (157), Expect = 2e-11 Identities = 44/110 (40%), Positives = 44/110 (40%), Gaps = 4/110 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXXG--GG 777 G G GG G G G G G G GGG G GG G GG GG G GG Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG 174 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGXXG 630 G G GG G GG GG G G G G GG G G G G G Sbjct: 175 GEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEERTRIEGYGSGSQDMGYFG 224 Score = 65.7 bits (153), Expect = 5e-11 Identities = 39/88 (44%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXX--GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GG GG GGG GG GGG G GGG G GG G G G G G G Sbjct: 118 GWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRG--GNGGGRGGG 175 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG G G GG Sbjct: 176 EGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 65.7 bits (153), Expect = 5e-11 Identities = 35/78 (44%), Positives = 35/78 (44%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G GG G G GGG G GG GG GG GG G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGR-GGGEGGWGGRGGNGGGRGGGEGGGGRGRGT 185 Query: 800 XGGXXGGGGXGXGGGXXG 747 GG GGGG G G G G Sbjct: 186 GGGSRGGGGDGRGRGRGG 203 Score = 62.5 bits (145), Expect = 5e-10 Identities = 34/71 (47%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 G GGG G G GG G GG G G G GG GG G G GG GGG G G G Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRG-G 192 Query: 808 GXGGXGXGXGG 776 G G G G GG Sbjct: 193 GGDGRGRGRGG 203 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/69 (44%), Positives = 31/69 (44%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG G GG G GG G G G G GGG G GG GG G G G G G Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGI--GRGGGR-GRGGGEGGWGGRGGNGGGRGGGEGG 178 Query: 802 GGXGXGXGG 776 GG G G GG Sbjct: 179 GGRGRGTGG 187 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/83 (40%), Positives = 34/83 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG G G G GGG G GGG G G GGG G G G Sbjct: 144 GGGIGRGGGR-GRGGGEGGWGGRGGNGGGRGGGEG-GGGRGRGTGGGSRGGGGDGRGRGR 201 Query: 800 XGGXXGGGGXGXGGGXXGGGGXG 732 G G G G G G Sbjct: 202 GGTEERTRIEGYGSGSQDMGYFG 224 Score = 42.7 bits (96), Expect = 4e-04 Identities = 31/86 (36%), Positives = 31/86 (36%) Frame = -1 Query: 946 GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGGXXX 767 G G G GG G G G G GGG G GGG G G GG G G GG Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGR-GGGRGRGG--GEGGWG-GRGGNGG 170 Query: 766 XXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG GGG G Sbjct: 171 GRGGGEGGGGRGRGTGGGSRGGGGDG 196 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 72.5 bits (170), Expect = 5e-13 Identities = 50/123 (40%), Positives = 50/123 (40%), Gaps = 5/123 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX----GGGXGGXXXXGG 813 GG G GGG GGG GG G GG G GG GGG GGG GG G Sbjct: 129 GGEGGMGGGM-SMGGGMGGGMSMGGMGGGMGGMMG-GGSMGGGMMSMAGGGMGGGMGGGM 186 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGX 636 G GG GG G G GGG GG G G G G G G GGG G Sbjct: 187 GGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSN 246 Query: 635 XGG 627 GG Sbjct: 247 GGG 249 Score = 71.7 bits (168), Expect = 8e-13 Identities = 50/118 (42%), Positives = 50/118 (42%), Gaps = 3/118 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G GGG G G G G G G GG GGG G GG G GG GG Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMG--GGMMSMAG-----GGMGGG 181 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG---XGXXGGXXGG 615 G G GGG GG G G G G GGG G GGG G G G GG GG Sbjct: 182 MGGGMGGGMEGGMGGGMMEGMQGMG-SMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 70.5 bits (165), Expect = 2e-12 Identities = 48/120 (40%), Positives = 48/120 (40%), Gaps = 3/120 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG--GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G G GGG G G G G G G GGG GGG GGG G GG Sbjct: 141 GGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG-GMGGGMM 199 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXG 630 G GG GGG GGG G G G GG GGG G G G G G Sbjct: 200 EGMQGMGSMGGGMMGGGM--GGGMGFNGMEDGGKEGGMGGGMLQMGDSNGGGMSEMGNMG 257 Score = 52.0 bits (119), Expect = 7e-07 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 3/94 (3%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXGGXGXG 711 GG G GG GG GG GG GGG G GG GG G G GG G Sbjct: 105 GGMGPMAPEGGPSEGGLMQKQFIEGGEGGMGGGMSMGGGMG-GGMSMGGMGGGMGGMMGG 163 Query: 710 XGXGGG-GGXXXXGXGGG-XGXXGXGXXGGXXGG 615 GGG G GGG G G G GG GG Sbjct: 164 GSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 48.8 bits (111), Expect = 7e-06 Identities = 38/106 (35%), Positives = 38/106 (35%), Gaps = 7/106 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXGGGG--XGXXGGXGGGXGXXGGGXXXX 818 G GGG GGG G GG G G G GG GGG GG GGG G GG Sbjct: 133 GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG 192 Query: 817 GXXG---XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G GG G GGG Sbjct: 193 GMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG G GGG G G G GG GGG GG G GGG G Sbjct: 187 GGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSN 246 Query: 805 XGG 797 GG Sbjct: 247 GGG 249 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 72.5 bits (170), Expect = 5e-13 Identities = 33/70 (47%), Positives = 33/70 (47%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P PPPP P P P PP P PPPP PP P PPPP PP PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPP-PPPPPPSPSPPRPPPPPPPSPPRPL--AAKLPEPPPI 251 Query: 844 PPXPPPXPPP 873 P PP PPP Sbjct: 252 PNMPPTLPPP 261 Score = 65.3 bits (152), Expect = 7e-11 Identities = 32/69 (46%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-----PXPXPPP-PXX 792 P P PPP P PPPP P P P PP P PPPP PP P PPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNM 254 Query: 793 PPXXXXPPP 819 PP PPP Sbjct: 255 PP--TLPPP 261 Score = 64.9 bits (151), Expect = 1e-10 Identities = 31/74 (41%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P PP P PPP P PPP P P PP PP PP P P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNM 254 Query: 868 PPXPXPPPXXXXXP 909 PP PPP P Sbjct: 255 PP-TLPPPTLGYLP 267 Score = 64.9 bits (151), Expect = 1e-10 Identities = 31/72 (43%), Positives = 31/72 (43%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P PPPP PP PPP PP PP PP PPP P P P P PP Sbjct: 195 PTSPSQITQPPPP--PPR---PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Query: 928 XXPPPXPXXPPP 963 P P PPP Sbjct: 250 PIPNMPPTLPPP 261 Score = 64.1 bits (149), Expect = 2e-10 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P P PPP P P P PP P PP P PPP P PP P PP P Sbjct: 204 PPPPP----PRPPPSPPPPPPPPSPSPPRP-PPPPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Query: 841 PPP 849 PPP Sbjct: 259 PPP 261 Score = 62.1 bits (144), Expect = 7e-10 Identities = 27/59 (45%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP---XXPPPXPXXPP 981 P PP PPP PPP PPP P PP P P PP P P PPP P PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 61.3 bits (142), Expect = 1e-09 Identities = 28/61 (45%), Positives = 28/61 (45%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P PP P P PPP P P P PP P PPPP PP P PP P PP P Sbjct: 204 PPPPPPRPPPSPPPPP--PPPSPSPPRPPPPPPPSPP-RPLAAKLPEPPPIPNMPPTLPP 260 Query: 972 P 974 P Sbjct: 261 P 261 Score = 60.9 bits (141), Expect = 2e-09 Identities = 27/60 (45%), Positives = 27/60 (45%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P PPP P P PPP P P PP P PPP P PP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP--PSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 58.8 bits (136), Expect = 6e-09 Identities = 31/75 (41%), Positives = 31/75 (41%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P PP PPP PP P P PPP PP PPP PPP PP P Sbjct: 195 PTSPSQITQPP--PPPPRPPPSPPPP-----PPPPSPSPPRPPP-PPPPSPPRPLAAKLP 246 Query: 898 XXXPXXPXPPXXPPP 942 P PP PPP Sbjct: 247 EPPPIPNMPPTLPPP 261 Score = 58.4 bits (135), Expect = 8e-09 Identities = 27/59 (45%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP--XXPPPXPXXPPPXPXXPP 981 PPP PP PPP PPP P P PPP P P PPP P PP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP--PP 261 Score = 57.6 bits (133), Expect = 1e-08 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP P PPP P PP PP P P PP P P P P P P P Sbjct: 208 PPRPPPSPPPP-------PPPPSP-SPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Query: 957 PP 962 PP Sbjct: 260 PP 261 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP----XXPXXPPPXPXPPP 980 PPP P PPP PP P PPP P P P P PP PPP P PP Sbjct: 204 PPPPPPRPPPSPP-PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 50.8 bits (116), Expect = 2e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP PP P P PP PP P P P PP P PPP P PP P Sbjct: 204 PPPPPPRPPPSPPPPP----PPPSPSPPRPP--PPPPPSPPRP 240 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PPP PP P P PP P P P P PPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PPPP P P P P PP PP P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 41.9 bits (94), Expect = 8e-04 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP-XPPXPXXPXXXXP-PPXXPXPPPX 863 PPPPP PP P PP P P PP P P P P PPP Sbjct: 204 PPPPPPRPPPSPPPPPP------------PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPI 251 Query: 864 PPXXPXPPPP 893 P P PPP Sbjct: 252 PNMPPTLPPP 261 Score = 36.7 bits (81), Expect = 0.029 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP PP P P P PPP P PP PP P P PP Sbjct: 204 PPPPPPRPPPSPPPPP------PPPSP--SPP-----------------RPPPPPPPSPP 238 Query: 804 XPXXPXXXXPPPXXPXPPPXPP 869 P PPP PP PP Sbjct: 239 RPLAAKLPEPPPIPNMPPTLPP 260 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPP 719 P PP PP P P PPPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPP 719 P PP PP P P P PPPPP P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPP--PPPPPSPPRP 240 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +2 Query: 662 PXPXXXXXXPPPPPXXXPXPXPXXP----XPPPPXXP--PPXXXPP 781 P P PP P P P P P P PP P PP PP Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P P PP P P P PPP PP P Sbjct: 222 PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 72.1 bits (169), Expect = 6e-13 Identities = 40/110 (36%), Positives = 40/110 (36%), Gaps = 3/110 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P PPPP P P P P P P P P P P PP PP Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG 89 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXP-PPXPXXPP 981 PP P P P P P P P PP P P PP P PP Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 61.7 bits (143), Expect = 9e-10 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 4/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPP-PPXXPPPXPXPPPPX 789 PP PP P P PP P P P P P P PP PP P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAI 88 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXP--PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P P PP P PP P PP P P P P PP Sbjct: 89 GPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPP 148 Query: 964 XPXXPP 981 PP Sbjct: 149 GDVGPP 154 Score = 58.4 bits (135), Expect = 8e-09 Identities = 41/118 (34%), Positives = 41/118 (34%), Gaps = 5/118 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P P P P PP P PP P PP P P PP Sbjct: 47 PDGPPGFPGPQGPNGPKGPPGL--PGPPGPPGFQGPPG-NPAGAIGPPGLPGPNGVNGPP 103 Query: 799 XXXXP--PPXXXXPPXP--PPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP PP P PP PP P PP P PP P PP P P Sbjct: 104 GELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP-GTNGELGPPGDVGPPGNPGGP 160 Score = 58.0 bits (134), Expect = 1e-08 Identities = 43/132 (32%), Positives = 43/132 (32%), Gaps = 16/132 (12%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PP P P P P P PP P P P PP Sbjct: 254 PAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNG 313 Query: 811 P--PPXXXXPPXPPPXP--------PPXPP-PXPXPPPXXXXXPXXP----XPPXXP-PP 942 P PP PP P P P P P P P P P PP P PP Sbjct: 314 PLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPP 373 Query: 943 XPXXPPPXPXXP 978 P PP P P Sbjct: 374 GPQMPPGPPGLP 385 Score = 56.8 bits (131), Expect = 3e-08 Identities = 45/137 (32%), Positives = 45/137 (32%), Gaps = 19/137 (13%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP----PXXP 795 PP P P PP PP P P P P P P PP PP P PP P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGP-PGP-PGPQMPPGPPGLPGPPGPAGPPGTNGELGP 147 Query: 796 PXXXXPPPXXXXP------------PXPPPXPPPXPPPXPXPPPXXXXXPXXPXP--PXX 933 P PP P P P P P P PP P P P P Sbjct: 148 PGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQM 207 Query: 934 PPPXPXXP-PPXPXXPP 981 PP P P P P PP Sbjct: 208 PPGPPGLPGAPGPKGPP 224 Score = 56.8 bits (131), Expect = 3e-08 Identities = 41/130 (31%), Positives = 41/130 (31%), Gaps = 13/130 (10%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP----------XPXP 777 PP P P P PP P PP PP P P P P PP P Sbjct: 706 PPGLPGPPGPASPPSP--PGPPGPPGPNGPPGPNGPLGPPGECGPAGNAGGVGCQGHHGN 763 Query: 778 PPPXXPPXXXXPPPXXXXPPXP--PPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PP PP PP P PP P PP P P P P P Sbjct: 764 PAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNG 823 Query: 949 XXPPPXPXXP 978 PP P Sbjct: 824 PLGPPGECGP 833 Score = 56.4 bits (130), Expect = 3e-08 Identities = 39/123 (31%), Positives = 39/123 (31%), Gaps = 5/123 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPP----PXX 792 P P P P PP P PP P P P P PP P P P PP P Sbjct: 175 PNGLPGPNGPLGPPGPPGDMGPPG---LPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLG 231 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 PP PP P P P P P P PP P PP P Sbjct: 232 PPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQ 291 Query: 973 XPP 981 PP Sbjct: 292 MPP 294 Score = 55.2 bits (127), Expect = 8e-08 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 13/131 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP-XXPPPXPXPP-------P 783 PP P P P PP P P P P P P PP PP P P Sbjct: 196 PPGLPGPQGPQMPPGPPGL--PGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGN 253 Query: 784 PXXP--PXXXXPPPXXXXPPXPP--PXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P PP PP PP P PP P PP P P P P Sbjct: 254 PAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNG 313 Query: 949 XXPPPXPXXPP 981 PP PP Sbjct: 314 PLGPPGDVGPP 324 Score = 55.2 bits (127), Expect = 8e-08 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 11/131 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP----P 786 P P P P PP P PP P P P P P PP P P PP P Sbjct: 342 PQGPNGQPGPPGINGPPGPLGDVGPPG-LPGP-PGPQMPPGPPGLPGAPGPKGPPGTNGP 399 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP--XPPPXXXXXPXXP----XPPXXP-PPX 945 PP PP P P P P P P P P PP P PP Sbjct: 400 LGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPG 459 Query: 946 PXXPPPXPXXP 978 P PP P P Sbjct: 460 PQMPPGPPGLP 470 Score = 55.2 bits (127), Expect = 8e-08 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 11/131 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP----P 786 P P P P PP P PP P P P P P PP P P PP P Sbjct: 427 PQGPNGQPGPPGINGPPGPLGDVGPPG-LPGP-PGPQMPPGPPGLPGAPGPNGPPGINGP 484 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP--XPPPXXXXXPXXP----XPPXXP-PPX 945 PP PP P P P P P P P P PP P PP Sbjct: 485 LGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPG 544 Query: 946 PXXPPPXPXXP 978 P PP P P Sbjct: 545 PQMPPGPPGLP 555 Score = 53.6 bits (123), Expect = 2e-07 Identities = 40/129 (31%), Positives = 40/129 (31%), Gaps = 7/129 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP--PXXPPPXPXPPPPX 789 PP P P PP P P PP PP PP P P P Sbjct: 366 PPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPA 425 Query: 790 XP--PXXXXPPPXXXXPPXP--PPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P PP PP P PP P PP P PP P P P P Sbjct: 426 GPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPL 485 Query: 955 PPPXPXXPP 981 PP PP Sbjct: 486 GPPGEAGPP 494 Score = 53.6 bits (123), Expect = 2e-07 Identities = 46/142 (32%), Positives = 46/142 (32%), Gaps = 21/142 (14%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP----P 786 P P P P PP P PP P P P P P PP P P PP P Sbjct: 512 PQGPNGQPGPPGINGPPGPLGDVGPPG-LPGP-PGPQMPPGPPGLPGAPGPNGPPGINGP 569 Query: 787 XXPPXXXXPPPXXXXP--------PXPPPXP--PPXPPPXPXPP-------PXXXXXPXX 915 PP PP P P P P P PP PP P P Sbjct: 570 LGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPG 629 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP P PP Sbjct: 630 PASPPSPPGPPG--PPGPKGPP 649 Score = 53.2 bits (122), Expect = 3e-07 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 9/130 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P P P PP P P P P PP P P P PP Sbjct: 184 PLGPPGPPGDMGP--PGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGP--PGDVGPP 239 Query: 799 XXXXPP--PXXXXPPXPPPXPPPXPPP----XPXPPPXXXXXPXXPXP--PXXPPPXPXX 954 P P P P P P P PP P P P P PP P Sbjct: 240 GNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGL 299 Query: 955 P-PPXPXXPP 981 P P P PP Sbjct: 300 PGAPGPKGPP 309 Score = 53.2 bits (122), Expect = 3e-07 Identities = 41/130 (31%), Positives = 41/130 (31%), Gaps = 12/130 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-------P 786 PP P P P PP P P P P P PP PP P P P Sbjct: 281 PPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPL-GPPGDVGPPGNPGGPGYQGNHGNP 339 Query: 787 XXP--PXXXXPPPXXXXPPXP-PPXPPPXPPPXPXP--PPXXXXXPXXPXPPXXPPPXPX 951 P P PP PP P PP P P P PP P P P P Sbjct: 340 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGP 399 Query: 952 XPPPXPXXPP 981 PP PP Sbjct: 400 LGPPGDVGPP 409 Score = 52.0 bits (119), Expect = 7e-07 Identities = 38/118 (32%), Positives = 38/118 (32%), Gaps = 7/118 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP----PPPXXP 795 PP P P P PP P PP PP P P P P PP P Sbjct: 791 PPGLPGPPGPASPPSPPG--PPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGN 848 Query: 796 PXXXXPPPXXXXPPX---PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P PP PP PP PP P P PP PP P PP Sbjct: 849 PAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPG--PPGPKGPP 904 Score = 51.2 bits (117), Expect = 1e-06 Identities = 41/130 (31%), Positives = 41/130 (31%), Gaps = 12/130 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-------P 786 PP P P P PP P P P P P PP PP P P P Sbjct: 451 PPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPL-GPPGEAGPPGNPGGPGYQGNHGNP 509 Query: 787 XXP--PXXXXPPPXXXXPPXP-PPXPPPXPPPXPXP--PPXXXXXPXXPXPPXXPPPXPX 951 P P PP PP P PP P P P PP P P P P Sbjct: 510 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGP 569 Query: 952 XPPPXPXXPP 981 PP PP Sbjct: 570 LGPPGEAGPP 579 Score = 50.8 bits (116), Expect = 2e-06 Identities = 39/135 (28%), Positives = 39/135 (28%), Gaps = 14/135 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP--PXXP--------PP 765 PP P P PP P P PP PP PP P P P Sbjct: 196 PPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPA 255 Query: 766 XPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP----XX 933 P P P PP PP P P P P PP P PP Sbjct: 256 GPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPL 315 Query: 934 PPPXPXXPPPXPXXP 978 PP PP P P Sbjct: 316 GPPGDVGPPGNPGGP 330 Score = 50.8 bits (116), Expect = 2e-06 Identities = 38/129 (29%), Positives = 38/129 (29%), Gaps = 11/129 (8%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP--PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 P P P PP PP P P P P P PP P P P P P PP Sbjct: 770 PNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPG 829 Query: 802 XXXPP--------PXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P P PP PP P P P P Sbjct: 830 ECGPAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPP 889 Query: 955 PPPXPXXPP 981 PP P PP Sbjct: 890 SPPGPPGPP 898 Score = 50.4 bits (115), Expect = 2e-06 Identities = 41/135 (30%), Positives = 41/135 (30%), Gaps = 15/135 (11%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPXPPP--PXXPP-------PX 768 P PP P P P PP P P PP PP PP P P P Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNPA 170 Query: 769 PXPPPPXXP-PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP----XX 933 P P P PP PP P P P P PP P PP Sbjct: 171 GIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPL 230 Query: 934 PPPXPXXPPPXPXXP 978 PP PP P P Sbjct: 231 GPPGDVGPPGNPGGP 245 Score = 50.4 bits (115), Expect = 2e-06 Identities = 37/116 (31%), Positives = 37/116 (31%), Gaps = 9/116 (7%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPX-------PPPPXXPPPXP 771 P PP P P P P P P PP P P P P P P P Sbjct: 545 PQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQP 604 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP PP P P P PP PP P PP P P P PP Sbjct: 605 GPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPP--GPKGPPGPNGPLGPP 658 Score = 49.6 bits (113), Expect = 4e-06 Identities = 38/132 (28%), Positives = 38/132 (28%), Gaps = 11/132 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP--PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P PP P P P P P P PP P P P P P Sbjct: 597 PQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLG 656 Query: 793 PPXXXXPP--------PXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP P P P P PP PP P P P P Sbjct: 657 PPGESGPAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPA 716 Query: 946 PXXPPPXPXXPP 981 PP P PP Sbjct: 717 SPPSPPGPPGPP 728 Score = 48.8 bits (111), Expect = 7e-06 Identities = 40/129 (31%), Positives = 40/129 (31%), Gaps = 12/129 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-------P 786 PP P P P PP P P P P P PP PP P P P Sbjct: 536 PPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPL-GPPGEAGPPGNPGGPGYQGNHGNP 594 Query: 787 XXP--PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP 957 P P PP PP P P P P P P PP PP P P Sbjct: 595 AGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Query: 958 --PPXPXXP 978 PP P Sbjct: 655 LGPPGESGP 663 Score = 48.0 bits (109), Expect = 1e-05 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 13/126 (10%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--------PPPPXXPPPXP 771 P PP P P P P P P PP P P P P P P Sbjct: 290 PQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQP 349 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPP 939 PP PP P P P PP PP P P P P P PP Sbjct: 350 GPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 409 Query: 940 PXPXXP 957 P P Sbjct: 410 GNPGGP 415 Score = 48.0 bits (109), Expect = 1e-05 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 13/126 (10%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--------PPPPXXPPPXP 771 P PP P P P P P P PP P P P P P P Sbjct: 375 PQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQP 434 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPP 939 PP PP P P P PP PP P P P P P PP Sbjct: 435 GPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPP 494 Query: 940 PXPXXP 957 P P Sbjct: 495 GNPGGP 500 Score = 47.2 bits (107), Expect = 2e-05 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 13/131 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP---------- 777 P P P P PP P PP PP P P P P PP P Sbjct: 621 PAGLPGPPGPASPPSPPG--PPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGN 678 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXX 954 P P PP PP PP P PP P PP P PP P Sbjct: 679 PAGVQGPNGQPGPPGINGPPGQ--IGEMGPPGLPGPP----GPASPPSPPGPPGPPGPNG 732 Query: 955 P--PPXPXXPP 981 P P P PP Sbjct: 733 PPGPNGPLGPP 743 Score = 46.4 bits (105), Expect = 4e-05 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 12/126 (9%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PP PP P P P Sbjct: 290 PQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQP 349 Query: 795 XPP---XPXXPXXXXPPPXXPXP-----PPXPPXXPXPP-PPXPPXXXXPXPXP---XPP 938 PP P P PP P P PP PP P P P PP P P PP Sbjct: 350 GPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 409 Query: 939 XXPXXP 956 P P Sbjct: 410 GNPGGP 415 Score = 46.4 bits (105), Expect = 4e-05 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 11/129 (8%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP--XPXPPPPXXPPX 801 P P P PP PP P P P P PP P P P P P PP Sbjct: 685 PNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPG 744 Query: 802 XXXPP--------PXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P P PP PP P P P P Sbjct: 745 ECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPP 804 Query: 955 PPPXPXXPP 981 PP P PP Sbjct: 805 SPPGPPGPP 813 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/113 (29%), Positives = 33/113 (29%), Gaps = 6/113 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP------XPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P PP P P P PP Sbjct: 718 PPSPPGPPGPPGPNGPPGPNGPLGPPGECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPP 777 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P P P PP PP P PP P P P PP Sbjct: 778 GINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPP--GPKGPPGPNGPLGPP 828 Score = 46.0 bits (104), Expect = 5e-05 Identities = 36/127 (28%), Positives = 36/127 (28%), Gaps = 6/127 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPX----PPPXPXXXXPPPP-PXPXPXPXPPXPXPPP-PXXPPPXPXPP 780 P PP P P P PP P PP P P PP P PP P P Sbjct: 62 PKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQ 121 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP PP P PP P P P P P Sbjct: 122 MPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGP 181 Query: 961 PXPXXPP 981 P PP Sbjct: 182 NGPLGPP 188 Score = 46.0 bits (104), Expect = 5e-05 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 12/126 (9%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PP PP P P P Sbjct: 375 PQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQP 434 Query: 795 XPPX---PXXPXXXXPPPXXPXP-----PPXPPXXPXPP-PPXPPXXXXPXPXP---XPP 938 PP P P PP P P PP PP P P P PP P P PP Sbjct: 435 GPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPP 494 Query: 939 XXPXXP 956 P P Sbjct: 495 GNPGGP 500 Score = 46.0 bits (104), Expect = 5e-05 Identities = 38/131 (29%), Positives = 38/131 (29%), Gaps = 10/131 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP P P P PP P P P P PP P Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Query: 799 XXXXPPPXXXXPPXPP-----PXPPPXPPPXPXPP--PXXXXXPXXPXPP-XXPPPXPXX 954 P P P PP PP P P PP PP P Sbjct: 834 AGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPG 893 Query: 955 P--PPXPXXPP 981 P PP P PP Sbjct: 894 PPGPPGPKGPP 904 Score = 43.6 bits (98), Expect = 3e-04 Identities = 33/121 (27%), Positives = 33/121 (27%), Gaps = 1/121 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PP PP P P P Sbjct: 545 PQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQP 604 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 PP P P P PP PP PP PP P P P P PP Sbjct: 605 GPPGVNGPPGEI-GEIGPAGLPGPPGPASPPSPPGPPGPPGP-KGPPGPNGPLGPPGESG 662 Query: 972 P 974 P Sbjct: 663 P 663 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 5/121 (4%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P P PP PP P PP P P Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPG--PPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 329 Query: 816 PXXXX-----PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P PP PP P P P P P PP P P Sbjct: 330 PGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPG 389 Query: 981 P 983 P Sbjct: 390 P 390 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 5/121 (4%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P P PP PP P PP P P Sbjct: 357 PPGPLGDVGPPGLPGPPGPQMPPG--PPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 414 Query: 816 PXXXX-----PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P PP PP P P P P P PP P P Sbjct: 415 PGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPG 474 Query: 981 P 983 P Sbjct: 475 P 475 Score = 42.3 bits (95), Expect = 6e-04 Identities = 36/122 (29%), Positives = 36/122 (29%), Gaps = 11/122 (9%) Frame = +3 Query: 624 PPXXPPXPXXXXX-PXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP-- 794 PP PP P P P PP PP P P P P Sbjct: 40 PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP-GPPGFQGPPGNPAGAIGPPGLPGPNG 98 Query: 795 --XPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPP-PPXPPXXXXPXPXP---XPPXXPX 950 PP PP P P PP PP P PP P PP P PP P Sbjct: 99 VNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPG 158 Query: 951 XP 956 P Sbjct: 159 GP 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 2/123 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PP PP P P P Sbjct: 205 PQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLP 264 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXP-XPXPPXXPXXPPPXP 968 P P PP PP P P P PP P P P P P PP Sbjct: 265 GPNGILGPPG---PPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDV 321 Query: 969 XPP 977 PP Sbjct: 322 GPP 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 38/129 (29%), Positives = 38/129 (29%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PP P P P P P P P P PP PP P PP Sbjct: 484 PLGPPGEAGP--PGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPP--GPLGDVGPPGL 539 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-----PPXPX 951 PP PP P P P PP P PP P P P P P Sbjct: 540 PGPPGPQMPPGPPGLPGAPGPNGPPG-INGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQ 598 Query: 952 XPPPXPXXP 978 P P P Sbjct: 599 GPNGQPGPP 607 Score = 40.7 bits (91), Expect = 0.002 Identities = 36/133 (27%), Positives = 36/133 (27%), Gaps = 27/133 (20%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-----------------------PPXPXPXPXPP 729 P PP P P P PP P PP P P PP Sbjct: 803 PPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGPNGQPGPP 862 Query: 730 XPXPPP----PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 PP PP P PP P PP PP P P PP P Sbjct: 863 GINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNT 922 Query: 898 XXXPXXPXPPXXP 936 P PP P Sbjct: 923 GGAGCQPAPPCPP 935 Score = 39.9 bits (89), Expect = 0.003 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 6/124 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P PP P P P P P P Sbjct: 408 PPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGP-PGPQMPPGP 466 Query: 796 PXXXXPPPXXXXPPXPPPXPPP---XPPPXPXPP--PXXXXXPXXPXPPXXPP-PXPXXP 957 P P P P PP PP P P P P P P P Sbjct: 467 PGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGING 526 Query: 958 PPXP 969 PP P Sbjct: 527 PPGP 530 Score = 38.7 bits (86), Expect = 0.007 Identities = 30/123 (24%), Positives = 30/123 (24%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P PP P PP P Sbjct: 184 PLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPG-NP 242 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P PP P P P P P PP P Sbjct: 243 GGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGA 302 Query: 975 PPP 983 P P Sbjct: 303 PGP 305 Score = 37.5 bits (83), Expect = 0.017 Identities = 39/134 (29%), Positives = 39/134 (29%), Gaps = 17/134 (12%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPP----PXXPPPXPX 774 P PP P P P P P P P P PP PP PP P Sbjct: 314 PLGPPGDVGP--PGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPG 371 Query: 775 PPPPXXPP----XXXXP----PPXXXXPPXPP-PXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PP P PP P PP P PP PP P P P Sbjct: 372 PPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPN 431 Query: 928 XXPPPXPXXPPPXP 969 P P PP P Sbjct: 432 GQPGPPGINGPPGP 445 Score = 36.3 bits (80), Expect = 0.038 Identities = 32/125 (25%), Positives = 32/125 (25%), Gaps = 7/125 (5%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX 797 PP P P P P P P PP P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQ--GNHGN 848 Query: 798 PPXPXXPXXXXPPPXXPXPPPX-----PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P PP PP PP P PP P P P P P P P Sbjct: 849 PAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNG 908 Query: 963 XPXPP 977 PP Sbjct: 909 CLGPP 913 Score = 35.9 bits (79), Expect = 0.050 Identities = 31/118 (26%), Positives = 31/118 (26%), Gaps = 2/118 (1%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P P P PP PP PP P P Sbjct: 111 PPGP-----PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPG---NPGGPGL 162 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP--XPXPXPPXXPXXPPPXPXPPPP 983 P P P PP PP P P P P P PP P P P Sbjct: 163 QGNHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGP 220 Score = 35.5 bits (78), Expect = 0.067 Identities = 25/98 (25%), Positives = 25/98 (25%), Gaps = 1/98 (1%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXX-PXXPXPPXXXXXXXXXXXXX 865 PP PP P P P PP P P P Sbjct: 809 PPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPP 868 Query: 866 XXXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 PP P P P P PP P P PP P Sbjct: 869 GQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP PP P P P P PP P PP P Sbjct: 685 PNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGP 730 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP PP P P P P PP P PP P Sbjct: 855 PNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGP 900 Score = 32.3 bits (70), Expect = 0.62 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 12/97 (12%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPP----PXXPPPXPX 774 P PP P P P P P P P P PP PP P P Sbjct: 569 PLGPPGEAGP--PGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPG 626 Query: 775 PP----PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP PP P P P P P PP P Sbjct: 627 PPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 31.9 bits (69), Expect = 0.82 Identities = 23/96 (23%), Positives = 23/96 (23%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXX 874 PP P P PP P P P P Sbjct: 393 PPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPP 452 Query: 875 XXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PP P P PP P P P P P PP Sbjct: 453 GLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPP 488 Score = 28.7 bits (61), Expect = 7.6 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P P PP PP P P PP P P P Sbjct: 876 PPGLPGPPGPASP---------PS-PPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGA 925 Query: 957 PPXPXPPPP 983 P PP P Sbjct: 926 GCQPAPPCP 934 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 70.9 bits (166), Expect = 1e-12 Identities = 36/98 (36%), Positives = 36/98 (36%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P PP P P P PPP P PPPP P P PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEP--PPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPT 955 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P PP PPP P P PP Sbjct: 956 SALP-PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 68.5 bits (160), Expect = 8e-12 Identities = 36/106 (33%), Positives = 36/106 (33%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P PPP PPPP P P P P P P P PP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP PPP PP PP P PP P P P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPP--PPPPVQTTTAPTLPPASCMP 997 Score = 67.7 bits (158), Expect = 1e-11 Identities = 37/105 (35%), Positives = 37/105 (35%), Gaps = 5/105 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPX 801 P P P P PPPP P P PP P PPPP P P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTT 947 Query: 802 XXXPPPXXXXPPXPPP---XPPPXPPPXPXPPPXXXXXPXXPXPP 927 PPP P P P PPP PP P PPP PP Sbjct: 948 RPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 62.9 bits (146), Expect = 4e-10 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 3/95 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP--- 786 P P P P P PPP P PPPP P P P P P PPPP Sbjct: 903 PTTPAPPPPLPLAPEPPP-PL----PPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSA 957 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP P PP PPP PP P PP Sbjct: 958 LPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/104 (31%), Positives = 33/104 (31%), Gaps = 6/104 (5%) Frame = +3 Query: 624 PPXXP--PXPXXXXXPXPXXXXXXPPPP-PXXXPP---XXPXXXXXXXXXXXXXXXXPPX 785 PP P P P P P PPPP P PP P PP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 P P P PPP P PPP PP P PP P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 50.0 bits (114), Expect = 3e-06 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 6/107 (5%) Frame = +2 Query: 668 PXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP------PX 829 P P P P P P P PPPP PPP PP P P P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPP---PPIQTTRPTVPTTPTTQASTTRPT 950 Query: 830 XXXXXXXXXXXXXXXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 PPP P P PPP P P P Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 734 PXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PPPP PPP PP P P P Sbjct: 1112 PLPPPP--PPPTEIPPAQETFEGSPPCPSP 1139 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXP 924 P PPP PPP PP P P Sbjct: 1112 PLPPPPPPPTEIPPAQETFEGSPPCP 1137 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 70.5 bits (165), Expect = 2e-12 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PPPP P P P PPP P PPPP PP PPP PP PP P P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAA---PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Query: 871 PXP 879 P P Sbjct: 107 PAP 109 Score = 66.5 bits (155), Expect = 3e-11 Identities = 32/72 (44%), Positives = 32/72 (44%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P PP P P P PPP PP P PPPP P PPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAP----PPPAAPPAAPPPPPPLPAP----PPPPAQPA 102 Query: 835 PXPPPXPPPXPP 870 P PPP PP P Sbjct: 103 PQPPPAPPHFLP 114 Score = 62.9 bits (146), Expect = 4e-10 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +1 Query: 616 PPXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP PP P P P PPP PPPP P P PP P P PP PP P P PP Sbjct: 50 PPPPPPSPPAAAPAAP-PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP-PPAQPAPQPPP 107 Query: 790 XPP 798 PP Sbjct: 108 APP 110 Score = 60.1 bits (139), Expect = 3e-09 Identities = 29/69 (42%), Positives = 29/69 (42%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PPPP P P PPP PPP PP PP PPP P P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAA--PPAAPPPPPPL--PAPPPPPAQPAPQP 105 Query: 913 XPXPPXXPP 939 P PP P Sbjct: 106 PPAPPHFLP 114 Score = 59.7 bits (138), Expect = 4e-09 Identities = 30/68 (44%), Positives = 30/68 (44%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P P PP P PPP P PP PP PP P PPP P P PP P Sbjct: 50 PPPPPPSPPAAAPAA--PPPPAAAPAAPP--PPAAPPAAPPPPP---PLPAPPPPPAQPA 102 Query: 940 PXPXXPPP 963 P P PP Sbjct: 103 PQPPPAPP 110 Score = 59.3 bits (137), Expect = 5e-09 Identities = 29/69 (42%), Positives = 29/69 (42%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP P PP P PP P P PPP P P P PP P P Sbjct: 50 PPPPPPSPPAAA-PAAPPPPAAAPAAPPPPAAPPAAPPP-------PPPLPAPPPPPAQP 101 Query: 957 PPXPXPPPP 983 P P P PP Sbjct: 102 APQPPPAPP 110 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/61 (47%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPP 888 PP P P PP P P PP P PP PP PP PPP P P PP P P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAA---PPPPPPLPAPPPPPAQPAPQPP 106 Query: 889 P 891 P Sbjct: 107 P 107 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +2 Query: 668 PXXXXXXPPPPPXXXPXPXPXXPXPP---PPXXPPPXXXPPXPXXXPXXPXXPXPP 826 P PPPPP P P P PP P PPP P P P P P PP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 10/60 (16%) Frame = +1 Query: 832 PPXPPPXPP-----PXPPP--XPXPPPXXXXXPXXPXPP---XXPPPXPXXPPPXPXXPP 981 PP PPP PP PPP P PP P P PP PPP P P P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 41.9 bits (94), Expect = 8e-04 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 740 PPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXXXXXPPPXPXXXPXPP 919 PPPP PP P P P P PP PPP P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAA-------------PPPPP---PLPA 93 Query: 920 PXPXXPXPPXPXPPXXPP 973 P P P P P PP PP Sbjct: 94 P-PPPPAQPAPQPPPAPP 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/85 (32%), Positives = 28/85 (32%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P PPPP PP P PP P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPP--AAPPAAP---------------PPPPPLP 92 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPP 869 PP P P P PPP PP Sbjct: 93 APPPP-------PAQPAPQPPPAPP 110 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 70.5 bits (165), Expect = 2e-12 Identities = 42/110 (38%), Positives = 42/110 (38%), Gaps = 2/110 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG-GXXX 801 G G GG G G GG G G G G G GG GGG G G Sbjct: 54 GGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDD 113 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXG 654 GG GG G GG GGG GG G G GGG G GGG G Sbjct: 114 GGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSGVGGGDG 163 Score = 64.9 bits (151), Expect = 1e-10 Identities = 42/125 (33%), Positives = 42/125 (33%), Gaps = 4/125 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G GG GG G GGG GG G GG G GG Sbjct: 34 GDVDDDGGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGGF-GDDGGDDSGGDDDSGGVGD 92 Query: 800 XGGXXGG----GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG GG GG G GG GGG GG G G GGG G G G G G Sbjct: 93 DGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDD 152 Query: 632 GGXXG 618 G Sbjct: 153 DSGSG 157 Score = 63.7 bits (148), Expect = 2e-10 Identities = 42/119 (35%), Positives = 42/119 (35%), Gaps = 2/119 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGGXX 804 G GG GG GG G GG G GG G GG GG GG Sbjct: 48 GGDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVG 107 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GGG GG GG GG G G GG GGG G G GG Sbjct: 108 DDGGDDGGGD-DDSGGVGDDGGDDGGGDDDSGGVGDDGG----DDGGGDDDSGSGVGGG 161 Score = 60.1 bits (139), Expect = 3e-09 Identities = 41/122 (33%), Positives = 41/122 (33%), Gaps = 1/122 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G GG G GG G G GG G G GG Sbjct: 31 GDDGDVDDDGGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDD---SGGDDDS 87 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXGXXGGXX 621 GG GG G G GG G G G G GG G GGG G G GG Sbjct: 88 GGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDD 147 Query: 620 GG 615 GG Sbjct: 148 GG 149 Score = 56.4 bits (130), Expect = 3e-08 Identities = 37/117 (31%), Positives = 37/117 (31%), Gaps = 4/117 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG GG GG Sbjct: 17 GAVGDDDSAVGDDNGDDGDVDDDGGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGGFGDD 76 Query: 797 GGXXGGGGXGXGG----GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GG GG G GGG GG G G GGG G G G G G Sbjct: 77 GGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGG 133 Score = 52.4 bits (120), Expect = 5e-07 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 3/84 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG---GGXGGXXXXGGG 810 GG GG G GG GG G GG G G GG G G GG GG Sbjct: 82 GGDDDSGG--VGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGG 139 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGG 738 GG GGG G G GG G Sbjct: 140 VGDDGGDDGGGDDDSGSGVGGGDG 163 Score = 48.4 bits (110), Expect = 9e-06 Identities = 31/96 (32%), Positives = 31/96 (32%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GG GG G G G GG G GG GGG GG G G Sbjct: 55 GVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDG 114 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGG 698 G G G G G GG GG Sbjct: 115 GGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGG 150 Score = 48.0 bits (109), Expect = 1e-05 Identities = 36/99 (36%), Positives = 36/99 (36%), Gaps = 8/99 (8%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGG-GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G G G GG G GG GG G GG GGG GG G Sbjct: 17 GAVGDDDSAVGDDNGDDGDVDDDGGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGGFGDD 76 Query: 710 XGX--GG----GGGXXXXGXGGG-XGXXGXGXXGGXXGG 615 G GG GG G GGG G G GG GG Sbjct: 77 GGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGG 115 Score = 46.0 bits (104), Expect = 5e-05 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G GG GG G G G GG G GG GG GG G Sbjct: 88 GGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDD 147 Query: 805 XGG---XGXGXGG 776 GG G G GG Sbjct: 148 GGGDDDSGSGVGG 160 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = -1 Query: 985 GGG----GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 GGG GG G GG G GG G GG GGG GG G G GGG Sbjct: 97 GGGDDDSGGVGDDGGDDG--GGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDS 154 Query: 817 GXXGXGGXG 791 G GG G Sbjct: 155 GSGVGGGDG 163 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 69.7 bits (163), Expect = 3e-12 Identities = 40/115 (34%), Positives = 40/115 (34%), Gaps = 3/115 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP P P PP P P P P PP P PP P P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPL 318 Query: 826 XXPPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP P PP P P P P PP PP P P P PP Sbjct: 319 RYPPSPIRYPPLPSRYPPSPPRYPSSHPRYP--PSPPRYPPSPPRYPSSHPRYPP 371 Score = 64.9 bits (151), Expect = 1e-10 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX---PXPPPP 786 PP PP P P PP P P P P PP P PP PP P P Sbjct: 261 PPRYPPS-PLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLR 319 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P PP PP PP P P P PP P P PP P P Sbjct: 320 YPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPS 379 Query: 967 PXXPP 981 P P Sbjct: 380 PIRYP 384 Score = 58.8 bits (136), Expect = 6e-09 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 10/131 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP----------XPXPPXPXPPPPXXPPPX 768 P PP P P P P P PP P P P PP P PP Sbjct: 272 PPIPPRYP-PSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPL 330 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P P PP PP PP P P PP P P PP Sbjct: 331 PSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLR--YLPSPIRYPPSHS 388 Query: 949 XXPPPXPXXPP 981 P P PP Sbjct: 389 RYPSSHPRYPP 399 Score = 52.0 bits (119), Expect = 7e-07 Identities = 38/133 (28%), Positives = 38/133 (28%), Gaps = 11/133 (8%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P PP PP PP P PP P Sbjct: 268 PLRYPPIPPRYPPSLIRYPTLPPRYPPSPP-RYPPSPPRYPPSLHRYPQSPLRYPPSPIR 326 Query: 795 XPPXP--XXPXXXXPPPXXPXPPPXPPXXPXPPP---------PXPPXXXXPXPXPXPPX 941 PP P P P P PP PP P PP P P P P PP Sbjct: 327 YPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPS 386 Query: 942 XPXXPPPXPXPPP 980 P P PP Sbjct: 387 HSRYPSSHPRYPP 399 Score = 48.8 bits (111), Expect = 7e-06 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPX-PXXPXP-PPXPXXXXPPP---PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 PP PP P P PP P P P PP P P PP P PP P Sbjct: 303 PPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRY 362 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-----XXPXPPXXPPPX 945 P P P P PP P P PP P P PPP Sbjct: 363 PSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPSHLRYPPSSLRYLPSHLRYPPPP 422 Query: 946 PXXPPPXPXXPP 981 PP PP Sbjct: 423 LRYPPSPLRYPP 434 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP PP P P PP P P P P P P P P Sbjct: 352 PPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPSHLRYPPSSLRY 411 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXP-------XPPPXXXXXPXXPXPPXXPPPXP 948 P PPP PP P PP P P P P P P Sbjct: 412 LPSHLRYPPPPLRYPPSPLRYPPSLSPICHHLFAIRLHLPAIRHQLPLYPPSPARYATLP 471 Query: 949 XXPPPXPXXPP 981 PP P P Sbjct: 472 PRFPPSPFNDP 482 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 69.3 bits (162), Expect = 4e-12 Identities = 39/91 (42%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX--GXGGGXXGGGGXGXGGXG 717 G G G G G G G G G G G G GG GG G GGG G GG GG G Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Query: 716 XGXGXG-GGGGXXXXGXGGGXGXXGXGXXGG 627 G G GGGG GGG G G GG Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 64.9 bits (151), Expect = 1e-10 Identities = 35/85 (41%), Positives = 35/85 (41%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G G G G G G G GGG G GGG GG GG G Sbjct: 127 GDGDGDGDGDGD-GDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGG 185 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GGGG G G G G GG Sbjct: 186 DDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 61.7 bits (143), Expect = 9e-10 Identities = 36/91 (39%), Positives = 36/91 (39%), Gaps = 2/91 (2%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX-GGXXGGGGXGXGGGXX 750 G G G G G G G G G G G GG GG GG G G G GG Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Query: 749 GGGGXGXGGXGX-GXGXGGGGGXXXXGXGGG 660 G G G GG G G GGGGG GG Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 61.3 bits (142), Expect = 1e-09 Identities = 40/96 (41%), Positives = 40/96 (41%), Gaps = 3/96 (3%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG--XGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G G G G G G G G GGG GG G G GG G GG Sbjct: 125 GDGDGDGDGD-GDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDG----GGSNGSGGGD 179 Query: 767 XGG-GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG G GGG G GG G GGGG GG Sbjct: 180 DGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 60.9 bits (141), Expect = 2e-09 Identities = 32/86 (37%), Positives = 32/86 (37%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G G G G G G G G G GGG GG G G G G G G G G Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Query: 692 GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG G GG GG Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 59.7 bits (138), Expect = 4e-09 Identities = 39/95 (41%), Positives = 39/95 (41%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G GGG GG G GGG G GGG Sbjct: 127 GDGDGDGDGD-GDGDGDGDGDGD-GDGDGDGGGSDDGGDDDDGDGGGSNGS---GGGDDG 181 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 G GGG G GGG GG G GG G GG Sbjct: 182 GDGGDDGGGSG-GGGDDGGSDGGGGGNDGGRDDGG 215 Score = 49.2 bits (112), Expect = 5e-06 Identities = 27/69 (39%), Positives = 27/69 (39%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G GGG G GG GG G GG G Sbjct: 139 GDGDGDGDGDG-DGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDD 197 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 198 GGSDGGGGG 206 Score = 47.6 bits (108), Expect = 2e-05 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GG G GGG G GG G G GG GGGG G GGG G GG Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGG-DDGGSDGGGGGNDGG 210 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGGGXXXXG 815 G G G G G G G G G G G G GGG G G GGG GGG G Sbjct: 125 GDGDGDGDGDGD-GDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGG-DDGG 182 Query: 814 XXGXGGXGXGXGG 776 G G G G GG Sbjct: 183 DGGDDGGGSGGGG 195 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = -1 Query: 985 GGGGGXGXGGG-XXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 G G G G GGG G G G G GG GG G G G G G GG G Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Query: 808 GXGGXGXG 785 GG G Sbjct: 207 NDGGRDDG 214 Score = 43.6 bits (98), Expect = 3e-04 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG GG GG G G GG GG G GG GG G GG G G Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSG----GGDDGGDGGDDGGGSGGGGDDGGS---DGGGG 205 Query: 805 XGGXGXGXGG 776 G GG Sbjct: 206 GNDGGRDDGG 215 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 68.9 bits (161), Expect = 6e-12 Identities = 43/106 (40%), Positives = 43/106 (40%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG GG G G GGG GG G G GG GGG GG GGGG G Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYG-GGHRGGGGYG 789 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GGG GG G G G G G G G GG G G Sbjct: 790 -GGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGGYNRNTGYNTYG 834 Score = 64.5 bits (150), Expect = 1e-10 Identities = 38/88 (43%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXX--GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 GG GGG GGG GG GG GGGG G GGG GGG G GG G G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGG-GYGGGHRGGGGY 788 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG G G G G GG Sbjct: 789 GGGGHRGGSYSGYRGSYKSGGYGQGSGG 816 Score = 63.7 bits (148), Expect = 2e-10 Identities = 44/119 (36%), Positives = 44/119 (36%), Gaps = 9/119 (7%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGX---GGXXXXGGGXXXXGGX 789 GG G G G G GGG GGG GG GG GG Sbjct: 705 GGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGG 764 Query: 788 XGGGGXG-XGGGXXGGGGXGXGGXGXGXGXGGG-----GGXXXXGXGGGXGXXGXGXXG 630 GGGG G GGG GGG G GG G G GG G G G G G G G G Sbjct: 765 YGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Score = 53.2 bits (122), Expect = 3e-07 Identities = 30/69 (43%), Positives = 30/69 (43%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG G GGG G G G G G GG GGG G GG GGG G G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRG-GGGYGGGGHRGGSYSGYRGSYKS 807 Query: 802 GGXGXGXGG 776 GG G G GG Sbjct: 808 GGYGQGSGG 816 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG G G G GGG G GG GG G G G G G G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 Query: 782 GGGXGXGGGXXGGGGXG 732 GG G G G Sbjct: 821 SGGYNRNTGYNTYGSYG 837 Score = 52.0 bits (119), Expect = 7e-07 Identities = 32/72 (44%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGG--GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GGG GG G GGG G GG G G G GG GGGG G G G G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGH-RGGSYSGYRGSYKSGGY---G 811 Query: 811 XGXGGXGXGXGG 776 G GG G G GG Sbjct: 812 QGSGGYGQGSGG 823 Score = 51.6 bits (118), Expect = 9e-07 Identities = 33/75 (44%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXG---XXGGXG--XGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXX 821 GG GG G GGG GG G G G GG GGGG G GG G G G GGG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGG--- 786 Query: 820 XGXXGXGGXGXGXGG 776 G G G G G Sbjct: 787 -GYGGGGHRGGSYSG 800 Score = 48.4 bits (110), Expect = 9e-06 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG GG GG GGG G G GG G G GGGGG G G Sbjct: 718 GGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGG 777 Query: 665 GGXGXXGXGXXGG 627 G G G G GG Sbjct: 778 YGGGHRGGGGYGG 790 Score = 46.8 bits (106), Expect = 3e-05 Identities = 34/88 (38%), Positives = 34/88 (38%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GG GG GGG GG G GGG GGGG G G Sbjct: 719 GRGGWQKDYQRGGRGGGGY-GGGYNDRRMQQGGYGNRSGGGYRGGGGYG---------GG 768 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG G GG GG Sbjct: 769 GGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 12/83 (14%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG------------GXGGGX 837 GG GGG G GGG GG G G GGG G GG GG G G G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRG-GGGYGGGGHRGGSYSGYRGSYKSGGYGQGS 814 Query: 836 GGXXXXGGGXXXXGGXXGGGGXG 768 GG GG G G G Sbjct: 815 GGYGQGSGGYNRNTGYNTYGSYG 837 Score = 41.1 bits (92), Expect = 0.001 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 1/119 (0%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG G GG G GG GGGG G GG GG G GG Sbjct: 705 GGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYG--GGYNDRRMQQGGYGNRSGGGYRGG 762 Query: 796 XGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXG-XGXXXXXGXGGXXGG 623 G G GG G GG GGGG G G G G GG Sbjct: 763 GGYGGGG-----GGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGG 816 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXG---GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GG GG GG G G G GG G G G GGG G GGG G Sbjct: 718 GGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRG-GGGYGGGGGGYRGGG 776 Query: 814 XXG---XGGXGXGXGG 776 G GG G G GG Sbjct: 777 GYGGGHRGGGGYGGGG 792 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 3/84 (3%) Frame = -3 Query: 857 GGXGGGXGGXXXXGG-GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG--GGGG 687 GG GG GG G GG G G GG GG G G G GGGG Sbjct: 705 GGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGG 764 Query: 686 XXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G GG G Sbjct: 765 YG----GGGGGYRGGGGYGGGHRG 784 Score = 37.9 bits (84), Expect = 0.012 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 7/84 (8%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-----XGGXG--XGXGXGGGGG 687 GG GG GG G GG GGG GG G G G GGGG Sbjct: 705 GGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGG 764 Query: 686 XXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG G G GG GG Sbjct: 765 ---YGGGGGGYRGGGGYGGGHRGG 785 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 68.5 bits (160), Expect = 8e-12 Identities = 41/115 (35%), Positives = 41/115 (35%), Gaps = 3/115 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXX 804 PP P P PP PPP P PP P P P P PPP P Sbjct: 4 PPNTAIPGDP--PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIP-IP 60 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXPPP 963 PPP P PPP P P P P P P P PP P P PPP Sbjct: 61 GNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 66.5 bits (155), Expect = 3e-11 Identities = 40/117 (34%), Positives = 40/117 (34%), Gaps = 1/117 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P PP P P PP PPP P PP P P PP P P PP Sbjct: 10 PGDPPPNTAIPGDP--PPNTTIPRAPPPNTAIPGDRPPNT-PIPGDPPPNIPIPGNPPPN 66 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PPP P PPP P P P P P P P PP P P Sbjct: 67 TPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDP 123 Score = 64.1 bits (149), Expect = 2e-10 Identities = 38/110 (34%), Positives = 38/110 (34%), Gaps = 5/110 (4%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPX---PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 PP PPP P PP P PPP P PP P PPP P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPP---NTPIPGDPPPNIPIP 60 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXPPPXPXXP 978 PPP P P P P P P P PP P P PPP P Sbjct: 61 GNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIP 110 Score = 60.1 bits (139), Expect = 3e-09 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 1/91 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP-XPXPPPPXXPPPXPXPPPPXX 792 P PP P P P PP P PPP P P PP P P P P P PPP Sbjct: 40 PGDRPPNTPIPGDP-PPNIPIPGNPPPNT-PIPGDPPPNTPIPGDPPPNTPIPGNPPP-N 96 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P PPP P PPP P P P Sbjct: 97 TPIPGDPPPNTPIPGDPPPNTPIQGDPLTIP 127 Score = 58.8 bits (136), Expect = 6e-09 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 4/121 (3%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPP----PXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP P P PPP P PP P P P Sbjct: 10 PGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPI 69 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P PPP P P PP P P P P P P PP P P Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP---NTPIPGDPPPNTPIQGDPLTI 126 Query: 972 P 974 P Sbjct: 127 P 127 Score = 57.2 bits (132), Expect = 2e-08 Identities = 37/122 (30%), Positives = 37/122 (30%), Gaps = 6/122 (4%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPP----PXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP P P PPP P PP P P P P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNP 63 Query: 804 XPXXPXXXXPPPXXPXPPPXPPXXPXP--PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PPP P P PP P P PPP P P P P P PP P Sbjct: 64 PPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDP--PPNTPIQG 121 Query: 978 PP 983 P Sbjct: 122 DP 123 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 66.9 bits (156), Expect = 2e-11 Identities = 41/122 (33%), Positives = 41/122 (33%), Gaps = 4/122 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXGG--GXXXX 798 G G GG GG G GG GG GG GG G GG G Sbjct: 511 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNN 570 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXGXXGGXX 621 GG GG G GG GG G G G GG GG G G GG Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 630 Query: 620 GG 615 GG Sbjct: 631 GG 632 Score = 61.7 bits (143), Expect = 9e-10 Identities = 45/132 (34%), Positives = 45/132 (34%), Gaps = 10/132 (7%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG--GGXGXGGGXGGGXGGGXGGXXXXGG-- 813 G G G GG GG G GG G GG GG G GG Sbjct: 497 GNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGND 556 Query: 812 GXXXXGGXXGGGGXGXG-GGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGG---XGX 651 G GG GG G GG GG GG GG G GG G G GG G Sbjct: 557 GSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN 616 Query: 650 XGXGXXGGXXGG 615 G GG GG Sbjct: 617 TGGNNNGGNTGG 628 Score = 59.3 bits (137), Expect = 5e-09 Identities = 36/124 (29%), Positives = 36/124 (29%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG GG G GG G GG GG GG Sbjct: 433 GGNNGGNNNGGNTGGDNNGGNNYGGNNN--GGNNNVGNNNGGNNNGGNNNGGNNNGGNNN 490 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGGGXGXXGXGXXGG 627 G GG G G GG GG G GG G G G G G Sbjct: 491 GGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGS 550 Query: 626 XXGG 615 GG Sbjct: 551 NNGG 554 Score = 59.3 bits (137), Expect = 5e-09 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 2/120 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G GG G GG GG G GG G GG G Sbjct: 521 GNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGG 580 Query: 788 XGGGGXGXG--GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG GG G G G GG GG G G GG G Sbjct: 581 NTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 640 Score = 59.3 bits (137), Expect = 5e-09 Identities = 33/109 (30%), Positives = 33/109 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G G G GG GG GG G G Sbjct: 539 GGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNN--- 595 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GG G GG GG G G G GG GG G Sbjct: 596 NGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 58.8 bits (136), Expect = 6e-09 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 2/120 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG--XGGGXGGXXXXGGGX 807 GG G GG G G G GG GG GG GG G Sbjct: 525 GGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGG 584 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G GG G G G GG GG G G G Sbjct: 585 NNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 58.8 bits (136), Expect = 6e-09 Identities = 30/87 (34%), Positives = 30/87 (34%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P PPPPP P P P PP P P P PPP P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPA 726 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PPP P P P Sbjct: 727 GSPSGTSAGNPQQQPPP-PGQLPGQQP 752 Score = 58.4 bits (135), Expect = 8e-09 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 3/118 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G G G GG G GG GG GG G GG Sbjct: 423 GGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGG 482 Query: 779 ---GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GG GG G G G GG G G G G GG Sbjct: 483 NNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 540 Score = 57.6 bits (133), Expect = 1e-08 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G GG GG GG G GG Sbjct: 486 GGNNNGGNNNGGNNNGENNGGNNNGGNN--NGGNNNGGNNNGGNNNGGNNNGENNGGNNN 543 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXGXXGGX 624 G G G G GG G G G GG GG G G GG Sbjct: 544 GGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGN 603 Query: 623 XGG 615 GG Sbjct: 604 NGG 606 Score = 57.2 bits (132), Expect = 2e-08 Identities = 42/129 (32%), Positives = 42/129 (32%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G GG GG G GG GG GG G GG Sbjct: 456 GGNNNGGNNNVGNNNGGNNNGGNNNGGNN---NGGNNNGGNNNGGNNNGENNGGNNNGGN 512 Query: 806 XXXGGXXGG---GGXGXGGGXXG--GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 G GG GG GG G GG GG G GG G G G G Sbjct: 513 NNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNG-GNTGGNNNG 571 Query: 641 GXXGGXXGG 615 G GG GG Sbjct: 572 GNTGGNNGG 580 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP-XPXPPPXXXXXPXX 915 PPPP PPP P PPPP PPP PP PPP PP P P Sbjct: 683 PPPPPPPPPPPPPPPP--------PPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSA 734 Query: 916 PXPPXXPPPXPXXPPPXP 969 P PPP P P Sbjct: 735 GNPQQQPPPPGQLPGQQP 752 Score = 56.8 bits (131), Expect = 3e-08 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 2/123 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GG G G G G GG GG GG G G Sbjct: 525 GGNNNGGNNNGENNGGNNNGGNNGGSN--NGGNDGSNNNGGNTGGNNNGGNTGGNNGGNT 582 Query: 797 GGXXGGGGXGXG--GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GG G GG GG G G G GG G G G GG Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN 642 Query: 623 XGG 615 GG Sbjct: 643 SGG 645 Score = 56.4 bits (130), Expect = 3e-08 Identities = 31/122 (25%), Positives = 31/122 (25%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G GG G GG GG G Sbjct: 446 GGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNG 505 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G G G GG GG G GG G G G GG Sbjct: 506 GNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNT 565 Query: 620 GG 615 GG Sbjct: 566 GG 567 Score = 56.4 bits (130), Expect = 3e-08 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 2/120 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G GG GG G GG G GG GG GG G Sbjct: 472 GNNNGGNNNGGNNNGGNNNGGNN---NGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNN 528 Query: 788 XGGGGXGX--GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG GG G G GG GG G G GG G Sbjct: 529 NGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 588 Score = 56.0 bits (129), Expect = 4e-08 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 9/123 (7%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G GG GG G GG GG GG GG GG G GG Sbjct: 413 GNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGG 472 Query: 779 ---GGXGXGGGXXGG---GGXGXGGXGXGXGXGG--GGGXXXXGXGGGXGXXGXGXXGGX 624 GG GG GG GG GG G GG GG G G G GG Sbjct: 473 NNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGN 532 Query: 623 XGG 615 G Sbjct: 533 NNG 535 Score = 56.0 bits (129), Expect = 4e-08 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 6/113 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG GG G GG G GG GG G G Sbjct: 548 GGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGN 607 Query: 800 XGGXXGG---GGXGXGGGXXGGGGXGXGGXGXGXGXGGG---GGXXXXGXGGG 660 GG G GG GG G G GG G GG G GGG Sbjct: 608 TGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSGEVTIQPGGG 660 Score = 55.2 bits (127), Expect = 8e-08 Identities = 38/123 (30%), Positives = 38/123 (30%), Gaps = 5/123 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGG---XGGXXXXGGGXX 804 G G GG GG G GG G GG GG G G Sbjct: 482 GNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGN 541 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GG G G GG GG G GG G G G G G GG Sbjct: 542 NNGGNNGGSNNGGNDGSNNNGG-NTGGNNNGGNTGGNNGGNTGGNNNG-GNTGGNNNGGN 599 Query: 623 XGG 615 GG Sbjct: 600 TGG 602 Score = 54.8 bits (126), Expect = 1e-07 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 3/121 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXGGXXXXGGGXXXXG 795 G G GG GG G G GG GG GG GG Sbjct: 477 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGE 536 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXGXXGGXXG 618 G G GG GG G G G GG GG G G GG Sbjct: 537 NNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 596 Query: 617 G 615 G Sbjct: 597 G 597 Score = 53.2 bits (122), Expect = 3e-07 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GG G G GG G GG G GG Sbjct: 423 GGNTNGGNNNGGNNGGNNNGGNTGGDNN--GGNNYGGNNNGGNNNVGNNNGGNNNGGNNN 480 Query: 800 XGGXXGG---GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GG GG GG G G G G GG G G G G Sbjct: 481 GGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 540 Query: 629 GXXGG 615 GG Sbjct: 541 NNNGG 545 Score = 53.2 bits (122), Expect = 3e-07 Identities = 34/112 (30%), Positives = 34/112 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G GG GG GG G GG Sbjct: 544 GGNNG-GSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGN--- 599 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG GG G G GG G G G GG GG G Sbjct: 600 TGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSG 651 Score = 52.8 bits (121), Expect = 4e-07 Identities = 27/66 (40%), Positives = 27/66 (40%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P PP PPP PPP PPP P PPP P P PP PP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPP-PPPPPPPPPQPSTPP--PPPPSTPPVQQSGAPG 723 Query: 964 XPXXPP 981 P P Sbjct: 724 SPAGSP 729 Score = 52.0 bits (119), Expect = 7e-07 Identities = 33/124 (26%), Positives = 33/124 (26%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG--GX 807 G G G G G GG G GG GG G GG G Sbjct: 388 GNNNNAGTSNVGNNGFTNNGVNNNNGNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGG 447 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G G G G GG G G G G Sbjct: 448 DNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGN 507 Query: 626 XXGG 615 GG Sbjct: 508 NNGG 511 Score = 52.0 bits (119), Expect = 7e-07 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGG---G 810 G GG G G GG GG GG GG GG G Sbjct: 451 GGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNG 510 Query: 809 XXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG GG G G G GG G GG G G G Sbjct: 511 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNN 570 Query: 632 GGXXGG 615 GG GG Sbjct: 571 GGNTGG 576 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP-----XPXPPXPXPPPPXXPPPXPXPP 780 PP PP P P P PPP PPPPP P P P P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPP 742 Query: 781 PPXXPP 798 PP P Sbjct: 743 PPGQLP 748 Score = 48.8 bits (111), Expect = 7e-06 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP--XXXXPXPXPXPPXXPXXPP 959 P P PP P PPP P PPP P P PPP PP P P Sbjct: 684 PPPPPPPP-------PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGN 736 Query: 960 PXPXPPPP 983 P PPPP Sbjct: 737 PQQQPPPP 744 Score = 48.4 bits (110), Expect = 9e-06 Identities = 30/121 (24%), Positives = 30/121 (24%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G GG G G GG GG G Sbjct: 399 GNNGFTNNGVNNNNGNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGG---DNNGGNNY 455 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG GG G G G G G GG G G G G G Sbjct: 456 GGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNG 515 Query: 617 G 615 G Sbjct: 516 G 516 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PPPP PP P P P PP PPP P PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PP P PPP PP P PPPP P P P PP P P P Sbjct: 677 PIQTMVPP--PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP P P PPP PPP PP P P P P Sbjct: 685 PPPPPPPPPPPPPP----PPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQ 740 Query: 957 PPXPXPPP 980 PP P P Sbjct: 741 PPPPGQLP 748 Score = 46.4 bits (105), Expect = 4e-05 Identities = 29/101 (28%), Positives = 29/101 (28%), Gaps = 2/101 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 GG G GG G G G G GG G GG GG G G G Sbjct: 544 GGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGN 603 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G GG G GG GG G Sbjct: 604 NGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P PPP PP PPP PPP P P PPP P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPA 726 Query: 940 PXP 948 P Sbjct: 727 GSP 729 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/125 (24%), Positives = 30/125 (24%), Gaps = 1/125 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G GG G GG GG GG G G G Sbjct: 511 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNN 570 Query: 805 XGGXGXGXGG-XXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 G G GG G GG G GG G GG Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 630 Query: 628 GGXXG 614 GG G Sbjct: 631 GGNTG 635 Score = 42.3 bits (95), Expect = 6e-04 Identities = 31/123 (25%), Positives = 31/123 (25%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG-GXGXXGGGXXXXGXX 809 G G GG G G G GG GG GG G GG G Sbjct: 497 GNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGND 556 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXG-XXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G G GG G GG G G G GG Sbjct: 557 GSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN 616 Query: 631 XGG 623 GG Sbjct: 617 TGG 619 Score = 41.9 bits (94), Expect = 8e-04 Identities = 30/118 (25%), Positives = 30/118 (25%), Gaps = 3/118 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G G G G G G GG G GG GG Sbjct: 382 GRNTNNGNNNNAGTSNVGNNGFTNNGVNNNNGNSNNGGNDKGGNTNGGNNN---GGNNGG 438 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGG---GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG GG G G GG G G G GG G Sbjct: 439 NNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNG 496 Score = 41.9 bits (94), Expect = 8e-04 Identities = 32/126 (25%), Positives = 32/126 (25%), Gaps = 2/126 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG--XGXXGGGXXXXGX 812 G G GG G G GG GG G GG G GG G Sbjct: 487 GNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGN 546 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G G G G GG G GG G GG Sbjct: 547 NGGSNNGGNDGS---NNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGN 603 Query: 631 XGGXXG 614 GG G Sbjct: 604 NGGNTG 609 Score = 38.3 bits (85), Expect = 0.009 Identities = 28/124 (22%), Positives = 28/124 (22%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GG G G GG GG G GG G G Sbjct: 428 GGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNN---NGGNN 484 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G G G GG G G G Sbjct: 485 NGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNG 544 Query: 625 GXXG 614 G G Sbjct: 545 GNNG 548 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 17/69 (24%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX---------PXPXP-------PXPXPPP 747 PP PP P P P PPP P PPPP P P P P PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Query: 748 PXX-PPPXP 771 P P P Sbjct: 744 PGQLPGQQP 752 Score = 36.7 bits (81), Expect = 0.029 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG---GGXGXGGXGX 714 G G G G G G G GG GG GG GG Sbjct: 378 GSSNGRNTNNGNNNNAGTSNVGNNGFTNNGVNNNNGNSNNGGNDKGGNTNGGNNNGGNNG 437 Query: 713 GXGXGGGGGXXXXGXG--GGXGXXGXGXXGGXXGG 615 G GG G G GG G G GG Sbjct: 438 GNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGG 472 Score = 34.3 bits (75), Expect = 0.15 Identities = 27/123 (21%), Positives = 27/123 (21%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG--GGXXXXGX 812 GG G G G G GG GG G GG G G G Sbjct: 418 GGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGG 477 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 GG G G G GG G G Sbjct: 478 NNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGEN 537 Query: 631 XGG 623 GG Sbjct: 538 NGG 540 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG GG G GG G G G G GG G G G Sbjct: 589 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNS 648 Query: 805 XGG 797 G Sbjct: 649 HSG 651 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPP 719 P PP PP P P P PPPPP PP Sbjct: 683 PPPPPPPPPPP--PPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = -1 Query: 985 GGGGGXGXGGG--XXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GG G GG G GG G G GG G GG G GG G Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN 642 Query: 811 XGXGGXGXG 785 G G Sbjct: 643 SGGSNSHSG 651 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GG G GG G GG G GG GG GG G GG Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNN 638 Query: 811 XGXGGXG 791 G G Sbjct: 639 NGGNSGG 645 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GG G G G GG G GG GG G G Sbjct: 592 GGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSG 651 Query: 805 XGGXGXGXG 779 G G Sbjct: 652 EVTIQPGGG 660 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PPPPP PP PP P P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP---------------QPSTPPPPPP 711 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P P P PPPP Sbjct: 712 STPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPP 744 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 65.7 bits (153), Expect = 5e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GG GGG GG G G G G G G G GGG GGGG G GG G G G GGGGG Sbjct: 48 GGDGGGGGGD---GDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGG-GGGDGDGGGGGDG 103 Query: 680 XXGXGGGXGXXGXG 639 G GG G G Sbjct: 104 GGGGDGGGGNDDDG 117 Score = 63.3 bits (147), Expect = 3e-10 Identities = 35/68 (51%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG G GGG G G G G GGG GG GGGG G GGG G G G GG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG--GGCDGGGGDGDGGG-GGDGDGGGGGDGG 104 Query: 713 GXGXGGGG 690 G G GGGG Sbjct: 105 GGGDGGGG 112 Score = 61.7 bits (143), Expect = 9e-10 Identities = 31/63 (49%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGG 696 GG GGG G G G G GG GGG G GG G GGGG G GG G G GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 695 GGG 687 GG Sbjct: 108 DGG 110 Score = 60.9 bits (141), Expect = 2e-09 Identities = 31/66 (46%), Positives = 31/66 (46%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG G G G G GGG GGG GGG G G G G G GGGG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG-GDGGGG 106 Query: 689 GXXXXG 672 G G Sbjct: 107 GDGGGG 112 Score = 59.3 bits (137), Expect = 5e-09 Identities = 32/74 (43%), Positives = 32/74 (43%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG GG G G GGG GGG GG G GGG G GGGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG----DGDGGGGGDG 103 Query: 767 XGGGXXGGGGXGXG 726 GGG GGG G Sbjct: 104 GGGGDGGGGNDDDG 117 Score = 58.4 bits (135), Expect = 8e-09 Identities = 34/74 (45%), Positives = 34/74 (45%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G G G G G G GGG GG GGG G GGGG G GG Sbjct: 48 GGDGGGGGGDGD-----GDDDDGDGNVGDDGGGDGGGCDGGGGD----GDGGGGGDGDGG 98 Query: 758 GXXGGGGXGXGGXG 717 G GGG G GG G Sbjct: 99 GGGDGGGGGDGGGG 112 Score = 58.0 bits (134), Expect = 1e-08 Identities = 33/74 (44%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXGGXXXXGGGXXXXGGXX 786 GG G GGG G G G G GGG GGG G G GG GGG GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG----GGDG 103 Query: 785 GGGGXGXGGGXXGG 744 GGGG G GG G Sbjct: 104 GGGGDGGGGNDDDG 117 Score = 56.0 bits (129), Expect = 4e-08 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGG 660 GG GGG G G G GG GGG G GG G G G G G GG G GGG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 659 XGXXGXGXXG 630 G G G Sbjct: 108 DGGGGNDDDG 117 Score = 55.2 bits (127), Expect = 8e-08 Identities = 28/60 (46%), Positives = 28/60 (46%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGGG G G G G G G G G G GGGG G GGG G G G GG G Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGG-DGDGGGGGDGDGGGGGDGGGGG 107 Score = 52.0 bits (119), Expect = 7e-07 Identities = 29/63 (46%), Positives = 29/63 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G G G G G GGGG G GG G G G GGG G G Sbjct: 52 GGGGGDGDGDDDDGD-GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG-GGGGDGGGGGDG 109 Query: 805 XGG 797 GG Sbjct: 110 GGG 112 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/67 (40%), Positives = 27/67 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G GGG G G G GGG G G GG GGG Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDGGGGGDGG 110 Query: 800 XGGXXGG 780 G G Sbjct: 111 GGNDDDG 117 Score = 48.4 bits (110), Expect = 9e-06 Identities = 29/68 (42%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXG-XGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GG GG G G G G G G GG GG G G GGG G GGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG----GDG 103 Query: 808 GXGGXGXG 785 G GG G G Sbjct: 104 GGGGDGGG 111 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 65.7 bits (153), Expect = 5e-11 Identities = 37/74 (50%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GG GGG GG G G G G G G G GGG GGGG G GG G G G GGGGG Sbjct: 63 GGDGGGGGGD---GDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGG-GGGDGDGGGGGDG 118 Query: 680 XXGXGGGXGXXGXG 639 G GG G G Sbjct: 119 GGGGDGGGGNDDDG 132 Score = 63.3 bits (147), Expect = 3e-10 Identities = 35/68 (51%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG G GGG G G G G GGG GG GGGG G GGG G G G GG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG--GGCDGGGGDGDGGG-GGDGDGGGGGDGG 119 Query: 713 GXGXGGGG 690 G G GGGG Sbjct: 120 GGGDGGGG 127 Score = 61.7 bits (143), Expect = 9e-10 Identities = 31/63 (49%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGG 696 GG GGG G G G G GG GGG G GG G GGGG G GG G G GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 695 GGG 687 GG Sbjct: 123 DGG 125 Score = 60.9 bits (141), Expect = 2e-09 Identities = 31/66 (46%), Positives = 31/66 (46%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG G G G G GGG GGG GGG G G G G G GGGG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG-GDGGGG 121 Query: 689 GXXXXG 672 G G Sbjct: 122 GDGGGG 127 Score = 59.3 bits (137), Expect = 5e-09 Identities = 32/74 (43%), Positives = 32/74 (43%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG GG G G GGG GGG GG G GGG G GGGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG----DGDGGGGGDG 118 Query: 767 XGGGXXGGGGXGXG 726 GGG GGG G Sbjct: 119 GGGGDGGGGNDDDG 132 Score = 58.4 bits (135), Expect = 8e-09 Identities = 34/74 (45%), Positives = 34/74 (45%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G G G G G G GGG GG GGG G GGGG G GG Sbjct: 63 GGDGGGGGGDGD-----GDDDDGDGNVGDDGGGDGGGCDGGGGD----GDGGGGGDGDGG 113 Query: 758 GXXGGGGXGXGGXG 717 G GGG G GG G Sbjct: 114 GGGDGGGGGDGGGG 127 Score = 58.0 bits (134), Expect = 1e-08 Identities = 33/74 (44%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXGGXXXXGGGXXXXGGXX 786 GG G GGG G G G G GGG GGG G G GG GGG GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG----GGDG 118 Query: 785 GGGGXGXGGGXXGG 744 GGGG G GG G Sbjct: 119 GGGGDGGGGNDDDG 132 Score = 56.0 bits (129), Expect = 4e-08 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGG 660 GG GGG G G G GG GGG G GG G G G G G GG G GGG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 659 XGXXGXGXXG 630 G G G Sbjct: 123 DGGGGNDDDG 132 Score = 55.2 bits (127), Expect = 8e-08 Identities = 28/60 (46%), Positives = 28/60 (46%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGGG G G G G G G G G G GGGG G GGG G G G GG G Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGG-DGDGGGGGDGDGGGGGDGGGGG 122 Score = 52.0 bits (119), Expect = 7e-07 Identities = 29/63 (46%), Positives = 29/63 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G G G G G GGGG G GG G G G GGG G G Sbjct: 67 GGGGGDGDGDDDDGD-GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDG-GGGGDGGGGGDG 124 Query: 805 XGG 797 GG Sbjct: 125 GGG 127 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/67 (40%), Positives = 27/67 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G GGG G G G GGG G G GG GGG Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDGGGGGDGG 125 Query: 800 XGGXXGG 780 G G Sbjct: 126 GGNDDDG 132 Score = 48.4 bits (110), Expect = 9e-06 Identities = 29/68 (42%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXG-XGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GG GG G G G G G G GG GG G G GGG G GGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG----GDG 118 Query: 808 GXGGXGXG 785 G GG G G Sbjct: 119 GGGGDGGG 126 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 64.9 bits (151), Expect = 1e-10 Identities = 47/142 (33%), Positives = 47/142 (33%), Gaps = 20/142 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX----PPP---------PXX 756 PP PP P P P P PPP P P PP P PPP P Sbjct: 307 PP--PPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLM 364 Query: 757 PPPXPXPP---PPXXPPXXXXPPPXXXXP----PXPPPXPPPXPPPXPXPPPXXXXXPXX 915 P PP PP PPP P P PPP PP P PP Sbjct: 365 STPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYI 424 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P PP P PPP P P Sbjct: 425 PPPPPGFPQFQPPPPPPPSDAP 446 Score = 60.1 bits (139), Expect = 3e-09 Identities = 39/123 (31%), Positives = 39/123 (31%), Gaps = 11/123 (8%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPX-----PPP 783 PP P PPP P PPP P P P PP PP PPP Sbjct: 329 PPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGPPP 388 Query: 784 PXXPPXXXXPPPXXXXPPX---PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P P PP P PP P PPP P PP P P Sbjct: 389 PWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAPWI 448 Query: 955 PPP 963 P Sbjct: 449 ERP 451 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/88 (32%), Positives = 29/88 (32%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P PP PPPP P P P PP P P PP P PPP Sbjct: 371 PPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPG 430 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PPP PPP P P P Sbjct: 431 FPQFQPPPPPPPSDAPWIERPKRFENNP 458 Score = 46.8 bits (106), Expect = 3e-05 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 6/129 (4%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPP P P P Sbjct: 320 PAPPPSQAPPP-----PKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGM 374 Query: 795 XPPXPXXPXXXXPPPXX------PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP PPP P PPP P P PP P P PP P P Sbjct: 375 RPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPP--PGFP 432 Query: 957 PPXPXPPPP 983 P PPPP Sbjct: 433 QFQPPPPPP 441 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 PP P P P P PPPP P P PP P P P Sbjct: 402 PPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAPWIERP 451 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 64.1 bits (149), Expect = 2e-10 Identities = 40/90 (44%), Positives = 40/90 (44%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GGG GG G GG GGG GGG GG G GG GG G Sbjct: 138 GRDGGGGGYRGGY-RGGYRGGYRGGRDRGGGYGGGGEGGYGM-----GGGDYSGGCGYGS 191 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG GG G G GG G G GGGGG Sbjct: 192 SYGGGGDYGGGPGYG-GGQGYGSYSGGGGG 220 Score = 60.9 bits (141), Expect = 2e-09 Identities = 35/79 (44%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGGGXXGGGGXGXGG-XG 717 GGG G GG GG GG G GGG G G G GG GG G G GG G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYG 200 Query: 716 XGXGXGGGGGXXXXGXGGG 660 G G GGG G GGG Sbjct: 201 GGPGYGGGQGYGSYSGGGG 219 Score = 58.4 bits (135), Expect = 8e-09 Identities = 38/88 (43%), Positives = 38/88 (43%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GG GG GG G GG GGGG G G GGG GG G G G Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEG---GYGMGGGDYSGGCGYGSSYG 194 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G G G G GG Sbjct: 195 GGGDY-GGGPGYG-GGQGYGSYSGGGGG 220 Score = 56.4 bits (130), Expect = 3e-08 Identities = 36/83 (43%), Positives = 36/83 (43%), Gaps = 6/83 (7%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGX-GXXGXXXXXGGGXGXGG----GXGGG-XGGGXGGXXXXGGGX 807 G GG G GG GG G GGG G GG G GGG GG G GGG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGG 197 Query: 806 XXXGGXXGGGGXGXGGGXXGGGG 738 GG GGG G G GGGG Sbjct: 198 DYGGGPGYGGGQGYGSYSGGGGG 220 Score = 47.6 bits (108), Expect = 2e-05 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GGG GG G G G G G G GG GGG G GGG Sbjct: 156 GGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPG----YGGGQGY 211 Query: 800 XGGXXGGGG 774 GGGG Sbjct: 212 GSYSGGGGG 220 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGG G G G GG G G GG GGG G GG G G GGG Sbjct: 169 GGGGEGGYGMGGGDYSGGCGYG-SSYGGGGDYGGGPGYGGGQGYGSYSGGGG 219 Score = 41.9 bits (94), Expect = 8e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGG G GG G G G G G G GGGG G G GG G G G Sbjct: 141 GGGGGYRGGYRG--GYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGD 198 Query: 802 GGXGXGXGG 776 G G G GG Sbjct: 199 YGGGPGYGG 207 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG 866 G G GGG G G G G G G GGG G Sbjct: 188 GYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGGNYDYQG 226 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 63.7 bits (148), Expect = 2e-10 Identities = 45/108 (41%), Positives = 45/108 (41%), Gaps = 3/108 (2%) Frame = -3 Query: 959 GGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGG-GXXXXGGX 789 GG G GG G GG G G G G GG GG G GG GG GG G GG Sbjct: 199 GGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGV 258 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G GGG G GG GG G G G G GG G G Sbjct: 259 IAGAGAGIGGGVIGTGGI-PGGILPGLAHGNLAG--LLGHGGLAGLAG 303 Score = 57.6 bits (133), Expect = 1e-08 Identities = 41/106 (38%), Positives = 41/106 (38%), Gaps = 3/106 (2%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXG--GGXXXXGGXXGGGGXGXGGG 756 GG G G GG G G G G GG GG G GG GG G GG G GGG Sbjct: 199 GGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLG-GGG 257 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G GG G G GG G G G G G G Sbjct: 258 VIAGAGAGIGGGVIGTGGIPGGILPGLAHGNLAGLLGHGGLAGLAG 303 Score = 57.2 bits (132), Expect = 2e-08 Identities = 43/108 (39%), Positives = 43/108 (39%), Gaps = 4/108 (3%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG----GGXXXXGGXXGGGGXGXGG 759 GG G GG G GG GG G G G G GG GG G GG G G Sbjct: 186 GGTGPVITEVAGLGGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVG 245 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG G GG G G G GGG G GG G G G G Sbjct: 246 GLGGIGGLGGGGVIAGAGAGIGGG--VIGTGGIPGGILPGLAHGNLAG 291 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = -3 Query: 977 GXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGX---GXGGGXGGG--XGGGXGGXXXXG 816 G G GG G GG G GG G G GGG G G G GGG GG G G Sbjct: 224 GAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGGIPGGILPG 283 Query: 815 GGXXXXGGXXGGGG 774 G G GG Sbjct: 284 LAHGNLAGLLGHGG 297 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 62.9 bits (146), Expect = 4e-10 Identities = 33/68 (48%), Positives = 33/68 (48%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GGG G GGG GG GG GG GG G G GG GGGG G GG Sbjct: 179 GGGGSQGGGYRSG-GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDY 237 Query: 710 XGXGGGGG 687 G GGG Sbjct: 238 GGGSKGGG 245 Score = 62.5 bits (145), Expect = 5e-10 Identities = 33/71 (46%), Positives = 33/71 (46%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G GGG G GG GG GG GG G G GG GGGG G GG Sbjct: 176 GDSGGGGSQGGGYRSGGG-GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGR 234 Query: 755 XXGGGGXGXGG 723 GGG GG Sbjct: 235 HDYGGGSKGGG 245 Score = 62.5 bits (145), Expect = 5e-10 Identities = 35/74 (47%), Positives = 35/74 (47%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG G GG GGG GG GG G G GGG GGG G GG G G G GG GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGY---GGSKGGYGGGSGGGGYGGG-RGGGGYGGGHGGGGYGG 231 Query: 686 XXXXGXGGGXGXXG 645 GGG G Sbjct: 232 GGRHDYGGGSKGGG 245 Score = 62.1 bits (144), Expect = 7e-10 Identities = 35/74 (47%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGGGGXXXXGX 669 G GG GGG GG GG G GGG GGG G G GG G G G GGGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGG-----YG 230 Query: 668 GGGXGXXGXGXXGG 627 GGG G G GG Sbjct: 231 GGGRHDYGGGSKGG 244 Score = 61.7 bits (143), Expect = 9e-10 Identities = 33/69 (47%), Positives = 33/69 (47%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GGG GGG G G G GGG G G G GGG GGG GG GGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSG-GGGYGGGRG-GGGYGGGHGGGGYGGGGRHD 236 Query: 800 XGGXXGGGG 774 GG GGG Sbjct: 237 YGGGSKGGG 245 Score = 60.5 bits (140), Expect = 2e-09 Identities = 35/74 (47%), Positives = 35/74 (47%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG GG GG G G GGG G GGG GGG GGG GG GG G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSG-GGGYGGGRGGG------GYGGGHGGGGYGG 231 Query: 782 GGGXGXGGGXXGGG 741 GG GGG GGG Sbjct: 232 GGRHDYGGGSKGGG 245 Score = 59.7 bits (138), Expect = 4e-09 Identities = 35/76 (46%), Positives = 35/76 (46%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GGG GGG GG GG GG G G GG GGG G GGG GGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGG----GSGGGGYGGGRGGG--GYGGGHGGGGY 229 Query: 737 XGXGGXGXGXGXGGGG 690 G G G G GGG Sbjct: 230 GGGGRHDYGGGSKGGG 245 Score = 59.7 bits (138), Expect = 4e-09 Identities = 34/76 (44%), Positives = 34/76 (44%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GG GGG G GG GG GG GGGG G G GGGG G G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGY---GGSKGGYGGGSGGGGYGGG---RGGGGYGGGHGGGGY 229 Query: 707 GXGGGGGXXXXGXGGG 660 G GG GGG Sbjct: 230 GGGGRHDYGGGSKGGG 245 Score = 58.8 bits (136), Expect = 6e-09 Identities = 34/69 (49%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GGG GG GGG G GG G GGG G GG G G G GG GG G GG G Sbjct: 179 GGGGSQGGGYRSGGG-GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDY 237 Query: 641 GXXGGXXGG 615 G GG GG Sbjct: 238 G--GGSKGG 244 Score = 56.4 bits (130), Expect = 3e-08 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 GGG GGG GG G G G GGG G GG G G G GGG G G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 799 GXGXGXG 779 G G G Sbjct: 239 GGSKGGG 245 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG GGG G GG G G G GG GGG G G GG GG G GGG G Sbjct: 185 GGGYRSGGGGYGGSKGGYGGGSGG---GGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGS 241 Query: 805 XGG 797 GG Sbjct: 242 KGG 244 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/55 (47%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG---GXGGGGXGXXGGXGGGXGXXGGG 830 GGGG G GG G GG G G G G G GGGG G G G G GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 47.6 bits (108), Expect = 2e-05 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = -3 Query: 776 GXGXGGGXXGG----GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG GG GG G GG G G G GGG G GG G G G GG GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGG--GGYGGGHGGGGYGG 231 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 62.5 bits (145), Expect = 5e-10 Identities = 43/120 (35%), Positives = 43/120 (35%), Gaps = 7/120 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXG-----GGXGXGGGXGGGXGGGXGGXXXXGG 813 G GGG G GG GG G G G G G GG G GG GG G Sbjct: 438 GDGAIGGGGDGAIGG--GGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIG 495 Query: 812 GXXXXGGXXGGGGXGXGG--GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G G G G GGG G GG G GG G GGG G G Sbjct: 496 GDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 57.6 bits (133), Expect = 1e-08 Identities = 39/119 (32%), Positives = 39/119 (32%), Gaps = 2/119 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G GG G G G GG G GG GG GG Sbjct: 440 GAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIGGDND 499 Query: 800 XGGXXGGGGXGXGG--GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G GGG G GG G G GG G G G G G Sbjct: 500 DGAIGGDDGATVDGDDGAIGGGAIGDGGDNGG---GDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 55.6 bits (128), Expect = 6e-08 Identities = 39/120 (32%), Positives = 39/120 (32%), Gaps = 3/120 (2%) Frame = -3 Query: 968 GXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXXXXG 795 G G G G GG G GG G G G G G GGG GG G Sbjct: 436 GIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIG 495 Query: 794 GXXGGGGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G GG G G GGG G G G G G G Sbjct: 496 GDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 54.4 bits (125), Expect = 1e-07 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 3/112 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXG-XGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX 765 GG G G G GGG G G G G G GGG GG GG Sbjct: 435 GGIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAI 494 Query: 764 GGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G GGG G GG G G GG Sbjct: 495 GGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGG 546 Score = 44.4 bits (100), Expect = 1e-04 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 15/113 (13%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG------ 833 GGGG GGG G G G G G GGGG G GG G GG Sbjct: 443 GGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIGGDNDDGA 502 Query: 832 -----GXXXXGXXG-XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 G G G GG G GG G GG GGGG Sbjct: 503 IGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 39.5 bits (88), Expect = 0.004 Identities = 35/124 (28%), Positives = 35/124 (28%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GGG G GG G G G G G GGG GG G G Sbjct: 435 GGIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGG--DIGGNNG 492 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G G G G GG G G G GG Sbjct: 493 AIGGDNDDGAIGGDDGATVDGDDGAIG-GGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDN 551 Query: 625 GXXG 614 G G Sbjct: 552 GGGG 555 Score = 34.3 bits (75), Expect = 0.15 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 1/102 (0%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G GG G G G G G G G GGGG Sbjct: 396 GNGGAFAFQAAGGDVAAVNVGGFGDRVIGCTGDVAAICIGGIGDGAIGGGGDGA-IGGGG 454 Query: 737 XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG-XGXXGGXXGG 615 G G G G G GGG G G G GG Sbjct: 455 DGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIGG 496 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 62.1 bits (144), Expect = 7e-10 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 2/98 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG--GGX 807 GG GG G GG GG G G G G GG GG GGG GG G G Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGG-GGQEGGGQGGAQAGGSTSGS 162 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GGGG G GG G G G GG Sbjct: 163 SSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGG 200 Score = 58.8 bits (136), Expect = 6e-09 Identities = 37/97 (38%), Positives = 37/97 (38%), Gaps = 6/97 (6%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGX-GGXXXXGG--GXXXXGGXXGGGGX---GXGGGXXGGGGXGXG 726 GG GGG GG GG GG GG G GG GGGG G GG GG G Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSS 163 Query: 725 GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG G GG G G GG Sbjct: 164 SGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGG 200 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/98 (33%), Positives = 33/98 (33%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG G G G GG G GG GG G GG GGG G G G Sbjct: 104 GGTAEGGGEAGGEA--GGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSG 161 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG G GG G GG G G G G Sbjct: 162 SSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAG 199 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG-XGXXGGGXXXXGXX 809 GGG G GG G G G G GG GGG GG GG G G G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGAT 168 Query: 808 GXGGXGXGXGG 776 GG G G Sbjct: 169 SGGGGVSGSSG 179 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG GGG G G G G GG GGG G G G GG G Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGV 174 Query: 805 XGGXGXGXGG 776 G G G Sbjct: 175 SGSSGTSIAG 184 Score = 35.9 bits (79), Expect = 0.050 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 1/107 (0%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG-XXGGGXXXXGXXGXGGXGXG 785 G G G G GG GG G G GG G GGG G GG G Sbjct: 94 GTAQAGASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGA 153 Query: 784 XGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 G G G G GG G G G Sbjct: 154 QAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGG 200 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 61.7 bits (143), Expect = 9e-10 Identities = 32/53 (60%), Positives = 32/53 (60%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 GGG G GGG GGG GGG GG GGG GG GGGG G G G GGGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGG----GGG----GGFGGGGGGGGGFGGGGGGGFG 128 Score = 59.3 bits (137), Expect = 5e-09 Identities = 27/48 (56%), Positives = 27/48 (56%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GG GGG GGG G GGG GG GGG G GGG GGGG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 59.3 bits (137), Expect = 5e-09 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG G GGG GGGG G GG G G GGGGG G GGG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 58.8 bits (136), Expect = 6e-09 Identities = 41/118 (34%), Positives = 41/118 (34%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG GG G G GGG G GGG GGG GGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGG-----GGGFGGGGGGGGGFGGGGGG--GFGSRARP 133 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G GG GG G GG G G Sbjct: 134 ASSNSNACRHFLKGNCWHGDNCKYSHDVSNAGQGGFGGQPRLGQQGGAFGQSRGGFSG 191 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/47 (55%), Positives = 26/47 (55%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 G GGG G GGG G GG G G GG GGGG G GG GGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 51.6 bits (118), Expect = 9e-07 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GG GG GGG G GG G G G G GGGG G GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G G G GGGGG G GGG G G GG GG Sbjct: 81 GGRG-GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/45 (53%), Positives = 24/45 (53%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G GG G G G GGGGG G GGG G G G G GG Sbjct: 81 GGRGGGFGGGG-GFG-GGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 61.7 bits (143), Expect = 9e-10 Identities = 41/105 (39%), Positives = 41/105 (39%), Gaps = 2/105 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G G G GG G G G GG G G GG GGG G GGG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG- 383 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GGG GGG G G G G G G GG G Sbjct: 384 DHGGGDHGGG--DHGGGDYGDGDHGDGDLFNGDRDHGDGGDRHHG 426 Score = 60.1 bits (139), Expect = 3e-09 Identities = 36/87 (41%), Positives = 36/87 (41%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GG G G GG GGG G GGG GG GGG G G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGG-DHGGGDHGGG--DHGDGDHG 381 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG G G G G GG G G G Sbjct: 382 GGDHGGGDHGGGDHGGGDYGDGDHGDG 408 Score = 59.3 bits (137), Expect = 5e-09 Identities = 37/97 (38%), Positives = 37/97 (38%), Gaps = 4/97 (4%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXG 768 GG G G G GG G G GG GGG G GGG G G GG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGD 384 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGG 663 GGG GGG G G G G G G G GG Sbjct: 385 HGGGDHGGGDHGGGDYGDGDHGDGDLFNGDRDHGDGG 421 Score = 57.6 bits (133), Expect = 1e-08 Identities = 36/84 (42%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G G GG GGG G GGG GG GGG GGG GGG G G G G Sbjct: 328 GDHGDGDHGGGDPGGGDPGGGDPGGG-DPGGGDPGGG--DHGGGDHGGGDHGDGDHGGGD 384 Query: 707 GXGGGGGXXXXGXGG-GXGXXGXG 639 GG G G G G G G G Sbjct: 385 HGGGDHGGGDHGGGDYGDGDHGDG 408 Score = 53.2 bits (122), Expect = 3e-07 Identities = 36/84 (42%), Positives = 36/84 (42%), Gaps = 5/84 (5%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGG---GGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 G G G G G GGG GG GG GG GGG GGG G G G G GG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPG-GGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 Query: 695 --GGGXXXXGXGGGXGXXGXGXXG 630 GGG G GG G G G G Sbjct: 384 DHGGGDHGGGDHGG-GDYGDGDHG 406 Score = 51.6 bits (118), Expect = 9e-07 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGGXGXG-XGXGGGGGXXX 678 G G G GGG G GG GG GGG GGG G G G G G G GG Sbjct: 326 GDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDH 385 Query: 677 XGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G Sbjct: 386 GGGDHGGGDHGGGDYGDGDHG 406 Score = 50.0 bits (114), Expect = 3e-06 Identities = 32/76 (42%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG--GGGXXXXGXGG 663 GG G G GG GGG GGG GGG G G G G GG GGG G G Sbjct: 325 GGDGDHGDGDHG-GGDPGGG--DPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHG 381 Query: 662 GXGXXGXGXXGGXXGG 615 G G GG GG Sbjct: 382 GGDHGGGDHGGGDHGG 397 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 61.3 bits (142), Expect = 1e-09 Identities = 39/102 (38%), Positives = 39/102 (38%), Gaps = 4/102 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX-PXXXXPPP-PPXPXPXPXPPXPXPPPPXX--PPPXPXPPP 783 PP PP P P PP P PP PP P P PPPP PPP PPP Sbjct: 428 PP--PPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPP 485 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PP PP PP P PPP P P P Sbjct: 486 PFGPP-----PPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYP 522 Score = 59.7 bits (138), Expect = 4e-09 Identities = 33/95 (34%), Positives = 33/95 (34%), Gaps = 3/95 (3%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP-- 837 PP P PP P P P P PP PPP PP PPP PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 838 -XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPP PPP PPP P P P Sbjct: 488 GPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYP 522 Score = 57.6 bits (133), Expect = 1e-08 Identities = 35/106 (33%), Positives = 35/106 (33%), Gaps = 5/106 (4%) Frame = +1 Query: 667 PXPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P PPPP P P PP P P P PPP PPP PP Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPR 480 Query: 844 PPXPPPXPPPXP----XPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP PP P PPP P P PP P P Sbjct: 481 GFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDP 526 Score = 55.2 bits (127), Expect = 8e-08 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 11/91 (12%) Frame = +1 Query: 739 PPPPXXPPPXPXPP--------PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPX 894 PPP PP P PP PP PP PPP PPP PPP PPP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNL--PPPPGGMRGMPPPPMGMYPPPRGFPPP- 485 Query: 895 XXXXPXXPXPPXX---PPPXPXXPPPXPXXP 978 P P PP PPP PPP P Sbjct: 486 ----PFGPPPPFYRGPPPPRGMPPPPRQRMP 512 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/97 (35%), Positives = 34/97 (35%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPP P P PP P P P PPP PPP PP P P P Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPP---PRGFP-P 484 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PPP P PP PP P P P Sbjct: 485 PPFGPPPPFY----RGPPPPRGMPPPPRQRMPSQGPP 517 Score = 49.2 bits (112), Expect = 5e-06 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 6/72 (8%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPX-PPPXPPXXPXPPPPX----PPXXXXPXPX-PXPPXXP 947 P P PP P PP P PPP PPPP PP P P P PP Sbjct: 437 PQPRPPH-GMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYR 495 Query: 948 XXPPPXPXPPPP 983 PPP PPPP Sbjct: 496 GPPPPRGMPPPP 507 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 8/77 (10%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPP------PXPPXXPXPPPPX--PPXXXXPXPXPX 932 PP P P P PP P PP P PP PPP PP P P Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYR 495 Query: 933 PPXXPXXPPPXPXPPPP 983 P P PP P P Sbjct: 496 GPPPPRGMPPPPRQRMP 512 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP P P PP P PPPP P P P PP P P Sbjct: 477 PPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDP 526 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P PPP PP P PP P Sbjct: 452 PQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGP---------PPPFYRGPPPPRG 502 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXP 866 PP P PP P P Sbjct: 503 MPPPPRQRMPSQGPPQVHYPSQDP 526 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 61.3 bits (142), Expect = 1e-09 Identities = 31/78 (39%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 PPP PPPP P P P P P PP P PPPP PP PP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQ 412 Query: 835 PXPPPXPPPXPPPXPXPP 888 PPP PP P P P Sbjct: 413 TLPPPSVPPPPIGVPNRP 430 Score = 52.4 bits (120), Expect = 5e-07 Identities = 39/115 (33%), Positives = 39/115 (33%), Gaps = 5/115 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G G G G G G GG GG GG G GG Sbjct: 2232 GGGGGGAGIGQGDCMD-GDPGQAGGNGTRHGGRGGKGGVVFESVGGINPMNFGASAGGGL 2290 Query: 788 XGGGGXGXGGGXXGG-----GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG GG G G GGGG GGG G G G Sbjct: 2291 YSDGGASPGDFETGGKSFLNGGEGGESRAGPVGGFGGGGSSRIRPGGGGGYSGGG 2345 Score = 49.2 bits (112), Expect = 5e-06 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPP P P P P PPPP PPP PPP PPP Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPM---IGPVTVPPPPLIPPPQASIPPPTM--IQTLPPP 417 Query: 820 XXXXPPXPPPXPPPXPPPXPXP 885 PP P P P P Sbjct: 418 SVPPPPIGVPNRPSVLYPNNNP 439 Score = 46.4 bits (105), Expect = 4e-05 Identities = 31/90 (34%), Positives = 31/90 (34%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P PPPP P P P P P PPP PPP P PP Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNP---HVPPPMIGPVTVPPP-PLIPPPQAS 404 Query: 880 XPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP PP PP P P P Sbjct: 405 IPPPTM----IQTLPPPSVPPPPIGVPNRP 430 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 7/85 (8%) Frame = +1 Query: 745 PPXXPPPX---PXPPPPXXPPXXXXPP--PXXXXPPXPPPX--PPPXPPPXPXPPPXXXX 903 P PPP PPPP P PP P P PPP P PPP PPP Sbjct: 349 PVIVPPPNLLFSFPPPPIIP---IPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASI 405 Query: 904 XPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP P P P P Sbjct: 406 PPPTMIQTLPPPSVPPPPIGVPNRP 430 Score = 44.4 bits (100), Expect = 1e-04 Identities = 33/99 (33%), Positives = 33/99 (33%), Gaps = 3/99 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX---GGGXGGXXXXGGGX 807 G G GG GG G G G GGG GG G GG Sbjct: 2248 GDPGQAGGNGTRHGGRGGKGGVVFESVGGINPMNFGASAGGGLYSDGGASPGDFETGGKS 2307 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G GG GGGG G G G GGG Sbjct: 2308 FLNGGEGGESRAGPVGGF-GGGGSSRIRPGGGGGYSGGG 2345 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P PP PPP P P P P PP PPPP P Sbjct: 368 PIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVP 427 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 10/71 (14%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXX---PXPPPPXPPXXXXPXPXPXPPXXPXXPP---- 959 P P PPP P PPP P PPP P P P PP PP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQ 412 Query: 960 ---PXPXPPPP 983 P PPPP Sbjct: 413 TLPPPSVPPPP 423 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 5/62 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP-----XPPPPXXPPPXPXPP 780 PP P P P PP PPPP P P P P PPP PPP P Sbjct: 370 PPPAMPAMFNPHVP-PPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPN 428 Query: 781 PP 786 P Sbjct: 429 RP 430 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXX-PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 P P P P P PPP P P PP P P PP P PP P Sbjct: 365 PIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQT-LP-PPSVP-- 420 Query: 954 PPPXPXPPPP 983 PPP P P Sbjct: 421 PPPIGVPNRP 430 Score = 35.9 bits (79), Expect = 0.050 Identities = 37/112 (33%), Positives = 37/112 (33%), Gaps = 20/112 (17%) Frame = -3 Query: 890 GGGXGXGGGXGG------GXGGGXGGXXXXGGGXXXXGGXXGGG------GXGXGGGXXG 747 GGG G G G G G GG G GG GG G GGG Sbjct: 2233 GGGGGAGIGQGDCMDGDPGQAGGNGTRHGGRGGKGGVVFESVGGINPMNFGASAGGGLYS 2292 Query: 746 GGGXGXGG---XGXGXGXGGGGGXXXXGXGGGXGXXG-----XGXXGGXXGG 615 GG G G GG GG G GG G G G GG GG Sbjct: 2293 DGGASPGDFETGGKSFLNGGEGGESRAGPVGGFGGGGSSRIRPGGGGGYSGG 2344 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PPP PP PP PPPP P P P P Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPNRPSVLYPNNNP 439 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G GG GG G GG GGGG GGG G GGG Sbjct: 2295 GASPGDFETGGKSFLNGGEGGESRAGPVGGFGGGGSSRI-RPGGGGGYSGGG 2345 Score = 32.7 bits (71), Expect = 0.47 Identities = 33/112 (29%), Positives = 33/112 (29%), Gaps = 9/112 (8%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG---GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG- 813 GG GG G GG GG GGG GG G G GG Sbjct: 2254 GGNGTRHGGRGGKGGVVFESVGGINPMNFGASAGGGLYSDGGASPGDFETGGKSFLNGGE 2313 Query: 812 GXXXXGGXXGGGGXGXG-----GGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G G GG G G GG G G G GGG G Sbjct: 2314 GGESRAGPVGGFGGGGSSRIRPGGGGGYSGGGVESDRHVFVVAGGGASFNNG 2365 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GG G G G GGG GG G GG G G Sbjct: 2255 GNGTRHGGRGGKGGVVFESVGGINPMNFGASAGGGLYSDGGASPGDFETGGKSFLNGGEG 2314 Query: 805 XGGXGXGXGG 776 GG Sbjct: 2315 GESRAGPVGG 2324 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 60.9 bits (141), Expect = 2e-09 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 1/91 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P PPP P PPP PPP PP PP PPP P Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMR 1260 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP PP P PP P P Sbjct: 1261 PMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 55.6 bits (128), Expect = 6e-08 Identities = 33/98 (33%), Positives = 33/98 (33%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP P P PP PPP P PP P PPP Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMR 1260 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP PP PP P P P P PP P P P Sbjct: 1261 PMPPQ--PPFMPPPPRMQP-----PGPPGPPGPPGPQP 1291 Score = 53.6 bits (123), Expect = 2e-07 Identities = 33/94 (35%), Positives = 33/94 (35%), Gaps = 3/94 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P PPP PP P PP PP PPP PP Sbjct: 1201 PNRPPTTAIPP-PMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPP--PP 1257 Query: 799 XXXXPPPXXXXPPXPP---PXPPPXPPPXPXPPP 891 PP P PP P PP PP P P P Sbjct: 1258 GMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 53.6 bits (123), Expect = 2e-07 Identities = 35/94 (37%), Positives = 35/94 (37%), Gaps = 3/94 (3%) Frame = +1 Query: 688 PPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PP P P P PPP PPPP PP PP PP PPP Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDG--PPKFMGLPP-PPPGMR 1260 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP P PP P P PP PP P P Sbjct: 1261 PMPPQPPFMPPPPRMQP--PGPPG-PPGPPGPQP 1291 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP PP P PPP P P PP P P PP PP P PP P P P Sbjct: 1238 PPAMPPDGPPKFMGLPPPPPGMR--PMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 60.9 bits (141), Expect = 2e-09 Identities = 41/126 (32%), Positives = 41/126 (32%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGX-----GXGGGXGGGXGGGXGGXXXXGG 813 G G GG GGG G GG GGG G G GG GG GG Sbjct: 233 GYKGGQGGTSSGGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGG 292 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G G G GGG GG G G GG GG G G G Sbjct: 293 GGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNC 352 Query: 632 GGXXGG 615 GG Sbjct: 353 QAGNGG 358 Score = 56.8 bits (131), Expect = 3e-08 Identities = 45/134 (33%), Positives = 45/134 (33%), Gaps = 12/134 (8%) Frame = -3 Query: 980 GGXXGXG--GGXXGXGGGXXGGXGXXGXXXXXGGGXGXG---GGXGGGXGGGXGGXXXXG 816 GG G G GG G G GG GGG G G GG GG G Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGS 332 Query: 815 GGXXXX--GGXXGGGGX-----GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGX 657 GG G GGGG G GG GG G G GGGGG G Sbjct: 333 GGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTA-SMGGGGGGLQFGNQDYT 391 Query: 656 GXXGXGXXGGXXGG 615 G GG GG Sbjct: 392 SRLSYGGGGGGGGG 405 Score = 55.6 bits (128), Expect = 6e-08 Identities = 40/120 (33%), Positives = 40/120 (33%), Gaps = 7/120 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG--GXGGGXGGXXXXGGGXX 804 G G GGG GG GG G GG G G GGG GG Sbjct: 303 GAGGGGGGGHFSGGA--GGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNS 360 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG-----XGXGGGGGXXXXGXGGGXGXXGXG 639 G GG G GGGG G G GGGGG G GG G G G Sbjct: 361 CQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 53.6 bits (123), Expect = 2e-07 Identities = 38/116 (32%), Positives = 38/116 (32%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G GG G G GGG G GGG GG G G G Sbjct: 270 GNAGGGAGEGSTGGPG--GINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTN 327 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG G GG G G GG G G G GG GG Sbjct: 328 QYG-GSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGG 382 Score = 52.4 bits (120), Expect = 5e-07 Identities = 48/147 (32%), Positives = 48/147 (32%), Gaps = 27/147 (18%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG-XGGGXGGXXXXG----- 816 G G G G GG G G G GGG GGG GG GG G Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQY 329 Query: 815 GG-----XXXXGGXXGGGG-----XGXGGGXXGGGGXGXGGXGXGXGXGGGGG------- 687 GG G GGGG G GG GG G G GGGGG Sbjct: 330 GGSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQD 389 Query: 686 ----XXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G GG G Sbjct: 390 YTSRLSYGGGGGGGGGSAFGIEGGRGG 416 Score = 49.6 bits (113), Expect = 4e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 3/110 (2%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG--- 768 GG G G G G GG GG GG G G GG GG G Sbjct: 263 GGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAA 322 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G GGGG GG G GG G Sbjct: 323 TGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAG 372 Score = 48.8 bits (111), Expect = 7e-06 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 11/132 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG--XXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GGG G G GG G G G G G GGGG G G GG G G Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGS 332 Query: 811 XGXG----GXGXGXGGXXXXXXXXXXXXXGXXGXXGG-----XXXGGGGGXXXXXXGXGX 659 G G G GG G GG GGGGG Sbjct: 333 GGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTS 392 Query: 658 XXXXGXGGXXGG 623 G GG GG Sbjct: 393 RLSYGGGGGGGG 404 Score = 44.0 bits (99), Expect = 2e-04 Identities = 44/138 (31%), Positives = 44/138 (31%), Gaps = 14/138 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXX------GGXGXGXGXXXXGGXGGG-GXGXXGGXGG-GXGXXGGG 830 GG GG GGG G G G G GGG G G GG GG G GG Sbjct: 236 GGQGGTSSGGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGD 295 Query: 829 XXXXGXXGXGGXGXG---XGGXXXXXXXXXXXXXGXXGXXGGXXXG---GGGGXXXXXXG 668 G GG G G GG G G G GGGG G Sbjct: 296 STTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAG 355 Query: 667 XGXXXXXGXGGXXGGXXG 614 G GG GG G Sbjct: 356 NGGNSCQ-RGGQSGGAAG 372 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G GGG G G GG GGGG G G GG G GGG Sbjct: 369 GAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 34.7 bits (76), Expect = 0.12 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG--GXXXXGGGX 807 G G GG G G G GGG GG G GGG Sbjct: 341 GACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGG- 399 Query: 806 XXXGGXXGGGGXGXGGGXXGGGG 738 GG GG G GG G GG Sbjct: 400 ---GGGGGGSAFGIEGGRGGHGG 419 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G GGG G G G G GGG GG G GG GGG Sbjct: 364 GGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGG-GGSAFGIEGGRGGHGGG 420 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 60.5 bits (140), Expect = 2e-09 Identities = 23/33 (69%), Positives = 23/33 (69%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PPPPP P P P PP P PPPP PPP P PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPP--PPPFPPPPPP 494 Score = 56.4 bits (130), Expect = 3e-08 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PPPPP P P P PP P PPPP PPP P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 56.0 bits (129), Expect = 4e-08 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 PPPPP P P P PP P PPPP PPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 55.6 bits (128), Expect = 6e-08 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 PPPP P P PP P PPPP PPP P PPPP P Sbjct: 464 PPPPPPPP---PPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPP P PPPP PP PPP PP PPP PPP PPP P Sbjct: 464 PPPPPPPPPPPPPP----PPP---PPPPPPPFPPP-PPPTP 496 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP PPP PPP P PPP PP PPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPP----------PPPPPPPFPPPPPPTP 496 Score = 53.2 bits (122), Expect = 3e-07 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PPPP PPP P PPPP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP---PPPP 494 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 PPP P PPPPP P P P PP P PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PPP P PPPPP P P P PP P PPP PPP P Sbjct: 464 PPPPPPPP---PPPPPPPPPPPPPPPPFPPP---PPPTP 496 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/39 (58%), Positives = 23/39 (58%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PPPP PPP P PPPP PP PPP PP PPP P Sbjct: 464 PPPPPPPPPPPPPPPP--PP----PPPPPPFPPPPPPTP 496 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/43 (58%), Positives = 25/43 (58%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PP P PPPP PP PPP PP PPP PPP PPP P P Sbjct: 464 PPPPPPPPP--PP----PPP----PPPPPPPPPPFPPPPPPTP 496 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/38 (60%), Positives = 23/38 (60%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPP PP PPP PP PPP PPP PPP P PPP Sbjct: 464 PPPPPPP----PPP----PPPPPPPPPPPPPPFPPPPP 493 Score = 52.0 bits (119), Expect = 7e-07 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PPP P PPP PP P PPPP PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/34 (58%), Positives = 20/34 (58%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPPP PP P P P PP P PPP P PPPP Sbjct: 464 PPPPPPP---PPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 49.6 bits (113), Expect = 4e-06 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P PPP PP P PPPP PP P P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 49.2 bits (112), Expect = 5e-06 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP 899 P PP P P PPP P PPP PP P PPPP P Sbjct: 464 PPPPPPPPPP---PPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 5e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P P P PPP P PPPPP P P P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 5e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 P P PPP P PPPPP P P P PP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 5e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 PPP P P PPP P P PP P PP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 48.8 bits (111), Expect = 7e-06 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P PPPP PP P P P PP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.6 bits (108), Expect = 2e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P P PPP P PPPPP P P P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPP-PPPPPFPPPPPPTP 496 Score = 47.6 bits (108), Expect = 2e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PPP PP PPP PPP PPP P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.4 bits (105), Expect = 4e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP PP P P P PPP P PPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P P P PPP P PPPPP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 713 PXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXP 808 P P P P PPPP PPP PP P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 734 PXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PPPP PPP PP P P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 734 PXPPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 P PPPP PPP PP P P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 734 PXPPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 P PPPP PPP PP P P P P PP Sbjct: 464 PPPPPP-PPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P PP PP P P P PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P PP PP P P P PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P PP PP P P P PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 60.1 bits (139), Expect = 3e-09 Identities = 41/121 (33%), Positives = 41/121 (33%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G G GG G GG G GGG G GG GG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGP-RGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDH 479 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GGG GG GG G G G G G G G G GG Sbjct: 480 YDSYYGGGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRG 539 Query: 620 G 618 G Sbjct: 540 G 540 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/104 (33%), Positives = 35/104 (33%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G GG G GGG G GG GG G G GGG G GG Sbjct: 409 GQSGFGSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRD 468 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGG G G G G GG GG Sbjct: 469 DYGYGGGSYDHYDSYYGGGYDDYYGGGPPRGGP-RGGRGGSRGG 511 Score = 47.2 bits (107), Expect = 2e-05 Identities = 41/127 (32%), Positives = 41/127 (32%), Gaps = 6/127 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG--GXGGGXGGGXGGXXXXGGGXX 804 G G G GG G G G GG GG G GG G G GG GG Sbjct: 409 GQSGFGSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQG-GGYEGYSGGYR 467 Query: 803 XXGGXXGGG----GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GG GGG G G G G GG G G G G Sbjct: 468 DDYGYGGGSYDHYDSYYGGGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGR 527 Query: 635 XGGXXGG 615 GG GG Sbjct: 528 GGGDFGG 534 Score = 45.6 bits (103), Expect = 6e-05 Identities = 35/102 (34%), Positives = 35/102 (34%), Gaps = 6/102 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX------GGGXGGGXGGGXGGXXXX 819 GG G GG G GGG G G GGG GGG GGG Sbjct: 444 GGPRGYDGGY-GQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDYYGGGPPRGGPR 502 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GG G G G G GG GG G G G Sbjct: 503 GGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGGTTPG 544 Score = 43.2 bits (97), Expect = 3e-04 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 1/125 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GG GG G G G G G G G G GGG G GG G GG Sbjct: 424 GGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSY 483 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 GG GG G G GG G G G G G GG Sbjct: 484 YGGGYDDYYGG----GPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRG 539 Query: 628 GGXXG 614 G G Sbjct: 540 GTTPG 544 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 59.7 bits (138), Expect = 4e-09 Identities = 41/108 (37%), Positives = 41/108 (37%), Gaps = 5/108 (4%) Frame = -3 Query: 980 GGXXGXGG--GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGG 813 GG G G G G GG G G GG GG GG GG GG Sbjct: 406 GGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQND 465 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG-XGXGXGGGGGXXXXG 672 GG GGG G GGG GGGG G G GGGGG G Sbjct: 466 VEGGFGG--GGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 56.0 bits (129), Expect = 4e-08 Identities = 35/101 (34%), Positives = 35/101 (34%), Gaps = 2/101 (1%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGG--GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXX 750 G G GG G G G G GGG G G GG G GG G Sbjct: 395 GNPGYGGSQFRGGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLA 454 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G GGGGG G GGG G G G Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 55.6 bits (128), Expect = 6e-08 Identities = 37/109 (33%), Positives = 37/109 (33%), Gaps = 2/109 (1%) Frame = -3 Query: 959 GGXXGXGG--GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXX 786 GG G G G G G G G G G GG G GG Sbjct: 406 GGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQND 465 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GGG G GG G GG G GG G GGG G G Sbjct: 466 VEGGFGGGGGPNGAGGGGGGGGGYS---GGASGSRSNSCGGGGGSYNAG 511 Score = 51.6 bits (118), Expect = 9e-07 Identities = 39/121 (32%), Positives = 39/121 (32%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG GG G G GGG G G G GG GG Sbjct: 395 GNPGYGGSQFR--GGSSGNGAEEGDNGYSGGG-GAGLNSNGRNNKNFGGSRGTGGEGGKS 451 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG GG G G G G G G GGGGG G G G G Sbjct: 452 FLAGGAGGRSNQNDVEGGFGGGGGPNGAGGG-GGGGGGYSGGASGSRSNSCGGGGGSYNA 510 Query: 617 G 615 G Sbjct: 511 G 511 Score = 46.4 bits (105), Expect = 4e-05 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 1/89 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXX 804 GG G GG G GG G GG G GGG G G GGG GG G Sbjct: 439 GGSRGTGG--EGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGS 496 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGGG G G G Sbjct: 497 RSNSCGGGGGSYNAGSDKSQQAGANNGAG 525 Score = 46.4 bits (105), Expect = 4e-05 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 2/86 (2%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX 765 GG G G G GG G GG GGG GG GGG GG GG Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGG-GGPNGAGGGGGGGGGYSGGASGSR 497 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGGG G G G Sbjct: 498 SNSCGGGGGSYNAGSDKSQQAGANNG 523 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXX-GGXGGGG--XGXXGGXGGGXGXXGGGXXXXG 815 GG G G GG GG G GG GGGG G GG GGG G GG Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRS 498 Query: 814 XXGXGGXGXGXGG 776 GG G G Sbjct: 499 NSCGGGGGSYNAG 511 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGX 669 GGG G G G G G GG GG G G G GGGG Sbjct: 372 GGGGGVDKLKGDSPRCHGSINEDGNPGYGGSQFRGGSSGNGAEEGDNGYSGGGGAGLNSN 431 Query: 668 GGGXGXXGXGXXGGXXGG 615 G G G GG Sbjct: 432 GRNNKNFGGSRGTGGEGG 449 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/101 (25%), Positives = 26/101 (25%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G G G GG GG G G GG G Sbjct: 373 GGGGVDKLKGDSPRCHGSINEDGNPGYGGSQFRGGSSGNGAEEGDNGYSGGGGAGLNSNG 432 Query: 737 XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG GG G G GG GG Sbjct: 433 RNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGG 473 Score = 38.3 bits (85), Expect = 0.009 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 16/86 (18%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGX-----------GXXXXGGXGG-----GGXGXXGGXGG 854 GG G G G G GG G G G GG GG GG G Sbjct: 406 GGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQND 465 Query: 853 GXGXXGGGXXXXGXXGXGGXGXGXGG 776 G GGG G G GG G G G Sbjct: 466 VEGGFGGGGGPNGAGGGGGGGGGYSG 491 Score = 37.1 bits (82), Expect = 0.022 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGG 690 G GGG G G G GG GG G G G G G G Sbjct: 372 GGGGGVDKLKGDSPRCHGSINEDGNPGYGGSQFRGGSSGNGAEEGDNGYSGGGGAGLNSN 431 Query: 689 GXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G G G GG Sbjct: 432 GRNNKNFGGSRGTGGEGGKSFLAGG 456 Score = 34.3 bits (75), Expect = 0.15 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXGG----GXXGXXGGXGXGXGXXXXGGXGGGGX--GXXGGXGGGXGXXGGGXX 824 GGG G G G G G G GG GG GG GGG G G G Sbjct: 423 GGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGG- 481 Query: 823 XXGXXGXGGXGXGXGG 776 G GG G GG Sbjct: 482 -----GGGGGGGYSGG 492 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 59.7 bits (138), Expect = 4e-09 Identities = 33/96 (34%), Positives = 33/96 (34%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP PP P P PP PPP PPP PP P PP P Sbjct: 225 PMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGF---PPMGMPGMGGMPPPGMPP 281 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PP PP P PPP PP P Sbjct: 282 PMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNP 317 Score = 58.0 bits (134), Expect = 1e-08 Identities = 30/86 (34%), Positives = 30/86 (34%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP PP P PP PPPP PP PPP PP P Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGM 274 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXP 918 PPP PP PP PP P P Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 54.4 bits (125), Expect = 1e-07 Identities = 30/86 (34%), Positives = 30/86 (34%), Gaps = 5/86 (5%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP----- 861 PP PP P PP PPPP P PPP PP PP P Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGM 274 Query: 862 XPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P P P P PP PP Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 48.8 bits (111), Expect = 7e-06 Identities = 43/137 (31%), Positives = 43/137 (31%), Gaps = 15/137 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP---PPXPXPXPX-PPXPXP-----PPPXXPPPX 768 PP PP P P P PPP PP P P PP P PPP PPP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP-- 942 PP PP PPP PP PP P P PP Sbjct: 284 ---PPGGMPPNMEQPPP---PPPSSGVSNSGMMPPHMQNPQHMGHQMMPGMMPQQFPPNL 337 Query: 943 ----XPXXPPPXPXXPP 981 PP P PP Sbjct: 338 MWGMTGQTRPPPPQMPP 354 Score = 48.4 bits (110), Expect = 9e-06 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 8/77 (10%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP-----XXXXPXPXPXPPX 941 PP P P PPP PP PP PPP PP P P PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 942 XPXXPPP---XPXPPPP 983 P PP P PPPP Sbjct: 284 PPGGMPPNMEQPPPPPP 300 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PP P P PP P P PP P PPP PPP Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPP--PGMPPPGMMPPP 261 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P P PP P P PPP PP Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPP 261 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 59.7 bits (138), Expect = 4e-09 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 4/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P PP P P P P PPP PPP P Sbjct: 316 PETEQPQMVAPSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVP 375 Query: 796 PXXXXPPPXXXXP----PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PPP P P PPP PPP P P PP P P P Sbjct: 376 TPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTP 435 Query: 964 XPXXPP 981 PP Sbjct: 436 VAAPPP 441 Score = 58.4 bits (135), Expect = 8e-09 Identities = 40/135 (29%), Positives = 40/135 (29%), Gaps = 13/135 (9%) Frame = +1 Query: 616 PPXXP-PXXPXPXXPXPPPX--------PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX 768 PP P P P PPP P PPP P P PP PPP Sbjct: 347 PPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPS 406 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP--- 939 P P PPP P P P PPP P PP PP Sbjct: 407 VFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVF 466 Query: 940 -PXPXXPPPXPXXPP 981 P P P PP Sbjct: 467 APSSGVPTPVAAPPP 481 Score = 57.2 bits (132), Expect = 2e-08 Identities = 33/101 (32%), Positives = 33/101 (32%), Gaps = 5/101 (4%) Frame = +1 Query: 694 PPPXPXPXPXPPXP-XPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP----PXPPPXPP 858 PPP P P P P P PPP P P PPP P P PP Sbjct: 399 PPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPP 458 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PPP P P PP P P P PP Sbjct: 459 PAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPP 499 Score = 54.8 bits (126), Expect = 1e-07 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 5/123 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P P P P PPP P P PP PPP P P Sbjct: 417 PVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPV 476 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 PPP P P P PPP P P P PP P P P Sbjct: 477 AAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTE 536 Query: 973 XPP 981 PP Sbjct: 537 PPP 539 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/112 (30%), Positives = 34/112 (30%), Gaps = 6/112 (5%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX-PPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P PP P P P P PP P P P PPP P Sbjct: 393 PTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPT 452 Query: 817 PXXXXPPXPPPX----PPPXPPPXPXPPPXXXXXPXX-PXPPXXPPPXPXXP 957 P PP PPP P P PPP P P PPP P Sbjct: 453 PVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAP 504 Score = 52.8 bits (121), Expect = 4e-07 Identities = 31/96 (32%), Positives = 31/96 (32%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPP P P P P PPP P P PPP P P Sbjct: 451 PTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 510 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP P P PPP P PP Sbjct: 511 TVTAPPAAP-PPSVFAPSSGVPTPVTEPPPAP--PP 543 Score = 52.4 bits (120), Expect = 5e-07 Identities = 37/120 (30%), Positives = 37/120 (30%), Gaps = 8/120 (6%) Frame = +1 Query: 628 PPXXPXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P P P P PPP P P PP PPP P P Sbjct: 475 PVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPV 534 Query: 805 XXPPPXXXXPPXPP----PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP---XXPPP 963 PPP P P P PPP P PP P P PPP PPP Sbjct: 535 TEPPPAPPPSVFAPSSGVPTPVTAPPPAP-PPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 51.6 bits (118), Expect = 9e-07 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 15/129 (11%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX-PPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P PP P P P P PP P P P PPP P P Sbjct: 433 PTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 492 Query: 817 PXXXXP----------PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP----PXPXX 954 P P P PP PPP P P PP PP P Sbjct: 493 PVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGV 552 Query: 955 PPPXPXXPP 981 P P PP Sbjct: 553 PTPVTAPPP 561 Score = 51.6 bits (118), Expect = 9e-07 Identities = 41/133 (30%), Positives = 41/133 (30%), Gaps = 11/133 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPX--PPPPXXPPPXPXPPPP 786 P PP P P P P PPP P P P PPP P P Sbjct: 453 PVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTV 512 Query: 787 XXPPXXXXPPPXXXXPPX--PPPXPPPXPPPXP--XPPPXXXXXPXXPXPPXXPP----P 942 PP PPP P P P P P P P P P PP PP P Sbjct: 513 TAPPAA--PPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAP 570 Query: 943 XPXXPPPXPXXPP 981 P P PP Sbjct: 571 SSAVPTPATAPPP 583 Score = 48.8 bits (111), Expect = 7e-06 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PPP P P P PP PPP P P Sbjct: 516 PAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVP 575 Query: 796 PXXXXPPPXXXXPPXPPP 849 PPP PPP Sbjct: 576 TPATAPPPVAATLSAPPP 593 Score = 47.2 bits (107), Expect = 2e-05 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 7/129 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPX--PPPPXXPP----PXPX 774 P PP P P P P PPP P P P PPP P P Sbjct: 395 PVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPV 454 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 PP PP P P P P P P P P P P Sbjct: 455 TAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTA 514 Query: 955 PPPXPXXPP 981 PP P PP Sbjct: 515 PPAAP--PP 521 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP P P P PP P PP PPP P PP P PP Sbjct: 309 PPMGAQLPETEQPQMVAPSSTVTPPVTEPAPPSS---VVAPPPAVPTPATAPP-PVVAPP 364 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P P PP Sbjct: 365 PSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPP 401 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 2/94 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP- 861 P P P P P PP P P P PP PP PPP Sbjct: 290 PHPATLPVTLFTPQAAPVTPPMGAQLPETEQPQMVAPSSTVTPPVTEPAPPSSVVAPPPA 349 Query: 862 XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PPP P P PPP Sbjct: 350 VPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPP 383 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP---X 950 P P PP P P P P PP P PP P P P PP Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAP-PPSVFAPSSAVPTPATAPPPVAATLS 589 Query: 951 XPPP 962 PPP Sbjct: 590 APPP 593 Score = 32.7 bits (71), Expect = 0.47 Identities = 34/138 (24%), Positives = 34/138 (24%), Gaps = 18/138 (13%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPP---------PPPXXXPPXXPXXXXXXXXXXXXXXXX 776 PP PP P PP P P PP Sbjct: 458 PPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPA 517 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPX--------PPXXPXPPPPXPPXXXXP-XPXP 929 P P P P PP P PPP P PPP PP P P Sbjct: 518 APPPSVFAPSSGVPTPVTEPP--PAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVP 575 Query: 930 XPPXXPXXPPPXPXPPPP 983 P P PPP Sbjct: 576 TPATAPPPVAATLSAPPP 593 Score = 30.7 bits (66), Expect = 1.9 Identities = 28/104 (26%), Positives = 28/104 (26%), Gaps = 1/104 (0%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP-PXXXXPPPXXXX 831 P P P P P P P P P PP P P Sbjct: 269 PNEPTVSHTISNPAMAAPWVTPHPAT-LPVTLFTPQAAPVTPPMGAQLPETEQPQMVAPS 327 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P PP PP P P P PPP PP Sbjct: 328 STVTPPVTEPAPPSSVVAPP-----PAVPTPATAPPP--VVAPP 364 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/79 (25%), Positives = 20/79 (25%), Gaps = 1/79 (1%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P P P PP P P P P PP Sbjct: 281 PAMAAPWVTPHPATLPVTLFTPQAAPVTPPMGAQLPETEQPQMVAPSSTVTPPVTEPAPP 340 Query: 928 -XXPPPXPXXPPPXPXXPP 981 P P P P PP Sbjct: 341 SSVVAPPPAVPTPATAPPP 359 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 59.3 bits (137), Expect = 5e-09 Identities = 36/123 (29%), Positives = 36/123 (29%), Gaps = 5/123 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 PP P P PP PPP PP PP PP P P P Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPG 933 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P PP P PPP P P P PP P Sbjct: 934 NQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQ 993 Query: 961 PXP 969 P P Sbjct: 994 PPP 996 Score = 38.3 bits (85), Expect = 0.009 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 4/119 (3%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX-PXX 815 P P P P PPP PP P P P P Sbjct: 882 PPPGNQVNP-PMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPM 940 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPP---PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP PP P PPP PP P P PP PP P PP Sbjct: 941 SSQPQPPPGNQVNPPM-SSQPQPPPGNQVNPPMSSQPQP---PPGNQVNPPMSSQPQPP 995 Score = 36.7 bits (81), Expect = 0.029 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP--PXPXPPPXXXXXPXXPXPPXX 933 PP P P PP PP P PPP PP P PPP P P Sbjct: 874 PPMSSQPQP--PPGNQVNPP-MSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQP 930 Query: 934 PPPXPXXPP--PXPXXPP 981 P PP P PP Sbjct: 931 LPGNQVNPPMSSQPQPPP 948 Score = 29.9 bits (64), Expect = 3.3 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 10/75 (13%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP---PPXPPXXXXPXP----XPXPPXX 944 P P P P PP P P P PP P PP P P PP Sbjct: 923 PMSSQPQPL-PGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPG 981 Query: 945 PXXPPP---XPXPPP 980 PP P PPP Sbjct: 982 NQVNPPMSSQPQPPP 996 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 59.3 bits (137), Expect = 5e-09 Identities = 32/66 (48%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GG GGG G GG GG GG G GG G G G GG GG G GGG G Sbjct: 87 GAGGSRAGGYRSGGG-GYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYG 145 Query: 644 XGXXGG 627 G GG Sbjct: 146 GGSKGG 151 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/69 (44%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = -3 Query: 887 GGXGXGGGXGGGX---GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G G GG GG GGG GG G G GG GGG G G G GGG G G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRD 143 Query: 716 XGXGXGGGG 690 G G GGG Sbjct: 144 YGGGSKGGG 152 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/67 (46%), Positives = 31/67 (46%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G GG G GGG G GG G G GGG GGG G GG G G G G GGG Sbjct: 87 GAGGSRAGGYRSGGGGYG-GSSRGGYGGGRGGGGYGGG-RGGGGYGGGRGGGYGGGRRDY 144 Query: 674 GXGGGXG 654 G G G Sbjct: 145 GGGSKGG 151 Score = 55.6 bits (128), Expect = 6e-08 Identities = 32/71 (45%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -3 Query: 977 GXXGXGGGXXGX---GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G GG G GGG GG G GGG GG GGG GGG GG GGG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG--GYGGGR 141 Query: 806 XXXGGXXGGGG 774 GG GGG Sbjct: 142 RDYGGGSKGGG 152 Score = 54.4 bits (125), Expect = 1e-07 Identities = 31/71 (43%), Positives = 31/71 (43%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G G G GGG G GG GG GGG GG GG GG GG G G GGG Sbjct: 84 GERGAGGSRAGGYRSGGG-GYGGSSRGGYGGGRGGGGY--GGGRGGGGYGGGRGGGYGGG 140 Query: 755 XXGGGGXGXGG 723 GG GG Sbjct: 141 RRDYGGGSKGG 151 Score = 53.6 bits (123), Expect = 2e-07 Identities = 32/76 (42%), Positives = 32/76 (42%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G GG G G G G G G GG GG GGG GG GG GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGG---GGYGGGRGGGGYGGG----RGGG 136 Query: 788 XGGGGXGXGGGXXGGG 741 GGG GGG GGG Sbjct: 137 YGGGRRDYGGGSKGGG 152 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/63 (47%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGX 714 GG GGG GG GG GG GG GG GGGG G G GG GGG GG Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGG----YGGGRGGGGYGGGRGGGYGGGRRDYGGGSK 149 Query: 713 GXG 705 G G Sbjct: 150 GGG 152 Score = 52.4 bits (120), Expect = 5e-07 Identities = 31/64 (48%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG GGG G GG GG G G GGG G GGG GGG GGG GG GG Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGY----GGGRG-GGGYGGGRGGGYGGGRRDYGGGS 148 Query: 803 XXGG 792 GG Sbjct: 149 KGGG 152 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 G G GG GG G GG GGGG G G GGG G GG G G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRG-GGGYGGGRGGGYGGGRRDYG 145 Query: 799 GXGXGXG 779 G G G Sbjct: 146 GGSKGGG 152 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG GG G GG G G GGG G GGG G G G GG GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRG--GGGYGGGRGGG 136 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G G G G G GG GGG G G GG G GGG G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGS 148 Query: 805 XGG 797 GG Sbjct: 149 KGG 151 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GGG G GG G G G GG GGG G G G G GGG Sbjct: 104 GGSSRGGYGGGRGG--GGYGGGRGGGGYGGGRGGGYG-GGRRDYGGGSKGGG 152 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 59.3 bits (137), Expect = 5e-09 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = +1 Query: 697 PPXPXPXPXPPX-PXPPPPXXPPPX-PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P PP P PP PPP P PP PP P PP PP PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P PP P PP P P P Sbjct: 207 PPPIPP---IDPPRTQPPPIFPQPTTPAP 232 Score = 59.3 bits (137), Expect = 5e-09 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +1 Query: 748 PXXPPPXPXPP-PPXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPX 921 P P P PP P PP PP PP P P PP PP PPP P Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 922 PPXXPPPXPXXPPPXPXXP 978 PP PP P P P P Sbjct: 207 PPPIPPIDPPRTQPPPIFP 225 Score = 58.4 bits (135), Expect = 8e-09 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 3/83 (3%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P PP P PP PP P PP PP PP P P PP P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Query: 919 XPPXXPP---PXPXXPPPXPXXP 978 PP PP P P P P P Sbjct: 210 IPPIDPPRTQPPPIFPQPTTPAP 232 Score = 57.2 bits (132), Expect = 2e-08 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 5/84 (5%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPP--PXXPPXXXXPPPXXXXPPXPPPXP 855 P P P P P PPP P PP PPP P PP PP PP P P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Query: 856 -PPXPPPXPXPPPXXXXXPXXPXP 924 PP PP PPP P P P Sbjct: 210 IPPIDPPRTQPPP-IFPQPTTPAP 232 Score = 56.8 bits (131), Expect = 3e-08 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 3/85 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPP-PXPXPXPXPPXPXPPPPXXPPPXPX--PPPPXXPPXXXXPP 816 P P P P P P P P P PP PPP P PP PP P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PP PP PP P P Sbjct: 203 PRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 54.8 bits (126), Expect = 1e-07 Identities = 32/82 (39%), Positives = 32/82 (39%), Gaps = 4/82 (4%) Frame = +1 Query: 616 PPXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPP-- 783 P PP P P PPP P P P P PP PPP P PP PPP Sbjct: 152 PMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Query: 784 PXXPPXXXXPPPXXXXPPXPPP 849 P PP PPP P P P Sbjct: 212 PIDPP-RTQPPPIFPQPTTPAP 232 Score = 54.0 bits (124), Expect = 2e-07 Identities = 36/96 (37%), Positives = 36/96 (37%), Gaps = 5/96 (5%) Frame = +1 Query: 619 PXXPPXXPXPXX--PXPPPXPXXXXPPPP-PXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 P P P P P P P PPP P P PP P PP PP PP P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPP---PIPPIDPPRTQPPPIPP 199 Query: 790 XPPXXXXPPPXXXXPPXPPP--XPPPXPPPXPXPPP 891 P PPP PP PP PPP P P P Sbjct: 200 IDPPRTQPPP---IPPIDPPRTQPPPIFPQPTTPAP 232 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P PPP P PP P PP PP P P P P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPID-PPRTQPPPIPPIDPPRTQPP 221 Query: 957 PPXPXPPPP 983 P P P P Sbjct: 222 PIFPQPTTP 230 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P PP PP PP P PP PP P PP P PP PP Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPP-PIPPIDPPRTQPPPIPPIDPPRTQ-- 206 Query: 955 PPPXPXXPP 981 PPP P P Sbjct: 207 PPPIPPIDP 215 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 4/90 (4%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP--PXPPPXPXPPPXX 897 PP P P P P P P PP P PP PPP Sbjct: 113 PPCYIPCPTATATTSTTATTPAKTTSATTKPVMTPTTPAPMTLPPISPIDPPRTQPPPIF 172 Query: 898 XXXPXXPXPPXXPP--PXPXXPPPXPXXPP 981 P PP PP P PPP P P Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 5/63 (7%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPPX---PPXXPXPPP--PXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P PP P PP PP P PP PP P PP P PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 972 PPP 980 PPP Sbjct: 207 PPP 209 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 4/96 (4%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP--XP 879 P P P P P P PP P PP PP P Sbjct: 114 PCYIPCPTATATTSTTATTPAKTTSATTKPVMTPTTPAPMTLPPISPIDPPRTQPPPIFP 173 Query: 880 XPPPXXXXXPXXPXPP--XXPPPXPXXPPPXPXXPP 981 PP P P P PPP P PP PP Sbjct: 174 IDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 35.9 bits (79), Expect = 0.050 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPP-PPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP P P P PP PP PP P PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP-------------PIDPPRTQ 206 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPP 869 P P P P PPP P P P Sbjct: 207 PPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PP P PP P PP P PP PP P Sbjct: 147 PTTPAPMTLPPISPIDPPRTQP----------PPIFPIDPPRTQPPPIP 185 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 59.3 bits (137), Expect = 5e-09 Identities = 35/104 (33%), Positives = 35/104 (33%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P PP P P PPP P P PP PP PPPP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPP---PPPLPPAMPAMDDLLPPEVLSPPPP--- 338 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PPP P P P PP P P P PP Sbjct: 339 -----PPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 Score = 58.0 bits (134), Expect = 1e-08 Identities = 45/136 (33%), Positives = 45/136 (33%), Gaps = 25/136 (18%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP------------PPPXPXPXPXPPXPXPPPPXXP 759 PP PP P P P PP PP P P P P PPP P Sbjct: 245 PP--PPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPP 302 Query: 760 PPX---PXPPP-PXXPP-----XXXXPPPXXXXPPXPPPXPP----PXPPPXPXPPPXXX 900 P P PPP P PP PP PP PPP P P P PP Sbjct: 303 LPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLY 362 Query: 901 XXPXXPXPPXXPPPXP 948 P P PPP P Sbjct: 363 DAPATLPSPIMPPPPP 378 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP-PXXPXX 953 PP P P P P P PPP PP P PP P P P P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSM 348 Query: 954 PPPXPXPPPP 983 P P P PP Sbjct: 349 PSSLPMPSPP 358 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/102 (30%), Positives = 31/102 (30%), Gaps = 5/102 (4%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXX-----PPXPXPXPPXPXXPXXXXPPPXXPXPP 857 PPPP PP P P PP P PP P P Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPPP PP P P PPP PPPP Sbjct: 305 NFTSPSPPPPPPLPP--AMPAMDDLLPPEVLSPPP---PPPP 341 Score = 41.9 bits (94), Expect = 8e-04 Identities = 30/98 (30%), Positives = 30/98 (30%), Gaps = 6/98 (6%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX-PXXPXXXXPPPXXPXPPPXP- 866 P PP PP PP P P PP P P P PPP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPS 342 Query: 867 -PXXPXP---PPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P PP P P P PPP P Sbjct: 343 EDFYSMPSSLPMPSPPEDLYDAPATLP--SPIMPPPPP 378 Score = 35.1 bits (77), Expect = 0.088 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P PPPPP PP P PP Sbjct: 286 PMTPPPAVVTAPPPAPPLPNFTSPSPPPPP-PLPPAMPAMDDLLPPEVLSPPPPPPPSED 344 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P PP P P PPPP Sbjct: 345 FYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 Score = 33.9 bits (74), Expect = 0.20 Identities = 24/96 (25%), Positives = 24/96 (25%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P P PP PP P PP P P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPP-PPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P P P P PP Sbjct: 342 SEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 58.8 bits (136), Expect = 6e-09 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PPP P P PP P P P P PPPP PP PPP PP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P PPP P P P PPPP PP P PPPP PPP P PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPP--------PPPGDGGAPPPPPPP 337 Score = 56.4 bits (130), Expect = 3e-08 Identities = 31/82 (37%), Positives = 31/82 (37%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P P P P P PPPP P PPPP PP PPP Sbjct: 261 PSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPP--PPPGGAPPP-- 316 Query: 826 XXPPXPPPXPPPXPPPXPXPPP 891 PP PPP P P P PPP Sbjct: 317 -PPPPPPPPPGDGGAPPPPPPP 337 Score = 55.2 bits (127), Expect = 8e-08 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP P PPPP PP P P P PP P P PPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PPPP PPP P PP PP PPP P PPP P P PP Sbjct: 290 PVPPPPPADGSAPAPPP-----PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 52.4 bits (120), Expect = 5e-07 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PPP P P P PPP P P PP PPP PP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPP--XPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP P PPP PPP PPP P PPP P PP PPP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP--PPP 337 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PP PPP P PPPPP P P P PPPP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP--PPP 337 Score = 48.4 bits (110), Expect = 9e-06 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P PP P PPP P PP P P PPPP PP P P PP Sbjct: 290 PVPPPP-PADGSAPAPPP--PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/86 (31%), Positives = 27/86 (31%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P P P P P PPP P P PPP P P P Sbjct: 257 PSIAPSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPP 316 Query: 886 PPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P P PP P PPP Sbjct: 317 PP-----PPPPPPPGDGGAPPPPPPP 337 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPPP P P P P PP PPP P PPPP Sbjct: 290 PVPPPP-PADGSAPAPPPPPPPG-GAPPPPPPPPPP 323 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P PPP P P PP P PPP Sbjct: 261 PSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Query: 964 XPXXP 978 P P Sbjct: 321 PPPPP 325 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P PP P P P P PPPPP Sbjct: 306 PPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P P PP P P P PPPPP Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPP 719 P PP P P PPPPP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXP 716 P PP P P P PPPPP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 58.8 bits (136), Expect = 6e-09 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP-PXXXXPPPXXXX 831 P PP P PP P P PP P P PPP PP P P P P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAA-GPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGY 173 Query: 832 PPXPPPX--PPPXPPPXPXPP 888 PP PPP P P PP PP Sbjct: 174 PPQPPPQAYPQPGYPPQGYPP 194 Score = 55.2 bits (127), Expect = 8e-08 Identities = 30/85 (35%), Positives = 30/85 (35%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPP P P P PP P PPP P PP P P PP P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P P P PP P P Sbjct: 178 PPQAYPQP---GYPPQGYPPTGPYP 199 Score = 53.2 bits (122), Expect = 3e-07 Identities = 36/102 (35%), Positives = 36/102 (35%), Gaps = 9/102 (8%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXP----PPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PP P P P PP PP P P PP P PPP P PP P Sbjct: 104 PPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPY 163 Query: 859 PXPP-PX----PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P PPP P P P PP P P P Sbjct: 164 PAQPYPQQGYPPQPPPQAYPQPGYP-PQGYPPTGPY-PQTQP 203 Score = 51.6 bits (118), Expect = 9e-07 Identities = 31/101 (30%), Positives = 31/101 (30%), Gaps = 2/101 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPP--PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 P P P P PP P P PP P PP PP P P P P P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYP 174 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 PP P PP PP P P P P Sbjct: 175 PQPPPQAYPQPGYPPQGYPPTGPYPQTQPGYAGATPQAHYP 215 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 6/86 (6%) Frame = +1 Query: 742 PPPXXPPPXPXP--PPPXXPPXXXXPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 PP P P PPP P P P PP P P PPP PP P Sbjct: 104 PPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPY 163 Query: 913 XPXP---PXXPPPXPXXPPPXPXXPP 981 P PP P P P PP Sbjct: 164 PAQPYPQQGYPPQPPPQAYPQPGYPP 189 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +3 Query: 831 PPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP P PP P P PP P P P P PP P P P P P Sbjct: 119 PPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPP-TSYPPQPYPAQPYP 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 3/72 (4%) Frame = +3 Query: 777 PPXPXPX---PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P P P PP P PPP P PP P P P P P P P P Sbjct: 127 PQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQ-PYPAQPYPQQGYPPQPPPQAYPQP 185 Query: 948 XXPPPXPXPPPP 983 PP P P Sbjct: 186 GYPPQGYPPTGP 197 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPX-PPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P P P PPP PP P P P P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGP-PMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGY 173 Query: 957 PPXPXP 974 PP P P Sbjct: 174 PPQPPP 179 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P PP PPP P P P P PP P P P Sbjct: 149 PPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYP-PQGYPPTGPYPQTQPGYAG 207 Query: 790 XPPXXXXP 813 P P Sbjct: 208 ATPQAHYP 215 Score = 33.9 bits (74), Expect = 0.20 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 11/87 (12%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX-PPPX--PXXXXPPPPPXPXPXPX---PPXPXP---PPPXXPPP- 765 P P P P PPP P PP P P P PP P P P P PP Sbjct: 132 PGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQG 191 Query: 766 -XPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P Sbjct: 192 YPPTGPYPQTQPGYAGATPQAHYPQQP 218 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 58.4 bits (135), Expect = 8e-09 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 2/110 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPP--PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P P P PP PP P PPP P PPP P Sbjct: 32 PPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVP 91 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P P P P PPP P PP P P PP Sbjct: 92 PPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPP 141 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 2/94 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXX 792 PP PP PP P P P P P PPP P PPP Sbjct: 49 PPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVT 108 Query: 793 PPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPP 891 PPP P P P P PP PPP Sbjct: 109 DAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 52.4 bits (120), Expect = 5e-07 Identities = 35/116 (30%), Positives = 35/116 (30%), Gaps = 10/116 (8%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPP--------PXPXPPPPXXPPXXXXPP 816 PP PP P P P P PP PP P PPP PP Sbjct: 21 PPVLTEAATTQPPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPP 80 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP-XPXXPP 981 P P P P P PPP P PP PPP P PP Sbjct: 81 PVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPP 136 Score = 50.8 bits (116), Expect = 2e-06 Identities = 32/113 (28%), Positives = 32/113 (28%), Gaps = 1/113 (0%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P P P PP P PP PPP P PP P Sbjct: 32 PPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPP--PPPVVTEAPTTVPPPVVTDAPTT 89 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PPP P P P PPP PP PP Sbjct: 90 VPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/103 (27%), Positives = 28/103 (27%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PP PP P P PPP P PPP Sbjct: 39 PTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVPPPVVTDA 98 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PPP P P P P PPP P PP Sbjct: 99 PTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPP 141 Score = 48.4 bits (110), Expect = 9e-06 Identities = 30/111 (27%), Positives = 30/111 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P PP P PPP P P Sbjct: 35 PPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPP---PPVVTEAPTTVPPPVVTDAPTTVP 91 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PP P PPP P P P P P P Sbjct: 92 PPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 58.4 bits (135), Expect = 8e-09 Identities = 40/107 (37%), Positives = 40/107 (37%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG GG G GGG G GG GGG GG G Sbjct: 197 GGRGGYGG--RGRGGGGRGGYG-------GGGGYGGYGGYDQYSGGGYGGYGDSYGSYGG 247 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG G G G G G G G GGG G GGG Sbjct: 248 GGGYGSSYGSYDGYGSMGMYNQSSSGYGKSYGGMSGGGSGGRGRGGG 294 Score = 56.8 bits (131), Expect = 3e-08 Identities = 40/104 (38%), Positives = 40/104 (38%), Gaps = 1/104 (0%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGG-GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G GG G G GG G GG G GGG GG G GGG G G G G G Sbjct: 197 GGRGGYGGRGR-----GGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGY 251 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G GG G G G GG Sbjct: 252 GSSYGSYDGYGSMGMYNQSSSGYGKSYGGMSGG-GSGGRGRGGG 294 Score = 51.6 bits (118), Expect = 9e-07 Identities = 34/93 (36%), Positives = 34/93 (36%), Gaps = 2/93 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXG--GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG G G GGG G GG GG GG GG GG G G GGG G Sbjct: 200 GGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYD 259 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G GG G Sbjct: 260 GYGSMGMYNQSSSGYGKSYGGMSGGGSGGRGRG 292 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/96 (38%), Positives = 37/96 (38%), Gaps = 4/96 (4%) Frame = -3 Query: 890 GGGXGXGG-GXGGGXGGGXGGXXXXGGGXXXXGG---XXGGGGXGXGGGXXGGGGXGXGG 723 GG G GG G GGG GG GG GGG GG GGG G G GG G G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGG----GGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYG 252 Query: 722 XGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GG GG Sbjct: 253 SSYGSYDGYGSMGMYNQSSSGYGKSYGGMSGGGSGG 288 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG-GXXXXGXX 809 GG GG G GGG G GG G G GGG G G G G GG G Sbjct: 200 GGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYD 259 Query: 808 GXGGXG 791 G G G Sbjct: 260 GYGSMG 265 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 8/78 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG--------XXGGG 830 GGGGG G GG GG G G GGGG G G G G G G Sbjct: 216 GGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYGSMGMYNQSSSGYG 275 Query: 829 XXXXGXXGXGGXGXGXGG 776 G G G G G GG Sbjct: 276 KSYGGMSGGGSGGRGRGG 293 Score = 36.7 bits (81), Expect = 0.029 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGG-GXXXXGX 812 GGG G GGG G GG G G G G G GG G G G G Sbjct: 209 GGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYGSMGMYN 268 Query: 811 XGXGGXGXGXGG 776 G G GG Sbjct: 269 QSSSGYGKSYGG 280 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 58.4 bits (135), Expect = 8e-09 Identities = 32/64 (50%), Positives = 32/64 (50%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GG GGG G GG GG G G GG G G G GGGG G GGG G G Sbjct: 183 GGGGSQGGGYRSGGG-GYGGSSRGGYGGGRGGGGYGGGRGGGG-----GYGGGRRDYGGG 236 Query: 638 XXGG 627 GG Sbjct: 237 SKGG 240 Score = 56.4 bits (130), Expect = 3e-08 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GGG G GG GG G G GG G GGG GGGG G G G G Sbjct: 183 GGGGSQGGGYRSGGGGY----GGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSK 238 Query: 698 GGG 690 GGG Sbjct: 239 GGG 241 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGG GG GG G GG GGGG G GG G G G GGG G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYG-GGRGGGGGYGGGRRDYGGGSKGG 240 Score = 52.8 bits (121), Expect = 4e-07 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG GGG G G G G G G GGG G GGG GG GGG GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG---GYGGGRGGGGGYGGGRRDYGGGSKG 239 Query: 779 GG 774 GG Sbjct: 240 GG 241 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG GG GGGG G G G G GGGG G GGG G GG GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GG GGG GG GG GG GG GG GGGG G G G Sbjct: 183 GGGGSQG-----GGYRSGGGGYGGSSRGGYGGGR---GGGGYGGGRGGGGGYGGGRRDYG 234 Query: 746 GGGXGXG 726 GG G G Sbjct: 235 GGSKGGG 241 Score = 48.8 bits (111), Expect = 7e-06 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -1 Query: 985 GGGGGXGXG--GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGG G G G G G G G GG GGG G GG GGG GGG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 48.4 bits (110), Expect = 9e-06 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG GGG GG G GGG G GGG GG GGG GG GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG-GYGGGRGG--GGGYGGGRRDYGGGSKG 239 Query: 797 GG 792 GG Sbjct: 240 GG 241 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -1 Query: 967 GXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 G GG G G G G GG GGG G G GG GG G GGG G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/67 (43%), Positives = 29/67 (43%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G GG GG GG GGG GG GGG GGG G Sbjct: 184 GGGSQGGGYRSGGGGY--GGSSRGGYGGGRGGGGYGGGRGGGGG-------YGGGRRDYG 234 Query: 761 GGXXGGG 741 GG GGG Sbjct: 235 GGSKGGG 241 Score = 45.6 bits (103), Expect = 6e-05 Identities = 27/61 (44%), Positives = 27/61 (44%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G GG GG GGG G GG G G GGG G GG G GG G GGG Sbjct: 183 GGGGSQGGGYRSGGGGYG-GSSRGGYGGGRGGGGYG-GGRGGGGGYGGGRRDYGGGSKGG 240 Query: 674 G 672 G Sbjct: 241 G 241 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG GGG GGG G G G G G G GGG G G G G GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 58.0 bits (134), Expect = 1e-08 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG GGG GGGG G GG G G G GGGGG GG G G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG GG GGGG G GG GGGG G GG G G G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG GGG G GG G G G GG GGGG G GGG GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVG---GGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G GGG G GGG GGG GGG GG G GG G G G G Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GGG G GG GGG GG GGGG G GGG G G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG---XXGGGGXGXGGGXXGGGGXG 732 GGG GGG G G GGG GG GGG GG GGG G GG G G Sbjct: 74 GGGDTDGGG-GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GGG GG GGGG G GGG GGGG G G GG Sbjct: 74 GGGDTDGGGGCGGGGG-GGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG-XXXXGGXXGGGGXG 768 GGG G G G GGG G G G GGG GGG G GGG GG G G Sbjct: 74 GGGDTDGGGGCGG----GGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G GGG G GGG GGG GGG GG G G G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 GG GGG G GGG GG G G GGG G GGG G GG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGG---GGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GGGG G GGG G GG G G G GGG G GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GG G G G GGGGG G GGG G GG G Sbjct: 74 GGGDTDGGGGCGGG-GGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG GGG GG G G G G G GGG GGG GG G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGG-----GVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 G GGG G GGG G GG G G GG G G G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG--GGXGXXGGXG 857 GGGGG G GGG GG G G GG G GG G G Sbjct: 89 GGGGGVGGGGG-----GGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 57.6 bits (133), Expect = 1e-08 Identities = 36/101 (35%), Positives = 36/101 (35%), Gaps = 1/101 (0%) Frame = -3 Query: 926 GGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXX 750 G G G G GG G GGG GG G GG G GG G Sbjct: 153 GNSGYGGSVWPGGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLN 212 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GGGGG G GGG G G G Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 54.4 bits (125), Expect = 1e-07 Identities = 39/118 (33%), Positives = 39/118 (33%), Gaps = 5/118 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G GGG G G GG G GG Sbjct: 153 GNSGYGGSVWPGGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLN 212 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG--GGG---XXXXGXGGGXGXXGXG 639 GG G G GGGG G G G G GG GGG GGG G G Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 51.2 bits (117), Expect = 1e-06 Identities = 40/108 (37%), Positives = 40/108 (37%), Gaps = 5/108 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGG 813 GG G G GG GG G GG GG GG GG GG G Sbjct: 164 GGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNG 223 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXG 672 GG G G G GGG GGG G G G GGGGG G Sbjct: 224 VPGGFGGGGGVWGNGGGGGG-GGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 48.8 bits (111), Expect = 7e-06 Identities = 36/117 (30%), Positives = 36/117 (30%), Gaps = 6/117 (5%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG G G G GG GG GG GG Sbjct: 130 GGGGGYDDANTRHATCDASTSTSGNSGYGGSVWPGGTGGNGATSTSSSHVGGGGGGFYTD 189 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGG------XXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G GG G GG G G GGG G G G GG GG Sbjct: 190 GSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGG 246 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G GG G G GG G G GGG G GG GGG G GGG Sbjct: 201 GPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYAC 260 Query: 802 GGXG 791 GG G Sbjct: 261 GGGG 264 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 6/73 (8%) Frame = -1 Query: 985 GGGGGX----GXGGGXXGXXGGXGXGXGXXXXGGXGGGG--XGXXGGXGGGXGXXGGGXX 824 GGGGG G G G G G GG GG G GG GGG G G G Sbjct: 181 GGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGG 240 Query: 823 XXGXXGXGGXGXG 785 G G G G G Sbjct: 241 GGGGGGYSGGGSG 253 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G G G GG G G G GGG G G Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGG 239 Query: 805 XGGXGXGXGG 776 GG G G G Sbjct: 240 GGGGGGGYSG 249 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GGGG G GGG G G G G G GGGG G Sbjct: 230 GGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 36.7 bits (81), Expect = 0.029 Identities = 33/103 (32%), Positives = 33/103 (32%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGG---XGXXGGGXXXX 818 GG GG G GG G G G GG G GG GG G GG Sbjct: 164 GGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGP-GGEGGKAFLNGGVGGRSVWN 222 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G G G GGGGG Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 30.3 bits (65), Expect = 2.5 Identities = 30/109 (27%), Positives = 30/109 (27%), Gaps = 6/109 (5%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGX-GGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G GG GGG G GG GG G G Sbjct: 99 GQEGGINTVSSTSGGGGGSFVAKGNTPLIVAGGGGGYDDANTRHATCDASTSTSGNSGYG 158 Query: 758 GXXGGGGXGXGG---XGXGXGXGGGGGXXXXGXGGG--XGXXGXGXXGG 627 G GG G G GGGGG G G G G G GG Sbjct: 159 GSVWPGGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGG 207 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 57.6 bits (133), Expect = 1e-08 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G G G G GG GGG GG GGG GG GG G G GGG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGD-GGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Query: 746 GGGXG 732 G G G Sbjct: 480 GDGGG 484 Score = 55.6 bits (128), Expect = 6e-08 Identities = 31/68 (45%), Positives = 31/68 (45%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G G G G GG G GGGG G G G GG G G GG G G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGG-----GDGGGGGDGGGDGIDGGDGGGDGG-GDG 474 Query: 710 XGXGGGGG 687 G GGG G Sbjct: 475 GGDGGGDG 482 Score = 52.0 bits (119), Expect = 7e-07 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GGG G G G G GG G G GGG GGG G G G GG GG Sbjct: 421 GGGRDDGDGDSDGCSSGV---GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGD 477 Query: 680 XXGXGGG 660 G GGG Sbjct: 478 GGGDGGG 484 Score = 50.4 bits (115), Expect = 2e-06 Identities = 31/66 (46%), Positives = 31/66 (46%), Gaps = 4/66 (6%) Frame = -3 Query: 941 GGGXXGGXGXX-GXXXXXG---GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 GGG G G G G GG G G G GGG GGG G GGG GG GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGG--DGGGDGGGDG 478 Query: 773 XGXGGG 756 G GGG Sbjct: 479 GGDGGG 484 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/62 (45%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG-GGXXXXGXGGG 660 GG G G G G GGG GGGG G GG G G GGG GG G GGG Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDG-GGDGIDGGDGGGDGGGDGGGDGGG 480 Query: 659 XG 654 G Sbjct: 481 DG 482 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GGG G G G GG GGG GG G G Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGD 481 Query: 800 XGG 792 GG Sbjct: 482 GGG 484 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGX 782 GG G G G G GGG G GG GGG G GG G GG G G Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGD 481 Query: 781 GG 776 GG Sbjct: 482 GG 483 Score = 48.8 bits (111), Expect = 7e-06 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGG G G G G G G G GGGG G G GG G GG G G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Query: 802 GGXG 791 G G Sbjct: 481 DGGG 484 Score = 46.4 bits (105), Expect = 4e-05 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Frame = -3 Query: 797 GGXXGGGGXGXG-GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G GG G G GGG G GGG G G GG Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGD 481 Query: 620 GG 615 GG Sbjct: 482 GG 483 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G G G G G GGG G G G G G GG GG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 G GGG G GGG G G G G G GG GGG G GG Sbjct: 444 GDGGGDGGGGGDGGGDGIDG-GDGGGDGGGDGGGDGGGDGG 483 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 985 GGGGGXGXGGG-XXGXXGGXGXGXGXXXXGGXGGG 884 GGGGG G G G G GG G G G GG GGG Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 57.2 bits (132), Expect = 2e-08 Identities = 35/92 (38%), Positives = 35/92 (38%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GG G GGG G G GG G GGG GG G GG G G Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGY-GNYGGYSQGGYGGYADNSW 245 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G GG GG G G G GGG Sbjct: 246 SGGYG-SYDGGYGNGGDYSNGYSSYGGGYGGG 276 Score = 55.2 bits (127), Expect = 8e-08 Identities = 37/118 (31%), Positives = 37/118 (31%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG GG G G GG G GG G GG GG Sbjct: 193 GGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSY 252 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G GGG G G G GG G GG Sbjct: 253 DGGYGNGGDYSNGYSSYGGGYGGGYDSSMGQYSQEASGYGPSRGTGGRGRGAPRGSGG 310 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/90 (34%), Positives = 31/90 (34%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G GGG G G GG GGG G GG G G G GG Sbjct: 185 GAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNS 244 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G G GG GGG G Sbjct: 245 WSGGYGSYDGGYGNGGDYSNGYSSYGGGYG 274 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/94 (36%), Positives = 34/94 (36%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GG G G G G GG GGG G G G GG G GG G Sbjct: 185 GAGGRGGRGGRGGGR--GAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYAD 242 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG G GG G G G G GGG Sbjct: 243 NSWSGGYGSYDGGYGNGGDYSNGYSSYGGGYGGG 276 Score = 53.2 bits (122), Expect = 3e-07 Identities = 36/93 (38%), Positives = 36/93 (38%), Gaps = 2/93 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGG--GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG G GG GGG G G GG GGG GG GGG G G G G GG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGS---GG-YGGGSYGGYGNYGGYSQGGYGGYAD 242 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G GG GG Sbjct: 243 NSWSGGYGSYDGGYGNGGDYSNGYSSYGGGYGG 275 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG-GXGXXGGGXXXXGXX 809 G GG G GGG G G G GG GGG G G GG G GG Sbjct: 188 GRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSG 247 Query: 808 GXGGXGXGXG 779 G G G G Sbjct: 248 GYGSYDGGYG 257 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG--X 812 G GG G GGG G GG G G GG G GG G GG G Sbjct: 204 GRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGGDYS 263 Query: 811 XGXGGXGXGXGG 776 G G G GG Sbjct: 264 NGYSSYGGGYGG 275 Score = 41.9 bits (94), Expect = 8e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGG-XGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GG G G G G GG GG G G GG G G GG Sbjct: 185 GAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNS 244 Query: 805 -XGGXGXGXGG 776 GG G GG Sbjct: 245 WSGGYGSYDGG 255 Score = 32.3 bits (70), Expect = 0.62 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G G G GG G GG G G G G G G G Sbjct: 214 GSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGGDYSNGYSSYG-GG 272 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 GG G G G G G GG Sbjct: 273 YGGGYDSSMGQYSQEASGYGPSRGTGGRGRGAPRGSGG 310 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 56.8 bits (131), Expect = 3e-08 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GGGG G GGG GGGG G GG G G G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 54.8 bits (126), Expect = 1e-07 Identities = 24/42 (57%), Positives = 24/42 (57%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GGGG G GGG GGGG G GG G G G GG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GGG G GGG GGGG G GG G G G GGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG GGGG G GG G G G GGGGG G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/41 (60%), Positives = 25/41 (60%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GGG G GGG GGG GGG GG GGG GG GGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGDG 168 Score = 52.0 bits (119), Expect = 7e-07 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 GGG GGG GGG GG GGG GG GGGG G GGG GGGG G Sbjct: 132 GGGGGGGGGGGGGG----GGG----GG--GGGGGGGGGGGGGGGGDG 168 Score = 51.6 bits (118), Expect = 9e-07 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 GGGGG G GGG G GG G G G GG GGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 51.6 bits (118), Expect = 9e-07 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GGG GGG GG GGG GG GGGG G GGG GGGG G G Sbjct: 132 GGGGGGGGGG----GGG----GGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 51.6 bits (118), Expect = 9e-07 Identities = 22/36 (61%), Positives = 22/36 (61%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG GGGG G GGG GGGG G GG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GG GGGG G GGG GGGG G GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGGG G GG G G G GGGGG G GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 G GGG G GGG GG G GGG G GGG GGG GGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGG--------GGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/43 (60%), Positives = 26/43 (60%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G GGG GGG GGG GG GGG GG GGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGG----GGG---GGGGGGGGGGGDG 168 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG GG GGGG G GGG GGGG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 48.8 bits (111), Expect = 7e-06 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 GGG GG G G GGG G GGG GGG GGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 48.4 bits (110), Expect = 9e-06 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXG 791 GG GGGG G GG GGG G GGG G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -3 Query: 740 GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG G G G GGGGG G GGG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -3 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G G GGGGG G GGG G G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G GGG G GGG GGG GGG GG GGG Sbjct: 132 GGGGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 GGG G GGG GGG GGG GG GGG G G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG G G G GG GGGG G GG GGG G GGG G G Sbjct: 132 GGGGGGGG----GGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 719 GXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGGGG G GGG G G G GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 734 GXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G G GGGGG G GGG G G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 725 GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GGGGG G GGG G G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 822 GXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGGG 694 G G G G G GG GGG GGGG G G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXG 718 GG G G G G GG GGG GGGG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 718 GGXXXGGGGGXXXXXXGXGXXXXXGXGGXXGGXXGXXXXXXXXXHXDPHGVFNKH 554 GG GGGGG G G G GG GG G D H N H Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDGDEDDDHDDINSH 186 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 56.8 bits (131), Expect = 3e-08 Identities = 29/90 (32%), Positives = 29/90 (32%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP P P P P P PPPP P P PPP PP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P PP PP Sbjct: 741 SSKHPPTVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 54.4 bits (125), Expect = 1e-07 Identities = 30/90 (33%), Positives = 30/90 (33%), Gaps = 3/90 (3%) Frame = +1 Query: 628 PPXXPXPXXPXP--PPXPXXXXPPPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPP 798 PP P P P P P PPPPP P P P P P PPP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PP PP P P PP Sbjct: 741 SSKHPPTVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 1/87 (1%) Frame = +1 Query: 691 PPPPXPXP-XPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPP P P P P PPPP P P P PPP P P PP Sbjct: 685 PPPPLPTPIASSEPLPLPPPP-PPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSK 743 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P PP P Sbjct: 744 HPPTVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 3/84 (3%) Frame = +1 Query: 616 PPXXPPXX---PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P P PPP P P P PP PP P PP Sbjct: 687 PPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPP 746 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPP 858 P PP PP PP Sbjct: 747 TVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 45.2 bits (102), Expect = 8e-05 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 8/91 (8%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPP---PXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 PP P P P P P PP P P P P P PP PP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPP--PPEEVSLPPPDES 738 Query: 832 PP---XPPPXPP--PXPPPXPXPPPXXXXXP 909 PP PP P PP P PP P Sbjct: 739 PPSSKHPPTVSPSSSSAPPRPSTPPSVSSAP 769 Score = 36.7 bits (81), Expect = 0.029 Identities = 27/104 (25%), Positives = 27/104 (25%), Gaps = 2/104 (1%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPXPXP 800 PP PP P PPPPP P P PP P P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPP-PDESP 739 Query: 801 PXPXXPXXXXPPPXXPXP-PPXPPXXPXPPPPXPPXXXXPXPXP 929 P P P P P PP PP P P Sbjct: 740 PSSKHPPTVSPSSSSAPPRPSTPPSVSSAPPQTTNFCDTPGTRP 783 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 56.8 bits (131), Expect = 3e-08 Identities = 35/104 (33%), Positives = 35/104 (33%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G G GG G G G G G G G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGDD 380 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G GG G G G G G G Sbjct: 381 GDNYDDDGDGNGDDDDDDGDGNGGDDDDDDDGDGDGDDGDGDDG 424 Score = 53.6 bits (123), Expect = 2e-07 Identities = 37/97 (38%), Positives = 37/97 (38%), Gaps = 5/97 (5%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG----XXGGGGXGXGG 723 GGG G GGG GGG GGG GG G G G G G G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGD 379 Query: 722 XGXG-XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G Sbjct: 380 DGDNYDDDGDGNGDDDDDDGDGNGGDDDDDDDGDGDG 416 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G GGG G GG G G G G G G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGD 379 Query: 805 XG 800 G Sbjct: 380 DG 381 Score = 40.7 bits (91), Expect = 0.002 Identities = 40/136 (29%), Positives = 40/136 (29%), Gaps = 22/136 (16%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG----------------GGXGGGX 849 GG G GGG G GGG GG G G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGD 379 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGG------XGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G GG G G G G G G G G G Sbjct: 380 DGDNYDDDGDGNGDDDDDDGDGNGGDDDDDDDGDGDGDDGDGDDGDNDDDDGDGNGDDDD 439 Query: 686 XXXXGXGGGXGXXGXG 639 G G G G G Sbjct: 440 DDGDGDGDGDGDGDDG 455 Score = 36.3 bits (80), Expect = 0.038 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 8/129 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G GGG G G G G G G G G G Sbjct: 329 GGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGDDGDNYDDDG 388 Query: 805 XGG------XGXGXGGXXXXXXXXXXXXXGXXGXXG--GXXXGGGGGXXXXXXGXGXXXX 650 G G G GG G G G G G G G Sbjct: 389 DGNGDDDDDDGDGNGGDDDDDDDGDGDGDDGDGDDGDNDDDDGDGNGDDDDDDGDGDGDG 448 Query: 649 XGXGGXXGG 623 G G G Sbjct: 449 DGDGDDGDG 457 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 56.8 bits (131), Expect = 3e-08 Identities = 36/103 (34%), Positives = 36/103 (34%), Gaps = 3/103 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXXXXPPPXXXXPP 837 PPP P P P PPPP P P P P P PPP P Sbjct: 2124 PPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSV-PPPMGAPPS 2182 Query: 838 XPPP--XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP PP PPP PP P PP PPP P Sbjct: 2183 GPPPMGAPPSGPPPMGTPP---SGHPPMGAPPMGPPPSGSHSP 2222 Score = 56.0 bits (129), Expect = 4e-08 Identities = 36/110 (32%), Positives = 36/110 (32%), Gaps = 4/110 (3%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP PPP P P PPP P PP P P P P Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVP 2174 Query: 844 PP--XPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP PP P P PP P P PPP P Sbjct: 2175 PPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAP--PMGPPPSGSHSP 2222 Score = 55.6 bits (128), Expect = 6e-08 Identities = 33/100 (33%), Positives = 33/100 (33%), Gaps = 2/100 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP--PPPXXPPPXPXPPPPX 789 PP P PPP PPPP P P P PP PPP PP Sbjct: 2125 PPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPS-- 2182 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PP PP PP PP P PPP P Sbjct: 2183 GPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP---PP 786 PP PP P P P P P PP P P P PP PPP PP PP Sbjct: 2150 PP--PPMGPARHSPSGPS-PLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 Query: 787 XXPPXXXXPPPXXXXPPXP 843 P PPP P P Sbjct: 2207 MGAP-PMGPPPSGSHSPAP 2224 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/116 (27%), Positives = 32/116 (27%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P P P PP P P P P Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHS-PSGPSPLGAPPSV 2173 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP P P PP PPP P P P PP P PP P P Sbjct: 2174 PPPMGAPPSGPPPMGAPP--SGPPPMGTPPSGHP-PMGAPPMGP--PPSGSHSPAP 2224 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/80 (36%), Positives = 29/80 (36%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G G GG GG GG GG GG G GG G GG G Sbjct: 763 GGDGHASSGAGSSSG-GASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSG 821 Query: 746 GGGXGXGGXGXGXGXGGGGG 687 G G G G G GG Sbjct: 822 GASGGAGSSSGGASGGADGG 841 Score = 54.8 bits (126), Expect = 1e-07 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXX 678 GG G G GG GG G G GG GG G G G GG G Sbjct: 763 GGDGHASSGAGSSSGGAS--GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSS 820 Query: 677 XGXGGGXGXXGXGXXGGXXGG 615 G GG G G GG GG Sbjct: 821 GGASGGAGSSSGGASGGADGG 841 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G GG GG GG G GG G GG GG G GG G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG-SSG 821 Query: 710 XGXGGGGGXXXXGXGGGXG 654 GG G GG G Sbjct: 822 GASGGAGSSSGGASGGADG 840 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/80 (35%), Positives = 28/80 (35%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G GG G G GG GG GG GG GG G Sbjct: 764 GDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGG--SSGGASGGAGGSSG 821 Query: 782 GGGXGXGGGXXGGGGXGXGG 723 G G G G G GG Sbjct: 822 GASGGAGSSSGGASGGADGG 841 Score = 51.6 bits (118), Expect = 9e-07 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G GG GG GG GG GG GG GG G GG G GG Sbjct: 764 GDGHASSGAGSSSGGASGGAGGSSGGAN--GGAGSSSGGASGGAGGSSGGASGGAGGSSG 821 Query: 728 GGXGX-GXGXGGGGGXXXXG 672 G G G GG G G Sbjct: 822 GASGGAGSSSGGASGGADGG 841 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG GG G G G GG GG GG GG GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGA-SGGAGGSSGG--ASGGAGGS 819 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 GG GG G GG G G Sbjct: 820 SGGASGGAGSSSGGASGGADG 840 Score = 50.0 bits (114), Expect = 3e-06 Identities = 31/89 (34%), Positives = 31/89 (34%), Gaps = 1/89 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGGXXXXGGGXXXXGGXX 786 G GG G GG G GG GG G GG GG GG Sbjct: 756 GSNIDSSGGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGG--ASGGAGGSSGGAS 813 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 GG G G GG GG G GG G G Sbjct: 814 GGAG-GSSGGASGGAGSSSGGASGGADGG 841 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GG G GG GG G GG G GG GG GG GG GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANG-GAGSSSGGASGGAGGSSGGASGGAGG--SSGGASGGA 827 Query: 797 GGXXGGGGXGXGGG 756 G GG G GG Sbjct: 828 GSSSGGASGGADGG 841 Score = 49.6 bits (113), Expect = 4e-06 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG G GG G G G GG G G GG G GG G Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSG 832 Query: 802 GGXGXGXGG 776 G G GG Sbjct: 833 GASGGADGG 841 Score = 48.4 bits (110), Expect = 9e-06 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G G G G G G GG G GG GG GG G Sbjct: 764 GDGHASSGAGSSSGGASGGAG-----GSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG 818 Query: 788 XGGGGXGXGGGXXGGGGXGXGG 723 GG G G GG G G Sbjct: 819 SSGGASGGAGSSSGGASGGADG 840 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G G GG G G GG G G GG GG G GG Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGAN-GGAGSSSGGASGGAGGSSGGASGGAGGSSGGAS 824 Query: 802 GGXGXGXGG 776 GG G GG Sbjct: 825 GGAGSSSGG 833 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GG G GG G G GG GG G GG GG G GG Sbjct: 777 GGASGGA-GGSSGGANGGAGSSSG-GASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGA 834 Query: 805 XGGXGXG 785 GG G Sbjct: 835 SGGADGG 841 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 GG G GG GG G G G G G G GG GG GG Sbjct: 799 GGASGGAGG--SSGGASGGAGGSSG-----GASGGAGSSSGGASGGADGG 841 >SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 56.4 bits (130), Expect = 3e-08 Identities = 51/130 (39%), Positives = 51/130 (39%), Gaps = 8/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGX----GGXXX 822 G G GGG G GGG G G G GGG G GGG G GGG GG Sbjct: 34 GYILGYGGGYILGYGGGYILGYGG-GYILGYGGGYILGYGGGYILGYGGGYILGYGGGYI 92 Query: 821 XGGGXXXXGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G GG G GGG G GG G G G G GGG GG G Sbjct: 93 LGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYG 152 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 153 GGYILGYGGG 162 Score = 56.0 bits (129), Expect = 4e-08 Identities = 50/126 (39%), Positives = 50/126 (39%), Gaps = 8/126 (6%) Frame = -3 Query: 968 GXGGGXX-GXGGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGX----GGXXXXGGG 810 G GGG G GGG G G G GGG G GGG G GGG GG G G Sbjct: 30 GDGGGYILGYGGGYILGYGG-GYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYG 88 Query: 809 XXXXGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G GG G GGG G GG G G G G GGG GG G G Sbjct: 89 GGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYI 148 Query: 632 GGXXGG 615 G GG Sbjct: 149 LGYGGG 154 Score = 54.4 bits (125), Expect = 1e-07 Identities = 48/124 (38%), Positives = 48/124 (38%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G GGG G GGG G G G GGG G GGG G GG G G Sbjct: 50 GYILGYGGGYILGYGGGYILGYGG-GYILGYGGGYIL--GYGGGYILGYGGGYILGYGGG 106 Query: 803 XXGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G GGG G GG G G G G GGG GG G G G Sbjct: 107 YILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILG 166 Query: 626 XXGG 615 GG Sbjct: 167 YGGG 170 Score = 53.6 bits (123), Expect = 2e-07 Identities = 54/138 (39%), Positives = 54/138 (39%), Gaps = 16/138 (11%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGX----GGXXX 822 G G GGG G GGG G G G GGG G GGG G GGG GG Sbjct: 82 GYILGYGGGYILGYGGGYILGYGG-GYILGYGGGYILGYGGGYILGYGGGYILGYGGGYI 140 Query: 821 XGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-----XGGXGXGXGXG---GGGGXXXXGXG 666 G G G GG G GGG G G G GG G G G G GG G G Sbjct: 141 LGYGGGYILGYGGGYILGYGGGYILGYGGGYILRYGGGYILGYGGGYILGYGGGYILGYG 200 Query: 665 GG-XGXXGXGXXGGXXGG 615 GG G G G GG Sbjct: 201 GGYILGYGGGYILGYRGG 218 Score = 44.4 bits (100), Expect = 1e-04 Identities = 45/124 (36%), Positives = 45/124 (36%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G GGG G GGG G G G GGG G GGG GG G G Sbjct: 130 GYILGYGGGYILGYGGGYILGYGG-GYILGYGGGYIL--GYGGGYILRYGGGYILGYGGG 186 Query: 803 XXGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G GGG G GG G G GGG GG G G G Sbjct: 187 YILGYGGGYILGYGGGYILGYGGGYILGYRGGYILVYGGGLILRYGGGVILGYGGGYILG 246 Query: 626 XXGG 615 GG Sbjct: 247 YGGG 250 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/60 (48%), Positives = 29/60 (48%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G GGG G G GGG GG GGG GG G G G G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGG----GGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 53.6 bits (123), Expect = 2e-07 Identities = 28/53 (52%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGGXGXXGXG 639 G GGGG G GGG GGGG G GG G G G G G G G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGG-GDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 52.0 bits (119), Expect = 7e-07 Identities = 31/62 (50%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGG 696 G G G G GGG GG GGG GG GGGG G G G G G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGG----GGG----GGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGD 353 Query: 695 GG 690 G Sbjct: 354 DG 355 Score = 51.6 bits (118), Expect = 9e-07 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G GGG G GGG GGG GGG G G G G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/54 (48%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGG 660 G G GG GGGG G GGG GGG G G G G G G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 50.8 bits (116), Expect = 2e-06 Identities = 31/65 (47%), Positives = 31/65 (47%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G GGG G GGG GG GGGG G GGG G G G G G G G G G G Sbjct: 302 GDGDGDGGGGG----DGGG----GGGGGGGGGGDGGGDGDGDGDG-DGDGDGDGDGDGDG 352 Query: 686 XXXXG 672 G Sbjct: 353 DDGWG 357 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 G G GGG G GGG GG G G G G G G G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GGG G GGG G GG G G G G G G G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 G G GGG GGG GG G G G G G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/63 (41%), Positives = 26/63 (41%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G GG G GGG G GGG GGG GGG G G G G G G Sbjct: 302 GDGDGDGGGGGD-------GGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDD 354 Query: 767 XGG 759 G Sbjct: 355 GWG 357 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GGG G GG G G G GGGG G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG-DGDGDGDGDGDG 350 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGG-GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGGG GG G G G GGG GG G G G G G G G G Sbjct: 302 GDGDGDGGGGGD-GGGGGGGGGGGGGDGGGDGDGDGDGDG-DGDGDGDGDGDG 352 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 56.4 bits (130), Expect = 3e-08 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 4/126 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX--GXXXXXGGGXGXGGGXGGGXGGGX--GGXXXXGG 813 G G GGG G GG G G GGG G G GG G GG Sbjct: 33 GYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGG 92 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G GGGG G GG G G GG GG G G Sbjct: 93 GSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDD 152 Query: 632 GGXXGG 615 G GG Sbjct: 153 AGGGGG 158 Score = 56.0 bits (129), Expect = 4e-08 Identities = 38/116 (32%), Positives = 38/116 (32%), Gaps = 2/116 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGX--GGXXXXGGGXXXXG 795 G G G G GG G GGG G G GG G GGG G Sbjct: 91 GGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDG 150 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGGG G GG G G GGGG GGG G GG Sbjct: 151 DDAGGGGGSDHDGDDAAGGGGSDDDGY-DAAGGGGSDDDGDDGGGSYDDGDDGGGG 205 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/122 (31%), Positives = 38/122 (31%), Gaps = 4/122 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX---GGGXGGGXGGGXGG-XXXXGGGXXX 801 G GG G GG G GGG G G GG G G GGG Sbjct: 11 GGGGDSYDDGDDAGGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDH 70 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GGG G GG G G G GGG GG G G Sbjct: 71 DGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGD 130 Query: 620 GG 615 GG Sbjct: 131 GG 132 Score = 54.0 bits (124), Expect = 2e-07 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 5/123 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX---GGGXGGGXGGGXGGXXXXGGG 810 G GGG G GG G GGG G G GG G G G G Sbjct: 72 GDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDG 131 Query: 809 XXXXGGXX--GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GGGG G GGGG G G GGG GG G G Sbjct: 132 GSDDDGYDAAGGGGSDDDGDDAGGGG-GSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGD 190 Query: 635 XGG 627 GG Sbjct: 191 DGG 193 Score = 52.4 bits (120), Expect = 5e-07 Identities = 42/129 (32%), Positives = 42/129 (32%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX---GGGXGGGXGGGXGGXXXXGGG 810 G G GGG G GG G GG G G GG G G GGG Sbjct: 20 GDDAGGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGG 79 Query: 809 XXXXGGXX--GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG--GGXGXXGX 642 G GGGG G GGGG G G GGGG G G G Sbjct: 80 GSDDDGYDAAGGGGSDHDGYDAGGGG---GSDDDGYDAAGGGGSDHDGYDAVGDGGSDDD 136 Query: 641 GXXGGXXGG 615 G GG Sbjct: 137 GYDAAGGGG 145 Score = 52.4 bits (120), Expect = 5e-07 Identities = 41/123 (33%), Positives = 41/123 (33%), Gaps = 7/123 (5%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGX---GGGXGGGXGGGXGGXXXXGGGXXXXGG 792 GGG G GG G GG G G GGG G G GGG G Sbjct: 65 GGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDG 124 Query: 791 XX--GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG--XGGGXGXXGXGXXGGX 624 G GG G GGG G G GGGGG G GG G G Sbjct: 125 YDAVGDGGSDDDGYDAAGGG---GSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAG 181 Query: 623 XGG 615 GG Sbjct: 182 GGG 184 Score = 49.2 bits (112), Expect = 5e-06 Identities = 35/122 (28%), Positives = 35/122 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GG G G G GG G G G GGG Sbjct: 53 GGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAG---GGGGSDD 109 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GGG G G G G GGG GGG G G Sbjct: 110 DGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGGGGSDHDGDDAAGG 169 Query: 620 GG 615 GG Sbjct: 170 GG 171 Score = 48.0 bits (109), Expect = 1e-05 Identities = 35/111 (31%), Positives = 35/111 (31%), Gaps = 2/111 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX--GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G GGG G GG G G GG G G GG GGG Sbjct: 98 GYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGG- 156 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G GGG G GG G GGG G GG G Sbjct: 157 --GGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGG 205 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/108 (26%), Positives = 29/108 (26%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GGG G G G G G G GGG G Sbjct: 111 GYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGGGGSDHDGDDAAGGG 170 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G GGG G G G G GGG G G G Sbjct: 171 GSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGGDDDDYDGDDDGGG 218 Score = 35.5 bits (78), Expect = 0.067 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGGG G GG G G GGG GG G G G G Sbjct: 11 GGGGDSYDDGDDAGGGGGSDDDGYD--AGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGS 68 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G GGGGG Sbjct: 69 DHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGG 106 Score = 35.1 bits (77), Expect = 0.088 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GG G GG G G G G GG Sbjct: 150 GDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGGDDDD 209 Query: 800 XGGXXGGGG 774 G GGG Sbjct: 210 YDGDDDGGG 218 Score = 33.9 bits (74), Expect = 0.20 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 1/100 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGGGXXXXGXX 809 G G G G G G GGGG G GGG G G G Sbjct: 59 GYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGG 118 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G GGGGG Sbjct: 119 GSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGGGG 158 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GG G G G GG G G GG G Sbjct: 144 GGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGG 203 Query: 800 XGGXXGGGGXGXGGG 756 G G GGG Sbjct: 204 GGDDDDYDGDDDGGG 218 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXXXG 815 G G G G G G G GGGG G GGG G GGG Sbjct: 150 GDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGGDDDD 209 Query: 814 XXGXGGXG 791 G G Sbjct: 210 YDGDDDGG 217 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 55.6 bits (128), Expect = 6e-08 Identities = 36/93 (38%), Positives = 36/93 (38%), Gaps = 2/93 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG GGG G G G G G GGG G GG GGG G GG Sbjct: 443 GGRGMRGGGMPNMDGFGGMEGGMNGIVGMNG-MGGGANGMAGGMNGMGGGMDDMAGGMGG 501 Query: 779 G--GXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G GGG G GG G GG G Sbjct: 502 GMNGMGAGMNAMGGGLNGIGGMNGMRGIGGMNG 534 Score = 52.0 bits (119), Expect = 7e-07 Identities = 33/95 (34%), Positives = 33/95 (34%), Gaps = 1/95 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGGXXXXGGGXX 804 GG G G G G G G G GGG GG GGG G G GGG Sbjct: 459 GGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGGLN 518 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 GG G G G G G G G G G Sbjct: 519 GIGGMNGMRGIGGMNGMDGMRGYERGPYGGSESFG 553 Score = 46.4 bits (105), Expect = 4e-05 Identities = 38/100 (38%), Positives = 38/100 (38%), Gaps = 9/100 (9%) Frame = -3 Query: 890 GGGXGXGGGXGG------GXGGGXGGXXXXGGGXXXXGGXXG--GGGXGXGGGXXG-GGG 738 G G G G GG G GG GG G GG G GG G GGG GG Sbjct: 439 GMGMGGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGG 498 Query: 737 XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G GG G GG G G G G G Sbjct: 499 MGGGMNGMGAGMNAMGG-GLNGIGGMNGMRGIGGMNGMDG 537 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -1 Query: 982 GGGGXG-XGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GGG G G G G G G G G GG G GG G G Sbjct: 441 GMGGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGGMG 500 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 501 GGMNGMGAG 509 Score = 32.7 bits (71), Expect = 0.47 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 4/73 (5%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXG--GXGGGGXGXXGGXGGGXGXXG--GGXXXXG 815 GGG G GG G GG G G G G G GG G G G G G Sbjct: 475 GGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGGLNGIGGMNGMRGIGGMNG 534 Query: 814 XXGXGGXGXGXGG 776 G G G G Sbjct: 535 MDGMRGYERGPYG 547 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 55.6 bits (128), Expect = 6e-08 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGGG G GGG GGGG G GG G G G G G GGG G G G G Sbjct: 41 GGGGGGGGGG--GGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 55.2 bits (127), Expect = 8e-08 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GGG GGG GGG GG G G GGG G GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDADNDDDDD 100 Query: 704 XGGGG 690 G G Sbjct: 101 DNGTG 105 Score = 54.8 bits (126), Expect = 1e-07 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GGG G GGG GGG GGG G G G GGGG G G G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 50.8 bits (116), Expect = 2e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG GG GGGG G GGG G G G G GGGGG G G G G Sbjct: 41 GGG----GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 50.8 bits (116), Expect = 2e-06 Identities = 27/67 (40%), Positives = 27/67 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G GGG G GG G G G GG G GG G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGG-GGGGGGGDGDGDGDGDADNDDDDD 100 Query: 805 XGGXGXG 785 G G G Sbjct: 101 DNGTGIG 107 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG GG G G G G GGG GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDADNDDDDD 100 Query: 782 GGGXGXG 762 G G G Sbjct: 101 DNGTGIG 107 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG GG G G G G GGG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDADNDDDDD 100 Query: 788 XGGGGXG 768 G G G Sbjct: 101 DNGTGIG 107 Score = 49.2 bits (112), Expect = 5e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GGGG G GG G G G G G G GG G G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGGG G GGG G GG G G G G G GG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG-DGDGDANANADGGGGGGGGGDGDGDGDGDADNDDDD 99 Query: 802 GGXGXGXG 779 G G G Sbjct: 100 DDNGTGIG 107 Score = 47.2 bits (107), Expect = 2e-05 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G GGG G GGG G G G G GGG GG GG G G G Sbjct: 41 GGGGGGGGGG-------GGGGGGGGGDGDGDGDGDANANADGGG----GGGGGGDGDGDG 89 Query: 761 GG 756 G Sbjct: 90 DG 91 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG GGG GG GGG GG GG G G G G G GG G G G G G G Sbjct: 41 GGGGGGGGGG----GGG----GGGGGGDGDGDGDGDANANADGGGGGG-GGGDGDGDG 89 Score = 46.4 bits (105), Expect = 4e-05 Identities = 25/50 (50%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 GGGGG G GGG G G G G G G GGGG G GG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGG-GGGGGDGDGDG 89 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 55.2 bits (127), Expect = 8e-08 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP PP P PP P PP P P P P P PP P Sbjct: 300 PPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGR 359 Query: 778 PP--PXXPPXXXXPPPXXXX-PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PP P PP PP PP P PP P PP P P P PP P Sbjct: 360 PPHEPGRPPHEPGRPPHEPGRPPYE----PGRPPHEPGRPPHELGRP--PHEPGRPPHEP 413 Query: 949 XXPPPXPXXPP 981 P P PP Sbjct: 414 GRLPHEPGRPP 424 Score = 54.4 bits (125), Expect = 1e-07 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 9/127 (7%) Frame = +1 Query: 628 PPXXPXPXXPX---PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP------XXPPPXPXPP 780 PP P P P PP P P PP P P PP Sbjct: 265 PPGIPYPDNPRLGERPPIDVRRQEPGREYYDQKPGPPGRPPFEPDRLQHEARIPPHDQGR 324 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P PP P PP P PP P P P PP P PP Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRP--PHEPGRPPHEPGRPP 382 Query: 961 PXPXXPP 981 P PP Sbjct: 383 YEPGRPP 389 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 6/108 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXX 828 P P P PP P P P P P PP P PP P PP PP Sbjct: 326 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 385 Query: 829 X-PPXPPPXPP---PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP PP P PP P P PP PP Sbjct: 386 GRPPHEPGRPPHELGRPPHEPGRPPHEPG--RLPHEPGRPPYEQRRPP 431 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 6/115 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXX 828 P PP P P P P PP P PP P PP PP Sbjct: 298 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 357 Query: 829 X-PPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P PP P PP P P P PP PP P PP Sbjct: 358 GRPPHEPGRPPHEPGRPPHEPGRPPYEPGRP--PHEPGRPPHELGRPPHEPGRPP 410 Score = 42.3 bits (95), Expect = 6e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 2/93 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX-- 792 P PP P P P P PP P P P P P PP P PP Sbjct: 343 PGRPPHEPG-RPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGR 401 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PP P P P PP PP Sbjct: 402 PPHEPGRPP---HEPGRLPHEPGRPPYEQRRPP 431 Score = 36.3 bits (80), Expect = 0.038 Identities = 34/130 (26%), Positives = 34/130 (26%), Gaps = 10/130 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP- 795 P PP P P P P PP P P P P P PP PP Sbjct: 378 PGRPPYEPG-RPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEPGRPPYEQRRPPHEKSW 436 Query: 796 -----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP----XXPPPXP 948 P PP P P PP P P P PP Sbjct: 437 QAFEHQRISHEHGGPLFEPGRPPHEPGRPSFDQRRPPYDQGRPGMPPGPRHDQSRPPLDE 496 Query: 949 XXPPPXPXXP 978 PP P P Sbjct: 497 GRPPLDPGRP 506 Score = 29.1 bits (62), Expect = 5.8 Identities = 24/96 (25%), Positives = 24/96 (25%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPX 872 PP PP P PP PP P P P P P Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHE--PGRPPYEPGRPPHEPGRPP 396 Query: 873 XPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PP P P P P PP PP Sbjct: 397 HELGRPPHEPGRPPHEPGRL-PHEPGRPPYEQRRPP 431 Score = 28.7 bits (61), Expect = 7.6 Identities = 32/125 (25%), Positives = 32/125 (25%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P P PP P P P P P P Sbjct: 406 PGRPPHEPGRLPHEPGRPPYEQRRPPHEKSWQAFEHQRISHEHGGPLFEPGRP-PHEPGR 464 Query: 793 PPXXXXPPPXXXXPPXPPPXP---PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P PP P PP PP P P PP P Sbjct: 465 PSFDQRRPPYDQGRPGMPPGPRHDQSRPPLDEGRPPLDPGRP-GPGRGRGYPPGDRSPRG 523 Query: 964 XPXXP 978 P P Sbjct: 524 VPISP 528 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 55.2 bits (127), Expect = 8e-08 Identities = 35/88 (39%), Positives = 35/88 (39%), Gaps = 5/88 (5%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXG---GGXXXXGGXXGGGG 774 GG GG G GG GG GG GG GG GG GG GGGG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 773 XGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GGG GG G G GGGG Sbjct: 501 GGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXG 672 GGG GG G GG G GG G GG GG G GGGG G Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 671 XGGGXGXXGXGXXGGXXGG 615 GGG G G G G Sbjct: 501 GGGGGGGFSGGACGDFTSG 519 Score = 47.6 bits (108), Expect = 2e-05 Identities = 29/88 (32%), Positives = 29/88 (32%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G G GG G G GG GG GG G G G GG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG G GG G G GGG Sbjct: 501 GGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/75 (38%), Positives = 29/75 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GG G GG G GGG GG GGG GG GG Sbjct: 458 GGAYGPGG--EGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGA--- 512 Query: 800 XGGXXGGGGXGXGGG 756 G G GGG Sbjct: 513 CGDFTSGLSPTCGGG 527 Score = 39.5 bits (88), Expect = 0.004 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGX----GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXX--GGXGGGXGXXGGGXX 824 GGGGG G G G G G GG GG GG GGG G GGG Sbjct: 442 GGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGG-- 499 Query: 823 XXGXXGXGGXGXGXGG 776 G GG G G G Sbjct: 500 -----GGGGGGGGFSG 510 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G GG GG GGG Sbjct: 443 GGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVG-GRSIWNVVPGGFGG----GGGASG 497 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GGGG G GG G G G G Sbjct: 498 GGGG-GGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGG----XGGGG 881 GGGGG GGG G GG G G GGGG Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGX---------GXGXXXXGGXGGGGXGXXGGXGGG 851 GG G G GG GG G G G GGGG G GG GG Sbjct: 458 GGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 G GGG G GG GG G G G G G G GGG Sbjct: 488 GFGGGGGASGG-----GGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 55.2 bits (127), Expect = 8e-08 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP PP P PP P PP P P P P P PP P Sbjct: 66 PPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGR 125 Query: 778 PP--PXXPPXXXXPPPXXXX-PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PP P PP PP PP P PP P PP P P P PP P Sbjct: 126 PPHEPGRPPHEPGRPPHEPGRPPYE----PGRPPHEPGRPPHELGRP--PHEPGRPPHEP 179 Query: 949 XXPPPXPXXPP 981 P P PP Sbjct: 180 GRLPHEPGRPP 190 Score = 54.4 bits (125), Expect = 1e-07 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 9/127 (7%) Frame = +1 Query: 628 PPXXPXPXXPX---PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP------XXPPPXPXPP 780 PP P P P PP P P PP P P PP Sbjct: 31 PPGIPYPDNPRLGERPPIDVRRQEPGREYYDQKPGPPGRPPFEPDRLQHEARIPPHDQGR 90 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P PP P PP P PP P P P PP P PP Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRP--PHEPGRPPHEPGRPP 148 Query: 961 PXPXXPP 981 P PP Sbjct: 149 YEPGRPP 155 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 6/108 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXX 828 P P P PP P P P P P PP P PP P PP PP Sbjct: 92 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 151 Query: 829 X-PPXPPPXPP---PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP PP P PP P P PP PP Sbjct: 152 GRPPHEPGRPPHELGRPPHEPGRPPHEPG--RLPHEPGRPPYEQRRPP 197 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 6/115 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXX 828 P PP P P P P PP P PP P PP PP Sbjct: 64 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 123 Query: 829 X-PPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P PP P PP P P P PP PP P PP Sbjct: 124 GRPPHEPGRPPHEPGRPPHEPGRPPYEPGRP--PHEPGRPPHELGRPPHEPGRPP 176 Score = 42.3 bits (95), Expect = 6e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 2/93 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX-- 792 P PP P P P P PP P P P P P PP P PP Sbjct: 109 PGRPPHEPG-RPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGR 167 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PP P P P PP PP Sbjct: 168 PPHEPGRPP---HEPGRLPHEPGRPPYEQRRPP 197 Score = 36.3 bits (80), Expect = 0.038 Identities = 34/130 (26%), Positives = 34/130 (26%), Gaps = 10/130 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP- 795 P PP P P P P PP P P P P P PP PP Sbjct: 144 PGRPPYEPG-RPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEPGRPPYEQRRPPHEKSW 202 Query: 796 -----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP----XXPPPXP 948 P PP P P PP P P P PP Sbjct: 203 QAFEHQRISHEHGGPLFEPGRPPHEPGRPSFDQRRPPYDQGRPGMPPGPRHDQSRPPLDE 262 Query: 949 XXPPPXPXXP 978 PP P P Sbjct: 263 GRPPLDPGRP 272 Score = 29.1 bits (62), Expect = 5.8 Identities = 24/96 (25%), Positives = 24/96 (25%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPX 872 PP PP P PP PP P P P P P Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHE--PGRPPYEPGRPPHEPGRPP 162 Query: 873 XPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PP P P P P PP PP Sbjct: 163 HELGRPPHEPGRPPHEPGRL-PHEPGRPPYEQRRPP 197 Score = 28.7 bits (61), Expect = 7.6 Identities = 32/125 (25%), Positives = 32/125 (25%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P P PP P P P P P P Sbjct: 172 PGRPPHEPGRLPHEPGRPPYEQRRPPHEKSWQAFEHQRISHEHGGPLFEPGRP-PHEPGR 230 Query: 793 PPXXXXPPPXXXXPPXPPPXP---PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P PP P PP PP P P PP P Sbjct: 231 PSFDQRRPPYDQGRPGMPPGPRHDQSRPPLDEGRPPLDPGRP-GPGRGRGYPPGDRSPRG 289 Query: 964 XPXXP 978 P P Sbjct: 290 VPISP 294 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 55.2 bits (127), Expect = 8e-08 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPX---PXPPPPXXPPPXPXPP--PPXXPPXXXXPPP 819 P P P P P P P P PPP PP PP P PP PPP Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPP 2630 Query: 820 XXXXPPXPPPXPPPXPPP-XPXPP 888 P P PPP PPP P PP Sbjct: 2631 GLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 50.4 bits (115), Expect = 2e-06 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 2/87 (2%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX-PPPXPX 882 P P P P P P PP P PPP P PP P PP P Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQL---PPPDMFPPQMMPPMVPMMLPPMLPL 2627 Query: 883 PPPXXXXXPXXP-XPPXXPPPXPXXPP 960 PPP P P PP PPP PP Sbjct: 2628 PPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 4/84 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPX--PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P PP P PPP P PP P P PPP Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPP 2630 Query: 862 XPPPXPXPP--PXXXXXPXXPXPP 927 P P P P P P PP Sbjct: 2631 GLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXX 792 P P P P PP P P P P PP PPP P P P PPP Sbjct: 2588 PIVAPMQPPFFGPQLPP-PDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLP 2646 Query: 793 PPXXXXPP 816 PP PP Sbjct: 2647 PPGGPFPP 2654 Score = 42.3 bits (95), Expect = 6e-04 Identities = 30/87 (34%), Positives = 30/87 (34%), Gaps = 6/87 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPP--PPXXPPPXPXPPP 783 PP P P PP P P P PP PP P PP P PPP Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPP 2630 Query: 784 --PXXPPXXXXPPPXXXXPPXPPPXPP 858 P P PPP PP P PP Sbjct: 2631 GLPMQPEAPVQPPP---LPPPGGPFPP 2654 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/99 (30%), Positives = 30/99 (30%), Gaps = 9/99 (9%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXP----PXXXXPPPXXXXPPXPPP--XPPPXPP- 870 P P P PPP P P P P P PPP PP P Sbjct: 2556 PLARGPQNFPQNVEQPPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPP 2615 Query: 871 --PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P P P PPP PP Sbjct: 2616 MVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 35.5 bits (78), Expect = 0.067 Identities = 26/96 (27%), Positives = 26/96 (27%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP P P P P PPP P P P P PP P Sbjct: 2542 PPAPQQQIVQQNVMPLARGPQNFPQNVEQPPPQ-PQMNAAMSPDRRWPIVAPMQPPFFGP 2600 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P PP P PP P P Sbjct: 2601 QLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQP 2636 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 55.2 bits (127), Expect = 8e-08 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P PP P P PP P P PP P PP P P P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 835 PXPP----PXPPPXPPPXPXPP 888 PP PP PPP P Sbjct: 798 HLPPAPNISAEPPPPPPVARKP 819 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PP P PP P PPP PP P P P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 892 XXXXXPXXPXPPXXPPPXPXXP 957 P P PPP P Sbjct: 798 HLPPAPNISAEPPPPPPVARKP 819 Score = 47.6 bits (108), Expect = 2e-05 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 1/83 (1%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P PP P PP P PP P P PP PP P P P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 871 PXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P Sbjct: 798 HLP-PAPNISAEPPPPPPVARKP 819 Score = 47.6 bits (108), Expect = 2e-05 Identities = 35/118 (29%), Positives = 35/118 (29%), Gaps = 1/118 (0%) Frame = +1 Query: 628 PPXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 PP P P P PP P P PPP P P P P PP P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPP-CAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNIS 806 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PP P P P P P PPP P Sbjct: 807 AEPP-----PPPPVARKPSRSNSTSSQRSLELQSPSREEGPSLITAEPPPPPPVARKP 859 Score = 46.4 bits (105), Expect = 4e-05 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPP 939 P P PP PP PP PP P PP P PP P P P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 940 PXPXXPPPXPXXPP 981 P P PP Sbjct: 798 HLPPAPNISAEPPP 811 Score = 45.2 bits (102), Expect = 8e-05 Identities = 40/145 (27%), Positives = 40/145 (27%), Gaps = 25/145 (17%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP----PPXPXPXPXPPXPXP---PPPXXPPPXPXP 777 P PP P P P PPP PP P P PP P P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISA 807 Query: 778 PPPXXPPXXXXP----------------PPXXXXPPXPPPXPPPXPP--PXPXPPPXXXX 903 PP PP P P P PPP PP P Sbjct: 808 EPPPPPPVARKPSRSNSTSSQRSLELQSPSREEGPSLITAEPPPPPPVARKPSRSNSTSS 867 Query: 904 XPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP P P Sbjct: 868 QQSIESAPGSPPTGADDFPPPPPPP 892 Score = 45.2 bits (102), Expect = 8e-05 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXP-PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 PP P P P P P PP PP P P PP P P P P P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP-APFSAAPHLPPAPNISAEP 809 Query: 954 PPPXPXPPPP 983 PPP P P Sbjct: 810 PPPPPVARKP 819 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP--PXPPPXPXPPPXXXXXPXX 915 P P P PP P PP P PPP P P P P PP Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 916 PXPPXXPPPXPXXPPPXP 969 PP P PPP P Sbjct: 798 HLPP--APNISAEPPPPP 813 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 11/77 (14%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP------XXP 947 P P P PP PP PP PPP P P P PP P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 948 XXPP-----PXPXPPPP 983 PP P PPPP Sbjct: 798 HLPPAPNISAEPPPPPP 814 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 54.8 bits (126), Expect = 1e-07 Identities = 37/121 (30%), Positives = 37/121 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P PP P P P PP PP PPP P PP P Sbjct: 424 PAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPP---PPPAPALPPLPLP 480 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P PP P PP PP PP P P P P P Sbjct: 481 PELPGSP--GDSPPATSPKQPPLPPKHSNGPP-LRQTPMSSSLSATPVSTPDTTPRTPAD 537 Query: 976 P 978 P Sbjct: 538 P 538 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 5/88 (5%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPPXPP----PXPPPXPPPXPXPPPXX 897 P P P P P PP P PP PP P PPP P P P P Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPE 482 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PP PP Sbjct: 483 LPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP---PPXPXPPPP 983 PP PPP PP PPPP P P P PP P P PP P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPAL---PPLPLPPELPGSPGDSPPATSPKQP 499 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/92 (29%), Positives = 27/92 (29%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P P P PP P P PP PP PPP PP P Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPP----PPPAPALPPLP 478 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P PP Sbjct: 479 LPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPP----PXPPXXPXPPPPXPPXXXXPXPXPXPPXX 944 PP P PP P P PPP P P P PP P P PP P P PP Sbjct: 449 PPLPSDEPP-PLPPDEEKPPPP-PAPALPPLPLPPELPGSPGDSPP-ATSPKQPPLPPKH 505 Query: 945 PXXPPPXPXP 974 PP P Sbjct: 506 SNGPPLRQTP 515 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 2/72 (2%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP--XPPPXPPP 873 P P PP P PP P PPP P PP PPP P PP PP PP Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIP---TPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Query: 874 XPXPPPXXXXXP 909 PPP P Sbjct: 71 VTQPPPPVTQSP 82 Score = 52.0 bits (119), Expect = 7e-07 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP----PPXXPPXXXXPPPXXXX 831 PP P P PP P PP P PPP PP PP P PP PPP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQS 81 Query: 832 PPXPP 846 P P Sbjct: 82 PEQEP 86 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/74 (36%), Positives = 27/74 (36%), Gaps = 3/74 (4%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP---PXXXXPPXP 843 P P PP P P P P P P PP P PPP P PP P PP Sbjct: 14 PVDQATPKPPQPTP-PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVT 72 Query: 844 PPXPPPXPPPXPXP 885 P PP P P Sbjct: 73 QPPPPVTQSPEQEP 86 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPP 786 PP P PPP PP P P P PP PP PP PP PPPP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 48.4 bits (110), Expect = 9e-06 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPP--PPXPXPXPXPPXPXPPPPXXPPPXPXPP---PPXXPPXXXX 810 P P P P P PP P PP P PPP PP PP PP P Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQ 73 Query: 811 PPPXXXXPPXPPP 849 PPP P P Sbjct: 74 PPPPVTQSPEQEP 86 Score = 48.4 bits (110), Expect = 9e-06 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P PP P P PPP P P P P PP PP P P P PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTP-PPVTQPPVTQPPVTQP-----PVTQPPVTQ 73 Query: 972 PPPP 983 PPPP Sbjct: 74 PPPP 77 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP---PPXXPPXXXXPPPXX 825 P P P PP P P P PP P PPP PP PP P PP Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP--V 71 Query: 826 XXPPXPPPXPPPXPP 870 PP P P P Sbjct: 72 TQPPPPVTQSPEQEP 86 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P PP PPP P P P PPP PP P PP PP Sbjct: 20 PKPPQP-TPPKPDTPPPGTNIPTPPSPN---TPPPVTQPP---VTQPPVTQPPVTQPPVT 72 Query: 949 XXPPPXPXXP 978 PPP P Sbjct: 73 QPPPPVTQSP 82 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P PP P PP P PP P PP PP PP P PP P Sbjct: 22 PPQPTPPKPDTPP----PGTNIPTPPSPNTPPPVTQPPVTQPP---VTQPPVTQPPVTQP 74 Query: 940 PXPXXPPP 963 P P P Sbjct: 75 PPPVTQSP 82 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXP-PPXXPXPPP-XPPXXPXPPPPXPPXXXXPXPXPXPP 938 PP P P P P P PP PPP P PP PP P P PP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP---PPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P PP P P P P PP PP P PP PPPP P P Sbjct: 30 PDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 777 PPXPXPXPPX---PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 PP P PP P P PPP PP P PP PP P P P Sbjct: 27 PPKPDTPPPGTNIPTPPSPNTPPP-VTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P PP P P PP PP P PP PP P P Sbjct: 35 PGTNIPTPPSPNTPPPVTQPPVTQ-PPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GG G GGG GGGG G GG G G GGGGG GGG G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYG-GGGGGGGFYQDSYGGGGG 140 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GG GG GGGG G GG GGGG G G G GGGGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 GGG GG GGG GG GG GGG GG GGGG G GGGG G Sbjct: 93 GGGRRERGGRGGG--GGYGGGGGYGGGGRSYGG--GGGGGGFYQDSYGGGGGG 141 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG GG GGGG G GG GGGG G GGG G GG GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGY------GGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 GG G G GGG GG G G GGG G GG GGG GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 985 GGGGGX--GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 GGGG G GG G GG G G G GG GGGG GGG G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GGG GG GG GGG GG GGG G GG G G GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 892 GGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GGGG GG GGG G GGG G GG G G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GGG G G GG GGG G GGGG G G GG G GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXG 791 GGG GG G G GG GGGG GG G G GGG G GG G Sbjct: 92 GGGGRRERGGRGGG------GGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G G G GGG GGG GGG GGGG G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -1 Query: 922 GXGXXXXGGXGGGGX-GXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G GG GGGG G GG GGG GGG G G G GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G G GGG G GGG G G GG G GGG GGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGGGG G GGG G GG G G GG GG GG GGG Sbjct: 103 GGGGGYGGGGGYGG--GGRSYGGG----GGGGGFYQDSYGGGGGG 141 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 G GGG G GGG G GG G G GG GGGG GGG G Sbjct: 101 GRGGGGGYGGG--GGYGGGGRSYG----GGGGGGGFYQDSYGGGGGG 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG 881 GGGGG G GG G GG G G GG GGGG Sbjct: 109 GGGGGYGGGGRSYG-GGGGGGGFYQDSYGGGGGGG 142 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G GG G GG GGG GG G GGG GGG G G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 52.8 bits (121), Expect = 4e-07 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P P P P P Sbjct: 469 PISNPSPR-PHPSPHPSSN-PSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSPN 526 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P Sbjct: 527 PISNPSISTSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSP 585 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/104 (27%), Positives = 29/104 (27%), Gaps = 1/104 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 477 PHPSPHPSSNPSPNPSPNP-SSDPSPNPSSNPSSDPSPNPSSNPSSEPSPNPISNPSIST 535 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P P P P P P P P Sbjct: 536 SPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDP 579 Score = 45.2 bits (102), Expect = 8e-05 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P PPPP PPP P PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P P P PPPP PPP P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P PP PPP PPP PPP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/83 (28%), Positives = 24/83 (28%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P P P P P P P P P P P P P P P P P P Sbjct: 473 PSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSPNPISNPS 532 Query: 913 XPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P Sbjct: 533 ISTSPISNPHPSSNPSPHPSSNP 555 Score = 42.3 bits (95), Expect = 6e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 P P P PPP PP P PPPP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPP 744 P P PPPPP P P P PP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/113 (24%), Positives = 28/113 (24%), Gaps = 5/113 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-----PXPXPPPPXXPPPXPXPP 780 P P P P P P P P P P P P P P P Sbjct: 483 PSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSEPSPNPISNPSISTSPISNPH 542 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P Sbjct: 543 PSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNPSSDPSLSFSPSSSSSPSVRP 595 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P P P PP P PPPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP 765 P P P P P PP P PPPP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PP PPP PPP PPP P P P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXP 735 P P P PPPPP P P P PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPP 961 P P P P PPP P P PP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P PPP P PPPP PP P P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P P PPP PPPPP P P P PP Sbjct: 862 PRPRRPPPPP------PPPPPPPPPPPPPP 885 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PPP PP PPP PPP P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P PPP P PPPPP P P P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P P P PPP PP PP PP PPP PPP Sbjct: 860 PRPRPRRPPPPPPP-----PP----PPPPPPPPPP 885 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 914 PPPXPXXPXPPXPXPPXXPPXPP 982 P P P P PP P PP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 915 PXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P PPP P PPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 896 PXXXPXPPPXPXXPXPPXPXPPXXPP 973 P P PP P P PP P PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 P P P P P PPP P PPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPP----PPPPPPP 885 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P P PPPP PP PPP PP PPP Sbjct: 860 PRPRPRRPPPPPPPPPP----PPP----PPPPPP 885 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 891 PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PP PPP P PPPP Sbjct: 860 PRPRPRRPPPPPPPPP-----PPPPPPPPPP 885 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P P P P P PPP P PPP P PPPP P P P Sbjct: 860 PRPRPRRPPP-------PPPPPPPPPP-----PPPPPPASSTGSTPGGDKVPSVGP 903 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P PP PPP P PPP P P PP Sbjct: 860 PRPRPRRPPPPPP-PPPPP----PPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P P P PPP P PPPPP P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PPP P PPP P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.5 bits (68), Expect = 1.1 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 2/83 (2%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXX 906 P P P P P P P P P P P P P P P P Sbjct: 459 PISNPSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSN 518 Query: 907 P-XXPXP-PXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 519 PSSEPSPNPISNPSISTSPISNP 541 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/73 (26%), Positives = 19/73 (26%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P P P P P P P P P P P P Sbjct: 459 PISNPSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSN 518 Query: 943 XPXXPPPXPXXPP 981 P P P P Sbjct: 519 PSSEPSPNPISNP 531 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P PPP P P PP PPP P Sbjct: 860 PRPRPRRPPPP----PPPPPPPPPPPPPPP 885 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP PP P P P PPP P P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P PP P P P PP P PP Sbjct: 860 PRPRPRRPPPP--PPPPPPPPPPPPPPP 885 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 PPP P P PPP P P P P Sbjct: 868 PPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 52.4 bits (120), Expect = 5e-07 Identities = 42/118 (35%), Positives = 42/118 (35%), Gaps = 8/118 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGG---GXGXGGGX---GGGXGGG-XGGXXXXGGG 810 G GGG G G GG G G G G GGG G G GGG G G Sbjct: 498 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 557 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGG G G G G G G G G GGG G G G G G Sbjct: 558 QPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPPG 615 Score = 49.6 bits (113), Expect = 4e-06 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 11/122 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP-----PPPXXPPPXPXPPPPXX 792 PP PPP PPPP P P PPP PPPP Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGA 552 Query: 793 PPXXXXPPPXXXXPPXPPP------XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 PPP PPP PPP PPP P PP Sbjct: 553 GQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLP 612 Query: 955 PP 960 PP Sbjct: 613 PP 614 Score = 47.6 bits (108), Expect = 2e-05 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 8/95 (8%) Frame = -3 Query: 890 GGGXGXG-----GGXGGGX---GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGX 735 GGG G G G GGG G G GG G G G G G GG G G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG-GGPPPPGAGQ 543 Query: 734 GXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G G GGG G G G Sbjct: 544 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 578 Score = 47.2 bits (107), Expect = 2e-05 Identities = 39/103 (37%), Positives = 39/103 (37%), Gaps = 13/103 (12%) Frame = -3 Query: 884 GXGXGGGX---GGGXGGG-XGGXXXXGGGXXXXGGXXGGG----GXGXGGG-XXGGGGXG 732 G G GGG G G GGG G G G GGG G G GGG G G G Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Query: 731 XGGXGXGXGXGGGGGXXXXGXGG----GXGXXGXGXXGGXXGG 615 G G G GGG G GG G G G G GG Sbjct: 556 WGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGG 598 Score = 46.0 bits (104), Expect = 5e-05 Identities = 38/108 (35%), Positives = 38/108 (35%), Gaps = 4/108 (3%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G G GG G G GGG G G G G GGG G Sbjct: 485 GGGQGWGQPPPGAGQG-GGPPPPGAGQGGGPPPPGAGQ---GWGQPPPGAGQGGGPPPPG 540 Query: 761 GGXXGGGGXGXGGXGXG---XGXGGGGGXXXXGXG-GGXGXXGXGXXG 630 G GG G G G G G GGG G G GG G G G Sbjct: 541 AGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEG 588 Score = 45.6 bits (103), Expect = 6e-05 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 3/89 (3%) Frame = -3 Query: 884 GXGXGGGXGGGX---GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 G GGG G G G G GG G G G G G G G G G G Sbjct: 481 GKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG-QGGGPPPP 539 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GGG G G G G G GG Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGG 568 Score = 45.2 bits (102), Expect = 8e-05 Identities = 32/112 (28%), Positives = 32/112 (28%), Gaps = 5/112 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXP-----PPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 PPP PPPP PP P PP PPPP PPP Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGA 552 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PP P P PP P PP Sbjct: 553 GQGWGQPP-PGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 42.3 bits (95), Expect = 6e-04 Identities = 37/116 (31%), Positives = 37/116 (31%), Gaps = 5/116 (4%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G G G G G G G G G G G G G GG G Sbjct: 485 GGGQGWGQPPPGA-GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQ 543 Query: 782 GGGXGXGGGXXGGG----GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGG G G G G G GG G G GG G G G GG Sbjct: 544 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Score = 41.5 bits (93), Expect = 0.001 Identities = 36/109 (33%), Positives = 36/109 (33%), Gaps = 8/109 (7%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGG---GXGXGGGX---GGGXGGGXGGXXXXGGGX 807 G GGG G G G G G G G GGG G G G G GG Sbjct: 509 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG 568 Query: 806 XXXGGXXGGGGXGXGGGXXG--GGGXGXGGXGXGXGXGGGGGXXXXGXG 666 G GG G G G G G GG G G G G G G Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPPGSG 617 Score = 33.9 bits (74), Expect = 0.20 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = -1 Query: 985 GGGGGX---GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GGG G G G G G G G G GGG G GG G G Sbjct: 531 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPP 590 Query: 814 XXGXGGXG 791 G G G Sbjct: 591 PPGAGQGG 598 Score = 32.7 bits (71), Expect = 0.47 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXP---XPPPPXXPPPXPXPPP 783 PP PP P PP PPP P PP PPPP P PPP Sbjct: 536 PP--PPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGP-PPP 592 Query: 784 PXXPPXXXXPPPXXXXPPXPPP 849 PP PPP Sbjct: 593 GAGQGGGPPPPGAGQGWGLPPP 614 Score = 30.7 bits (66), Expect = 1.9 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGG---GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G G GG G G GG G G G G G G G G G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP---PPGA 541 Query: 626 XXGG 615 GG Sbjct: 542 GQGG 545 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 52.0 bits (119), Expect = 7e-07 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 5/113 (4%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX---PPPXPXPPPPXXPPXXXX 810 P P P PPP P P P PPP PPP PPP P Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGG 216 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP--XPXXPPP 963 PP P P PPP PP P P PPP P PPP Sbjct: 217 IPPQNH-PLTNYPAPPPQ--GYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPP 266 Score = 44.8 bits (101), Expect = 1e-04 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPP-X 789 PP P P PPP PP P P PP P P PPP Sbjct: 176 PPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGY 235 Query: 790 XPPXXXXP--PPXXXXPPXPPPXP-PPXPPPXPXP 885 PP P PP P PPP P PPP P Sbjct: 236 APPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 1/100 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P PPP P PP PPP P PP P PP Sbjct: 175 PPPGHYPAPGQPGGYYPPPGGYQQP---PPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPP 231 Query: 820 XXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXP 936 P PP P PP P P P P P P Sbjct: 232 PQGYAP-PPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 2/83 (2%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXX-PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXX 915 PPPP PP P PP P P PPP PPP PP Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGG 215 Query: 916 PXPPXXPP-PXPXXPPPXPXXPP 981 PP P PPP PP Sbjct: 216 GIPPQNHPLTNYPAPPPQGYAPP 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 35/115 (30%), Positives = 35/115 (30%), Gaps = 11/115 (9%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPX------PXPPXPXPPPP--XXPPPXPXPPPP 786 P P P P PPP P P P P PPP PPP Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGG 215 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP---PXXPPP 942 PP P P PP P P P PP P P P P PPP Sbjct: 216 GIPPQNH---PLTNYPAPPPQGYAPPPGGYPGAPP-AGGYPGAPPPGGYPGGPPP 266 Score = 39.5 bits (88), Expect = 0.004 Identities = 33/111 (29%), Positives = 33/111 (29%), Gaps = 5/111 (4%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P P P PP P P P P PP PP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPP-PYVPQEG 214 Query: 844 PPXPPPXPP--PXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPP--XPXXPP 981 PP P P PPP P P P P PPP P PP Sbjct: 215 GGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPP 265 Score = 35.9 bits (79), Expect = 0.050 Identities = 30/117 (25%), Positives = 30/117 (25%), Gaps = 5/117 (4%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P PPP P P PP PP Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPA--PGQPGGYYPPPGGYQQPPPGGYAPPPYVPQE 213 Query: 819 XXXXPPPXXPXP--PPXPPXXPXPPP---PXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 PP P P PP PPP P P P P P PPP P Sbjct: 214 GGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 Score = 34.7 bits (76), Expect = 0.12 Identities = 33/115 (28%), Positives = 33/115 (28%), Gaps = 18/115 (15%) Frame = +3 Query: 693 PPPPXXXPPXX--------PXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXP 848 PPPP PP P PP PP P PPP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPP----PGGYAPPPYVP 211 Query: 849 X-----PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXX---PXXPPPX--PXPPPP 983 PP P P PP P P P P PPP P PPP Sbjct: 212 QEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPP 266 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 52.0 bits (119), Expect = 7e-07 Identities = 33/93 (35%), Positives = 33/93 (35%), Gaps = 1/93 (1%) Frame = -3 Query: 947 GXGGGXXG-GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G G GG G GG GG G G GGGG Sbjct: 174 GVGAGWDGTGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGS 233 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GGGG GG G G GGGG G Sbjct: 234 EDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 Score = 50.8 bits (116), Expect = 2e-06 Identities = 35/122 (28%), Positives = 35/122 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G GG G G G Sbjct: 155 GGTGGNPGECNSAGSSYHGGVGAGWDGTGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGY 214 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G GGG G G G G G GG G GGG G Sbjct: 215 NGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGGSSCSAVT 274 Query: 620 GG 615 GG Sbjct: 275 GG 276 Score = 48.8 bits (111), Expect = 7e-06 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 1/109 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGX-GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G G G G G G G G G G GG G GG G G G Sbjct: 174 GVGAGWDGTGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGS 233 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GG GG G G G G G GG GG G Sbjct: 234 EDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGGSSCSAVTGGNSKEYG 282 Score = 47.6 bits (108), Expect = 2e-05 Identities = 34/115 (29%), Positives = 34/115 (29%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G G G G G G G GG GG G G G G Sbjct: 121 GGGGGASNGYNGVDGQSGENGYRSSGTNYGQSRAGGTGGNPGECNSAGSSYH---GGVGA 177 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GG GG G G GG G GG GG Sbjct: 178 GWDGTGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGG 232 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGX---XGGXGGGXGXXGGGXXXXGXXGXGGXG 791 GG G G G GG GGGG G G GGG G GGG GG G Sbjct: 204 GGRAGGMNSGYNGGPAPGAVGGFGGGGGG-SEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Query: 790 XGXGG 776 GG Sbjct: 263 SYCGG 267 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 982 GGGGXGXGGGXX-GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG-GXGXXGGG 830 GG G GG G GG G G G G GGG G GG G G GGG Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGG 260 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGX-GGGXGXXGGGXXXXGXXG 806 GG G GG G GG GG GGG G G GGG G GG G Sbjct: 216 GGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGGSSCSAVTG 275 Query: 805 XGGXGXG 785 G Sbjct: 276 GNSKEYG 282 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GGGGG G G GG G G GGGG GG Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 Score = 35.1 bits (77), Expect = 0.088 Identities = 31/126 (24%), Positives = 31/126 (24%), Gaps = 5/126 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-----GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXX 821 GGGG G G G G G GG GG G G G Sbjct: 122 GGGGASNGYNGVDGQSGENGYRSSGTNYGQSRAGGTGGNPGECNSAGSSYHGGVGAGWDG 181 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G G GG G GG G GG G G Sbjct: 182 TGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGG 241 Query: 640 GGXXGG 623 GG G Sbjct: 242 GGGYSG 247 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 52.0 bits (119), Expect = 7e-07 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P P PPPP P PP PPP PP PPP P PP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPP---PPPPTDFAPPPPPPEPTSELPPP 325 Query: 877 PXPP 888 P PP Sbjct: 326 PPPP 329 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 4/61 (6%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPX----PPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PP P PP P PPP P PPPP PPP PPP PP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Query: 859 P 861 P Sbjct: 329 P 329 Score = 46.4 bits (105), Expect = 4e-05 Identities = 29/74 (39%), Positives = 29/74 (39%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP PPP PPPPP P PPP PPP PPP PP Sbjct: 269 PPIPSASQNATPPP------PPPPPSNTPGMFASSGFQPPP--PPPTDFAPPP--PP--- 315 Query: 808 XPPPXXXXPPXPPP 849 P P PP PPP Sbjct: 316 -PEPTSELPPPPPP 328 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXP---PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 PP P PPP P P P PPP PP P P P P PPP P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PPPP P PP P P PPP PPPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP---PPPP 329 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PP P PPPP PP P PPP PP P P PP P P Sbjct: 269 PPIPSASQNATPPPPP--PPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Query: 919 XPP 927 PP Sbjct: 327 PPP 329 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 7/62 (11%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPX-------PPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P PPPPP P P P P PP PPP P P PP P Sbjct: 270 PIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPP--PPP 327 Query: 814 PP 819 PP Sbjct: 328 PP 329 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P PP P PPP P PPPP P P P P P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 PP P PPP P PPPP P P P P PPP Sbjct: 286 PPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP----PXXPPPXPXXPPPXPXXP 978 PP PP PPP P P P P P P PPP P P P P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Query: 979 P 981 P Sbjct: 329 P 329 Score = 37.5 bits (83), Expect = 0.017 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P PP PP PP PPP PP P P P P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPP-----PPPPEPTSELP 323 Query: 940 PXPXXPPP 963 P P PPP Sbjct: 324 PPP--PPP 329 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP---XPXPPPP 983 P P PPPP PP P P PPP P PPPP Sbjct: 270 PIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPP 316 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 52.0 bits (119), Expect = 7e-07 Identities = 33/96 (34%), Positives = 33/96 (34%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G GGG G GGG GG GG GG G GG Sbjct: 156 GHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDGDDDGGDDDGV 215 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GGG GGG G G GG G Sbjct: 216 -VDNGDVVVDDGGGDDDGGGVNNGDVVVDDGGGGDG 250 Score = 46.8 bits (106), Expect = 3e-05 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 5/113 (4%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G G G GG G G G G GGG GG GGG G Sbjct: 140 GGGDNGGVVDV-VVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGG-DDGGGADGGGADGGD 197 Query: 761 GGXXGGGGXGXGGXGXGXGXGG-----GGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GG G G GG G G G GG G Sbjct: 198 DDGGDGDGDDDGGDDDGVVDNGDVVVDDGGGDDDGGGVNNGDVVVDDGGGGDG 250 Score = 45.2 bits (102), Expect = 8e-05 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GGG GG G G GG G GGG GG G GG G G GGG Sbjct: 137 GLVGGGDNGGVVDVVVEDDGH----GGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGG 192 Query: 689 GXXXXGXGG-GXGXXGXGXXGG 627 GG G G G G Sbjct: 193 ADGGDDDGGDGDGDDDGGDDDG 214 Score = 42.7 bits (96), Expect = 4e-04 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 7/112 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GG G G G GGG GG G G G GG GG G Sbjct: 142 GDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGG---ADGGGADGGDD 198 Query: 788 XGGGGXGXGGGXXGGGGXGXG----GXGXGXGXGGG---GGXXXXGXGGGXG 654 GG G G G G G G G GGG G GGG G Sbjct: 199 DGGDGDGDDDGGDDDGVVDNGDVVVDDGGGDDDGGGVNNGDVVVDDGGGGDG 250 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G G GG GG G G G G GGG G G G G GG Sbjct: 158 GGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDGDDDGG 210 Score = 36.7 bits (81), Expect = 0.029 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG--- 806 GG GG G G G G GGG GG G G G GGG G G Sbjct: 140 GGGDNGGVVDVVVEDDGHGGGDGGDDG-DGGGDDDDGGDGDGGGDDGGGADGGGADGGDD 198 Query: 805 XGGXGXG 785 GG G G Sbjct: 199 DGGDGDG 205 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG GGG G G G G GG G GGG G Sbjct: 178 GDGGGD-DGGGADGGGADGGDDDGGDGDGDDDGGDDDGVVDNGDVVVDDGGGDDDGGGVN 236 Query: 805 XGGXGXGXGG 776 G GG Sbjct: 237 NGDVVVDDGG 246 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 51.6 bits (118), Expect = 9e-07 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 11/115 (9%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXP-XPXPPXPXPP---------PPXXP-PPXPXP 777 P P P P PPP PPPP P P P PP P P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPAP 840 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P PP PP PP P P P PP PPP Sbjct: 841 APPITPDDTITRSAVHNLPPC-PPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPP 894 Score = 44.8 bits (101), Expect = 1e-04 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 17/110 (15%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXP------PPXPXPP-PPXXPPXXXXPPPXXXXPPXPPP 849 PPP P P P P PPPP P P P PP P P PP Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPAPAPP 843 Query: 850 XPPP----------XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P PP P P P PPP P Sbjct: 844 ITPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPP 893 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/116 (29%), Positives = 34/116 (29%), Gaps = 10/116 (8%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P PPPPP P PP P PP P P PP P P Sbjct: 781 PTTPPPEYPPPPPG-LARPNPPPPNPPLQVTSIPGE-PAPPFVKLIASAMAAAFPFPFNP 838 Query: 844 PPXPPPXPPPX----------PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P PP P P P P P P PP Sbjct: 839 APAPPITPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPP 894 Score = 42.7 bits (96), Expect = 4e-04 Identities = 38/130 (29%), Positives = 38/130 (29%), Gaps = 26/130 (20%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX-PXXXXPPPPPXPXPX-------------PXPPXPXPPPPX 753 PP PP P P PPP P P P P P P P P PP Sbjct: 785 PPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPAPAPPI 844 Query: 754 XP------------PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P PP P PP P P P P PPP PP P Sbjct: 845 TPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWP-PPPPPPATSNGDPSL 903 Query: 898 XXXPXXPXPP 927 P PP Sbjct: 904 LLTTNVPPPP 913 Score = 36.7 bits (81), Expect = 0.029 Identities = 30/115 (26%), Positives = 30/115 (26%), Gaps = 2/115 (1%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXP--PXXPXXXXXXXXXXXXXXXXPPXPXPX 797 PP PP P P P PP PP P P P P Sbjct: 785 PPEYPPPPPGLARPNPP-----PPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPA 839 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P P PP PP P P P P P PPP Sbjct: 840 PAPPITPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPP 894 Score = 36.3 bits (80), Expect = 0.038 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 5/81 (6%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXX-----PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P PP PP P P P P PPPP P Sbjct: 835 PFNPAPAPPITPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPP 894 Query: 796 PXXXXPPPXXXXPPXPPPXPP 858 P PPP P Sbjct: 895 ATSNGDPSLLLTTNVPPPPDP 915 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 831 PPPXXPXPPPXPPX--XPXPPPPXPPXXXXPXP-XPXPP 938 P P PP PP P PPPP PP P P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP P PPP P P P PP P P PP Sbjct: 781 PTTPP--PEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPP 961 P P P PPP P PP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +3 Query: 876 PXPPPPX--PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP PP P P PP P P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAP 818 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 51.6 bits (118), Expect = 9e-07 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 2/97 (2%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXX 750 G G GG G G GGG GG G G GG G GG G Sbjct: 189 GNSGYGGAAWPGGTAGNGATTADSNVSGGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGV 248 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G GG G G GGG G G G Sbjct: 249 GGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 47.6 bits (108), Expect = 2e-05 Identities = 32/95 (33%), Positives = 32/95 (33%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G GGG G G GG GG GG Sbjct: 189 GNSGYGGAAWPGGTAGNGATTADSNVSGGGGGGFYTDGQGSRNKGGSGGE---GGKAFLH 245 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G GGGG G G G G GGG Sbjct: 246 GGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGG 280 Score = 45.6 bits (103), Expect = 6e-05 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 3/89 (3%) Frame = -3 Query: 980 GGXXGXGG--GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G GG GG G GG G GG GG GG Sbjct: 200 GGTAGNGATTADSNVSGGGGGGFYTDGQGSRNKGGSGGEGGKAF-LHGGVGGRQFSSNSY 258 Query: 806 XXXGGXXGGGGXGX-GGGXXGGGGXGXGG 723 GG GGG G GGG GGGG GG Sbjct: 259 GGFGG--GGGACGCNGGGAGGGGGYSGGG 285 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG-XXGGXGGGXGXXGGG 830 GG GG G G GG G GGG G GG GGG G GGG Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGX----GGGXGXXGGGXXXX 818 GG G G GG G G G GG G GG GG G Sbjct: 200 GGTAGNGATTADSNVSGGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYG 259 Query: 817 GXXGXGGXGXGXGG 776 G G GG GG Sbjct: 260 GFGGGGGACGCNGG 273 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 51.6 bits (118), Expect = 9e-07 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 3/109 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP--XXXXPPP 819 P PP PP P P P P P P P P P PP P PP Sbjct: 393 PVEGFSPPDMVPMPGPPRPVPIPFPVPVNHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPP 452 Query: 820 XXXXPPXP-PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P PP P P P P P P P P PP Sbjct: 453 RVEHVPFPIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYPVPVPVRQPP 501 Score = 48.8 bits (111), Expect = 7e-06 Identities = 41/127 (32%), Positives = 41/127 (32%), Gaps = 11/127 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXPPXPXPP-PPXXPPPX---- 768 PP P P P P P P P PP P P P PP P P PP Sbjct: 399 PPDMVPM-PGPPRPVPIPFPVPVNHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEHV 457 Query: 769 PXPPPPXXPPXXXXPP-PXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P PP P P P PP P P P P P P P P P Sbjct: 458 PFPIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYPVPVPVRQPPMIQRFYYPVPVSRPGQ 517 Query: 943 XPXXPPP 963 P P Sbjct: 518 IHHIPYP 524 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/101 (31%), Positives = 32/101 (31%), Gaps = 6/101 (5%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPPXPPPXPPPXPPP 873 PP P P PP P P P P P PP P P P P PP Sbjct: 399 PPDMVPMPGPPRPVPIP--FPVPVNHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEH 456 Query: 874 XPXP-----PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P P P P P P P P P Sbjct: 457 VPFPIPVHSPPQIEKVP-IPFPYPVPSPPQIKPMPYPVPVP 496 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/127 (25%), Positives = 33/127 (25%), Gaps = 5/127 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-----PXPXPP 780 P PP P P P P P P P P P PP P P P Sbjct: 419 PVNHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEHVPFPIPVHSPPQIEKVPIPFPY 478 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP P P PP P P P P P P Sbjct: 479 PVPSPPQIKPMPYPVPVPVRQPPMIQRFYYPVPVSRPGQIHHIPYPIYIRGPAEVRHVPY 538 Query: 961 PXPXXPP 981 P P P Sbjct: 539 PVPIRSP 545 Score = 38.3 bits (85), Expect = 0.009 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 18/121 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP----- 780 P PP P P P P P P P P PP P P P P PP Sbjct: 447 PFHTPPRVEHVPFPIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYPVPVPVRQPPMIQRF 506 Query: 781 ----PPXXP--------PXXXXPPPXXXXPPXPPP-XPPPXPPPXPXPPPXXXXXPXXPX 921 P P P P P P P PP P P P P P Sbjct: 507 YYPVPVSRPGQIHHIPYPIYIRGPAEVRHVPYPVPIRSPPEQVPFPVPSPPEIFFQRVPV 566 Query: 922 P 924 P Sbjct: 567 P 567 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P PP P P PP P Sbjct: 415 PFPVPVNHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEHVPFPIPVHSPPQIEKVPI 474 Query: 960 PXPXPPP 980 P P P P Sbjct: 475 PFPYPVP 481 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PP P P P PP P P P PP Sbjct: 400 PDMVPMPGPPRPVPIPFPVPVNHPPRVEHVPFPVPVEGPP 439 Score = 31.9 bits (69), Expect = 0.82 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP--XPXPXPPXXPX 950 PP P P P P P PP P P P P P P PP Sbjct: 399 PPDMVPMPGPPRPVPIPFPVPV--NHPPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEH 456 Query: 951 XPPPXPXPPPP 983 P P P PP Sbjct: 457 VPFPIPVHSPP 467 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 51.2 bits (117), Expect = 1e-06 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG G G G G GGG G GGG GGG G G G G GG Sbjct: 400 GTSPSGGSSSGTGASSAGGSS----AGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGG 455 Query: 692 GGXXXXGXGGGXGXXGXG 639 G G G G G Sbjct: 456 AGGGGAGGGSTGGASSSG 473 Score = 47.2 bits (107), Expect = 2e-05 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G GG G G G G GG GGG G G G G G Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASGGGHKGAG----GGSAAGGGTGSGSTGNGNAGNG- 454 Query: 728 GGXGXGXGXGGGGGXXXXG 672 G G G G G GG G Sbjct: 455 GAGGGGAGGGSTGGASSSG 473 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG--GGXGXXGXGXXGGX 624 G G G GG G G G G G G GGG G G G G G G G GG Sbjct: 406 GSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGS 465 Query: 623 XGG 615 GG Sbjct: 466 TGG 468 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G GG G GG G G G G G G G G GG Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Query: 758 GXXGGGGXGXGGXG 717 G GG G G Sbjct: 460 GAGGGSTGGASSSG 473 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 GGG G GGG G G G G G GG GGG GGG G G Sbjct: 425 GGGHKGAGGGSAAG-GGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/82 (31%), Positives = 28/82 (34%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G GG G G GG G G G G G G GGG G G G Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASGG-GHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGG 458 Query: 632 GGXXGGXXXXXXXAXSXRSTWS 567 GG GG + S S+ S Sbjct: 459 GGAGGGSTGGASSSGSKSSSSS 480 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GG G G GG GG G GGG G G G G G G Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASG---GGHKGAGGGSAAGGGTGSGST---GNGNAGN 453 Query: 797 GGXXGGGGXGXGGGXXGG 744 GG GGG GGG GG Sbjct: 454 GGAGGGGA---GGGSTGG 468 Score = 41.9 bits (94), Expect = 8e-04 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXX 801 G G G GG G G G GGG GGG G G G G G GGG Sbjct: 405 GGSSSGTGASSAGGSSAGASG--GGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAG 462 Query: 800 XGGXXGGGGXG 768 G G G Sbjct: 463 GGSTGGASSSG 473 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGG 833 GG GGG G GG G G G G G G GG G G G GG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G GG G G Sbjct: 406 GSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGS 465 Query: 800 XGGXXGGG 777 GG G Sbjct: 466 TGGASSSG 473 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX--GXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGGGXXXXGX 812 G G GG G GG G G G GG G G G G GG G GG G Sbjct: 410 GTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGA 469 Query: 811 XGXG 800 G Sbjct: 470 SSSG 473 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG G G G G G GGG GG G G G G G G GG Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHKGA--GGGSAAGGGTGS--GSTGNGNAGNGGAGGGG 460 Query: 796 XGXGXGG 776 G G G Sbjct: 461 AGGGSTG 467 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 51.2 bits (117), Expect = 1e-06 Identities = 35/122 (28%), Positives = 35/122 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GG GG G G GG G G Sbjct: 285 GGSNGNPGVCNRAGGNYHGGVGAGWNGAGCNRTQNMHGEAGGARAQGWVGGRAGNMNSGY 344 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G GGG G G G G G GG G GGG G Sbjct: 345 NGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVT 404 Query: 620 GG 615 GG Sbjct: 405 GG 406 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 1/109 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGX-GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G G G G G G G G G G G GG G G G Sbjct: 304 GVGAGWNGAGCNRTQNMHGEAGGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGS 363 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GG GG G G G G G GG G G Sbjct: 364 EDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVTGGNSGREG 412 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXG-XXGGXGXGXGXXXXGGXGGGGXG--XXGGXGGGXGXXGGGXXXXG 815 GG G GG G G G GG GGGG G G GGG G GGG Sbjct: 325 GGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITW 384 Query: 814 XXGXGGXGXGXGG 776 GG G G Sbjct: 385 NQAGGGGGSYCAG 397 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/88 (29%), Positives = 26/88 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G GG G GG GG G G Sbjct: 325 GGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITW 384 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG G G G G G Sbjct: 385 NQAGGGGGSYCAGSSCKGVTGGNSGREG 412 Score = 35.5 bits (78), Expect = 0.067 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 8/67 (11%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGX--------GGGXGXXGGGXXXXGXXG 806 GG G GG G G G G GGG G GG GGG G G G G Sbjct: 346 GGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVTG 405 Query: 805 XGGXGXG 785 G Sbjct: 406 GNSGREG 412 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGGG G G GG G GGGG G G GG G Sbjct: 357 GGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG-SSCKGVTGGNSGREG 412 Score = 32.7 bits (71), Expect = 0.47 Identities = 32/111 (28%), Positives = 32/111 (28%), Gaps = 1/111 (0%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGX 771 G GGG GG G GGG G G G G GG Sbjct: 231 GTGGG--GGSFVYTSAGVLLVAAGGGGGGSSGFKGVDGQATENGAASKGRLSYSRAGGSN 288 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GG GG G G G G G G G GG G Sbjct: 289 GNPGVCNRAGGNYHGGVGAGWN-GAGCNRTQNMHGEAGGARAQGWVGGRAG 338 Score = 31.9 bits (69), Expect = 0.82 Identities = 31/125 (24%), Positives = 31/125 (24%), Gaps = 4/125 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXG---XXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG-XGXXGGGXXXX 818 GGGGG G G G G G G G GG G G G Sbjct: 253 GGGGGSSGFKGVDGQATENGAASKGRLSYSRAGGSNGNPGVCNRAGGNYHGGVGAGWNGA 312 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXG 638 G GG G GG G GG G G G Sbjct: 313 GCNRTQNMHGEAGGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGG 372 Query: 637 GXXGG 623 G G Sbjct: 373 GGYSG 377 Score = 31.5 bits (68), Expect = 1.1 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG----GXGXXGGXG----GGXGXXGGG 830 GG G G G G G G GG G GG GG G GGG Sbjct: 303 GGVGAGWNGAGCNRTQNMHGEAGGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGG 362 Query: 829 XXXXGXXGXGGXGXGXG 779 G G GG G G Sbjct: 363 SEDNGASGGGGGYSGGG 379 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/32 (62%), Positives = 20/32 (62%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PPPP P P P P P PPPP PPP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPP--PPPPPPPPTP 1186 Score = 49.2 bits (112), Expect = 5e-06 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PPPPP P P P P P PPPP PPP P P Sbjct: 1158 PPPPPPPPPPPSSPSP-PPPPPPPPPPPTP 1186 Score = 48.0 bits (109), Expect = 1e-05 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PPPP P P P PPPP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 PPP P PPPPP P P PP P PPPP P Sbjct: 1157 PPPPPP---PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P PP P P P PPP P PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXP 923 PP P PPP PP P PPPP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 46.4 bits (105), Expect = 4e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P PPPP PPP PP PPP PPP P P Sbjct: 1157 PPPPPPPPP--------PPPSSPSPPPPPPPPPPPPTP 1186 Score = 46.4 bits (105), Expect = 4e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPP PP PPP P PPP PPP PPP P Sbjct: 1157 PPPPPPP----PPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 46.4 bits (105), Expect = 4e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PPP PPP PP P PPP P PP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPP--------PPPPPPPPPTP 1186 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P PPP P PPPP P P P PP P PPP Sbjct: 1157 PPPPPPPP---PPPPSSPSPPPPPPPPPPPP 1184 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PPPP PP P PPPP PP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP---PPPP 1184 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PPPP P P PPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 44.8 bits (101), Expect = 1e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPP PP PP P P PPP P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP 899 P PP P P PPP P PPP PP P PPPP P Sbjct: 1157 PPPPPPPPP----PPPSSPSPPPPPP--PPPPPPTP 1186 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P PPP P P PP P PP PP P Sbjct: 1157 PPPPP---PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 43.6 bits (98), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P P PPP P PPPPP P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 43.6 bits (98), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P P PPP P P PPP P P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP 714 PP PP P P P PPP P PPPPP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP----PPPPPPPTP 1186 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PPP P PPPP P PPP PP PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPP----PPPPPPTP 1186 Score = 42.7 bits (96), Expect = 4e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 PPP P PPP P P PPPP PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PPPP PP P P P PP P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPP--PPPPPPTP 1186 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PPPP PP P P P PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 734 PXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PPPP PPP P P P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 PP PP P P P PPPPP PP P Sbjct: 1157 PPPPPPPP-----PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP 704 P PP PP P P P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PPP P PP PP P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEP 290 Query: 874 XPXP 885 P P Sbjct: 291 EPEP 294 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P PP P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLP---PRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPE----PE 283 Query: 841 PPPXPPPXPPPXPXPPP 891 P P P P P P P P Sbjct: 284 PEPEPEPEPEPVHVPEP 300 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PP PP P P P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPE--PERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEP 288 Query: 892 XXXXXPXXPXPP 927 P P Sbjct: 289 EPEPEPVHVPEP 300 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +1 Query: 757 PPPXPXP---PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PPP P PP PP P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEP-EPEPE 289 Query: 928 XXPPPXPXXPP 960 P P P Sbjct: 290 PEPEPVHVPEP 300 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXP 777 PP P P P P P P P P P P P P P P P P P P P P P Sbjct: 246 PPRQPVAEPEPERQPEPEPEPEQE-PEPEPEPEPEPEPEPEPEPEPEPEPVHVPEP 300 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P P PP P P P P P P P P P P P P P P P Sbjct: 232 PPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPE 291 Query: 823 XXXPPXPPP 849 P P Sbjct: 292 PEPVHVPEP 300 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPP 783 PP P P P P P P P P P P P P P P P P P P P Sbjct: 241 PPAKLPPRQPVAEPEPERQ-PEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP 292 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PPP P PP P P P P P P P P P P P P P P P Sbjct: 231 PPPV--PQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEP-EPEPEPEPEPEP-EP 286 Query: 958 PPXPXXPP 981 P P P Sbjct: 287 EPEPEPEP 294 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 PP P P PP P P P P P P P P P P P P Sbjct: 232 PPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPE 291 Query: 916 PXPPXXPPP 942 P P P P Sbjct: 292 PEPVHVPEP 300 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP P P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAE---PEPERQPEPEPEPEQEPEPE-PEPEPEPEPEPEP 286 Query: 796 PXXXXPPPXXXXPP 837 P P P Sbjct: 287 EPEPEPEPVHVPEP 300 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 5/71 (7%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP-----PXPPXXXXPXPXPXPPXXPX 950 P P P P PP P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPP-RQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPE 289 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 290 PEPEPVHVPEP 300 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXXPP---PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP P PP P P P P P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEP-EPEPEPEPEPEP- 288 Query: 952 XPPPXPXXPP 981 P P P P Sbjct: 289 EPEPEPVHVP 298 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP P P P PP PP P P P PP P PP PP Sbjct: 597 PPEPFELRKALPKHESPSPPSRVPPQPETAPKPFP--NITPPEVRPSLPGTPPETKTKPP 654 Query: 871 PXPXPP---PXXXXXPXXPXPPXXPPP 942 P PP P P P P PPP Sbjct: 655 LAPYPPKTSPKTTPKPHIPPAPSRPPP 681 Score = 48.4 bits (110), Expect = 9e-06 Identities = 30/92 (32%), Positives = 30/92 (32%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P P P P P P P P P P PP P PP P Sbjct: 597 PPEPFELRKALPKHESPSPPSRVP-PQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPL 655 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PP P P P P P PP PP Sbjct: 656 APYPPKTSP-KTTPKPHIPPAPSRP-PPQLPP 685 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +1 Query: 631 PXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P PP P P P P P P PP P P PP P Sbjct: 608 PKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTT 667 Query: 808 XPPPXXXXPPXPPPXPPP 861 P P PPP PP Sbjct: 668 PKPHIPPAPSRPPPQLPP 685 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 6/85 (7%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXP-PXPXP--PPPXXPPPXPXPPP--PXXPPXXXXPPPXXXXPP 837 P P PP P P P P P PP P P PP PP PP Sbjct: 608 PKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTT 667 Query: 838 XPPPXPP-PXPPPXPXPPPXXXXXP 909 P PP P PP PP P Sbjct: 668 PKPHIPPAPSRPPPQLPPEASKAVP 692 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP-XPPPXXXXXPXXPXPPXXPPPXPXXP--PP 963 PP P P P P PP P P PP P P PP P P PP Sbjct: 615 PPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPP 674 Query: 964 XPXXPP 981 P PP Sbjct: 675 APSRPP 680 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P PP P P P P P PP P PPP P Sbjct: 627 PKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHI--PPAPSRPPPQLP 684 Query: 796 P 798 P Sbjct: 685 P 685 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXP---PPP 786 P P P P P P PP P PP PP P PP P P P Sbjct: 613 PSPPSRVPPQPETAPKPFP--NITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKP 670 Query: 787 XXPPXXXXPPP 819 PP PPP Sbjct: 671 HIPPAPSRPPP 681 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP P P P P P P PP PP P P Sbjct: 613 PSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPP 660 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +3 Query: 777 PPXPXPXP-PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPX 950 PP P P P P PP P P PP PP P P P P P P Sbjct: 620 PPQPETAPKPFPNIT----PPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPA 675 Query: 951 XPPPXPXPPP 980 P P PP Sbjct: 676 PSRPPPQLPP 685 Score = 35.5 bits (78), Expect = 0.067 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 6/75 (8%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPX--PPPXPPXXPXPPPPX---PPXXXXPXPXPXPPX 941 P P PP P P P PP P P PP PP P P P Sbjct: 608 PKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYP-PKTSPKT 666 Query: 942 XPXXP-PPXPXPPPP 983 P PP P PPP Sbjct: 667 TPKPHIPPAPSRPPP 681 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPX-PPXXPXPPPPXP---PXXXXPXPXPXPPXXPXXPPPX 965 PP P P P PP PP P P P P P PP PP Sbjct: 597 PPEPFELRKALPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLA 656 Query: 966 PXPP 977 P PP Sbjct: 657 PYPP 660 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P PP P PP P P P PP P P P P Sbjct: 635 PPEVRPSLPGTP-PETKTKPPLAPYPPKTSPKTT-PKPHIPPAPSRPPPQLPPEASKAVP 692 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 1/58 (1%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP-XPPXXPPPXPXXPPPXPXXPP 981 PP P P PP P P P PP P P PP PP Sbjct: 597 PPEPFELRKALPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPP 654 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.8 bits (116), Expect = 2e-06 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 6/123 (4%) Frame = +1 Query: 628 PPXXPXPXXPXP----PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 20 PQTTPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTP 79 Query: 796 -PXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P Sbjct: 80 TPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPKTPTPTTPTPTA 139 Query: 970 XXP 978 P Sbjct: 140 HTP 142 Score = 41.5 bits (93), Expect = 0.001 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 4/122 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXP-PPXPXPPPPX 789 P P P P P P P P P P P P P P P P P Sbjct: 26 PTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPT 85 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP-PXXPPPXPXXP-PP 963 P P P P P P P P P P P P P P Sbjct: 86 PTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPKTPTPTTPTPTAHTPTTP 145 Query: 964 XP 969 P Sbjct: 146 TP 147 Score = 37.5 bits (83), Expect = 0.017 Identities = 25/103 (24%), Positives = 25/103 (24%), Gaps = 2/103 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXX 828 P P P P P P P P P P P P P P Sbjct: 5 PTAPTLTTPTLTKATPQTTPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAP 64 Query: 829 XPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P Sbjct: 65 TQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTP 107 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/99 (24%), Positives = 24/99 (24%), Gaps = 3/99 (3%) Frame = +3 Query: 696 PPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXX 875 P P P P P P P P P P P P P P Sbjct: 29 PTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTT 88 Query: 876 PX---PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P Sbjct: 89 STLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTP 127 Score = 35.5 bits (78), Expect = 0.067 Identities = 20/80 (25%), Positives = 20/80 (25%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P Sbjct: 5 PTAPTLTTPTLTKATPQTTPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAP 64 Query: 919 XPPXXPPPXPXXPPPXPXXP 978 P P P P P Sbjct: 65 TQTTPTPATPTPTTPTPKTP 84 Score = 33.5 bits (73), Expect = 0.27 Identities = 28/120 (23%), Positives = 28/120 (23%), Gaps = 2/120 (1%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPXPXP 800 P P P P P P P P P P P Sbjct: 24 PTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKT 83 Query: 801 PXPXXPXXXXPPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P P P P P P P P P P P P P Sbjct: 84 PTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPKTP-TPTTPTPTAHTP 142 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXP--PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P P P P P P Sbjct: 24 PTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTP 76 Score = 31.9 bits (69), Expect = 0.82 Identities = 22/94 (23%), Positives = 22/94 (23%), Gaps = 1/94 (1%) Frame = +3 Query: 696 PPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPP-PXXPXPPPXPPX 872 P P P P P P P P P P P P P Sbjct: 54 PTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPT 113 Query: 873 XPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P Sbjct: 114 TPTPTAHTPTKPTPKTPTPTTPTPTAHTPTTPTP 147 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/82 (23%), Positives = 19/82 (23%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXX 903 P P P P P P P P P P P P P Sbjct: 5 PTAPTLTTPTLTKATPQTTPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAP 64 Query: 904 XPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P Sbjct: 65 TQTTPTPATPTPTTPTPKTPTP 86 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P P P P P P Sbjct: 20 PQTTPTPTKPT-PTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTT 78 Query: 960 PXPXPPPP 983 P P P P Sbjct: 79 PTPKTPTP 86 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/69 (24%), Positives = 17/69 (24%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P P P P P P Sbjct: 69 PTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPK 128 Query: 957 PPXPXPPPP 983 P P P P Sbjct: 129 TPTPTTPTP 137 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 50.8 bits (116), Expect = 2e-06 Identities = 30/86 (34%), Positives = 30/86 (34%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GG GG G GGG G G GGG G G G G G G Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNG 615 Query: 692 GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G Sbjct: 616 GDDDYNG-GDGDSNGGDGGDNGTGDG 640 Score = 49.2 bits (112), Expect = 5e-06 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG G GG GG G G GGGG G G G G G G Sbjct: 558 GGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDD-GGGGDGDYNGGDGDYNGGDGDYNGG 616 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G G G GG Sbjct: 617 DDDYNGGDGDSNGGDGGDNGTGDG-DGDYNGG 647 Score = 48.0 bits (109), Expect = 1e-05 Identities = 30/93 (32%), Positives = 30/93 (32%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G G G G GGG G GG GG G Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNG- 615 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G G GG G G G G G GG Sbjct: 616 -GDDDYNGGDGDSNGGDGGDNGTGDGDGDYNGG 647 Score = 47.6 bits (108), Expect = 2e-05 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 2/94 (2%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG G GG G G G G GG GG G GG G Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGD---GDYNGGDGDY 613 Query: 767 XGGGXX--GGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GG G GG G G G G G G Sbjct: 614 NGGDDDYNGGDGDSNGGDGGDNGTGDGDGDYNGG 647 Score = 45.6 bits (103), Expect = 6e-05 Identities = 27/88 (30%), Positives = 27/88 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GGG G G G G GG G GG GG Sbjct: 560 GGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDD 619 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G G G GG G G G G Sbjct: 620 YNGGDGDSNGGDGGDNGTGDGDGDYNGG 647 Score = 45.2 bits (102), Expect = 8e-05 Identities = 32/93 (34%), Positives = 32/93 (34%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G G GGG G G G GGG G GG G GG Sbjct: 556 GGGGGGDYNGG----DGDDDDGGGGGDDDDGDGDGDDDDDGGG--GDGDYNGGDGDYNGG 609 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG G G GG GG G G G Sbjct: 610 DGDYNGGDDDYNGGDGDSNGGDGGDNGTGDGDG 642 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX--GXGGGXXGG 744 G G G G GG GG G G G G GG G G G GG Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGG 616 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG G G GG G G G Sbjct: 617 DDDYNGGDGDSNGGDGGDNGTGDGDGDYNG 646 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GGG G G G GG G G G GG G GG G Sbjct: 565 GGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDDYN-GG 623 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 624 DGDSNGGDGG 633 Score = 36.3 bits (80), Expect = 0.038 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXG--XGXGXXXXGGXG--GGGXGXXGGXGGGXGXXGGG 830 GGGG GG GG G G GG G GG G G G G G GG Sbjct: 592 GGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNGGDGGDNGTGDGDGDYNGG 647 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 50.8 bits (116), Expect = 2e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP--PXPPPXPXPPPXXXXX 906 P PPPP PPP P PP P P P P P PP PP P P P P Sbjct: 1660 PAPPPP--PPPAPGPPGPDGP--MGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Query: 907 PXXPXPPXXPPPXPXXPPP 963 P P P P PP Sbjct: 1716 PGRDGPMGPPGPSGGQGPP 1734 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/76 (36%), Positives = 28/76 (36%), Gaps = 4/76 (5%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP-XPPPPXXPPXXXXP---PPXXXX 831 P P P PPP P P P PP P P P P P P PP P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGA 1711 Query: 832 PPXPPPXPPPXPPPXP 879 P PP P PP P Sbjct: 1712 PAGPPGRDGPMGPPGP 1727 Score = 43.6 bits (98), Expect = 3e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP-XPPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P P PPP P PP P P P P P P P PP P P P P Sbjct: 1660 PAPPPP-PPPAP---GPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Query: 817 PXXXXPPXPP-PXPPPXPP 870 P P PP P PP Sbjct: 1716 PGRDGPMGPPGPSGGQGPP 1734 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 1/87 (1%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P PPP PP P P P P P P P P PP P Sbjct: 1652 PWYPVFHYPAPPPP----PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPG 1707 Query: 811 PPPXXXXPP-XPPPXPPPXPPPXPXPP 888 P PP P PP P PP Sbjct: 1708 YPGAPAGPPGRDGPMGPPGPSGGQGPP 1734 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P PPP PP P PP P P P P P PP P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 41.9 bits (94), Expect = 8e-04 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P P P P P PPP PP P P PP PP P P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP----QGIPG 1707 Query: 913 XPXPPXXPP--PXPXXPP 960 P P PP P PP Sbjct: 1708 YPGAPAGPPGRDGPMGPP 1725 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P PP P P P P P P P PP PP P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGP---MGLPGPQGPDGP-KGPPGPPGLPGPQGIPGYPGAPAGP 1715 Query: 957 PPXPXPPPP 983 P P P Sbjct: 1716 PGRDGPMGP 1724 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/102 (26%), Positives = 27/102 (26%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P PP P P P PP P P P P P PP Sbjct: 1790 PQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P PP PP P P P Sbjct: 1850 GAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGPAGIPGIPGP 1891 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXPXX 953 PP P P PP P P P P P P PP P P P P P P Sbjct: 1665 PPPPAPGPPGPDGPMGL-PGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPMG 1723 Query: 954 PP-PXPXPPPP 983 PP P PP Sbjct: 1724 PPGPSGGQGPP 1734 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P PP P PP P PP P PP P P P P PP Sbjct: 1790 PQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PP P P PP P P P P P PP P P P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMG-LPGPQGPDGPKGPPGPPGLPGP 1702 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 1/75 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP-XPXPPPPXXPPPXPXPPPPXX 792 P PP P P P P P P P P PP P P P P PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRD 1719 Query: 793 PPXXXXPPPXXXXPP 837 P P PP Sbjct: 1720 GPMGPPGPSGGQGPP 1734 Score = 35.5 bits (78), Expect = 0.067 Identities = 32/114 (28%), Positives = 32/114 (28%), Gaps = 2/114 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P PP P P P P PP PP P P Sbjct: 1784 PPGLAGPQGPKGMPGP-----PGPPGP-PGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPK 1837 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP--XXPPPXPXXPPP 963 P P P P P PP P P P P P P Sbjct: 1838 GWPGVPGPPGPPGAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGPAGIPGIPGP 1891 Score = 35.5 bits (78), Expect = 0.067 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P PP P PP P P P P P P P P P Sbjct: 1785 PGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPG 1844 Query: 972 PPPP 983 PP P Sbjct: 1845 PPGP 1848 Score = 32.7 bits (71), Expect = 0.47 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 4/90 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXX-XXPPPPPXP-XPXPXPPXPXPP-PPXXPPPXPXPPPP 786 PP P P P P PP PP P P P P PP PP P P Sbjct: 1802 PPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAYGWKGYPGNP 1861 Query: 787 XXPP-XXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P P Sbjct: 1862 AGPPGRDGIPGPPGRQGGKGPAGIPGIPGP 1891 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P PP P P P PP PP P P P P PP Sbjct: 1815 PGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAYGWKGYPGNPAGPPGRDGIPGPP 1874 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 10/78 (12%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXX----- 944 P P P PP P P P PP P PP P P P P P Sbjct: 1797 PGP-PGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAYGWK 1855 Query: 945 -----PXXPPPXPXPPPP 983 P PP P P Sbjct: 1856 GYPGNPAGPPGRDGIPGP 1873 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P PP P P P P PP P P P P P P P Sbjct: 1828 PGPPGPQGPKGWPGVPGPPGPPGAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGPAGIPG 1887 Query: 972 PPPP 983 P P Sbjct: 1888 IPGP 1891 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 PP P P P P PP P P PP PP P P P Sbjct: 1784 PPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPG--PPGPQGPKGWPG 1841 Query: 973 XP 978 P Sbjct: 1842 VP 1843 >SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) Length = 404 Score = 50.8 bits (116), Expect = 2e-06 Identities = 42/126 (33%), Positives = 42/126 (33%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG--GXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G G G G G G GG G G G G Sbjct: 162 GIGEYGTGLGGTKGMGEYGTGLAGTKGIGEHGTGLAGTKGMGGNKGIGEHGTGLGGNKGI 221 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXX 633 G GG G G G GG G G G G G G G G GG G G G G Sbjct: 222 GEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLG 281 Query: 632 GGXXGG 615 G G Sbjct: 282 GNKGKG 287 Score = 50.8 bits (116), Expect = 2e-06 Identities = 40/112 (35%), Positives = 40/112 (35%), Gaps = 3/112 (2%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G G G G G G G GG G G G G GG G GG G Sbjct: 188 GIGEHGTGLAGTKGMGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGI 247 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXXG 630 G G G G G G G G G G G G G GG G G G G G Sbjct: 248 GEYGTGLG----GNKGIGEYGTGLGGNKGIGEHGTGLGGNKGKGEYGTGLGG 295 Score = 49.6 bits (113), Expect = 4e-06 Identities = 47/133 (35%), Positives = 47/133 (35%), Gaps = 11/133 (8%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGG---XXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGG 813 GG G G G GG G G G G G GG G G G G GG G Sbjct: 216 GGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLGGNKGIGE 275 Query: 812 GXXXXGGXXGGG--GXGXGGG----XXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXG 654 GG G G G G GG G G G G G G G G G G G G G Sbjct: 276 HGTGLGGNKGKGEYGTGLGGNKGKCEYGTGLAGNKGIGEHGTGLAGNKGIGEYGTGLG-G 334 Query: 653 XXGXGXXGGXXGG 615 G G G GG Sbjct: 335 NKGKGEYGTGLGG 347 Score = 48.4 bits (110), Expect = 9e-06 Identities = 41/121 (33%), Positives = 41/121 (33%), Gaps = 4/121 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGGXXXXGGGXX 804 GG G G G GG G G G G G G G GG G G G G Sbjct: 41 GGNKGKGEYDTGLGGNK--GIGEYGTGLAGNKGIGEYGTGLGGNKGIGEYGTGLAGNKGI 98 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXX 633 G GG G G G GG G G G G G G G G G G G G Sbjct: 99 GEYGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLAGNKGMGEYGTGLAGNKGIGEHGTGLA 158 Query: 632 G 630 G Sbjct: 159 G 159 Score = 48.4 bits (110), Expect = 9e-06 Identities = 41/121 (33%), Positives = 41/121 (33%), Gaps = 4/121 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG-GXGGGXGGGXGGXXXXGGGXX 804 GG G G G GG G G G G G G G GG G G G G Sbjct: 203 GGNKGIGEHGTGLGGNK--GIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGI 260 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXX 633 G GG G G G GG G G G G G G G G G G G G Sbjct: 261 GEYGTGLGGNKGIGEHGTGLGGNKGKGEYGTGLGGNKGKCEYGTGLAGNKGIGEHGTGLA 320 Query: 632 G 630 G Sbjct: 321 G 321 Score = 47.2 bits (107), Expect = 2e-05 Identities = 41/121 (33%), Positives = 41/121 (33%), Gaps = 5/121 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G G G G GG Sbjct: 149 GIGEHGTGLAGNKGIGEYGTGLGGTKGMGEYGTGLAGTKGIGEHGTGLAGTKGMGGNKGI 208 Query: 800 XGGXXG-GGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXX 633 G GG G G G GG G G G G G G G G GG G G G G Sbjct: 209 GEHGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLG 268 Query: 632 G 630 G Sbjct: 269 G 269 Score = 46.0 bits (104), Expect = 5e-05 Identities = 39/123 (31%), Positives = 39/123 (31%), Gaps = 2/123 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G G G G G G G Sbjct: 268 GGNKGIGEHGTGLGGNKGKGEYGTGLGGNKGK-CEYGTGLAGNKGIGEHGTGLAGNKGIG 326 Query: 800 XGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG-XXGG 627 G GG G G G GG G G G G G G G GG G G GG Sbjct: 327 EYGTGLGGNKGKGEYGTGLGGNKGIGEHGTGLAGNKGKGEYGTGLGGNKGIDEYGTGLGG 386 Query: 626 XXG 618 G Sbjct: 387 NKG 389 Score = 45.6 bits (103), Expect = 6e-05 Identities = 36/109 (33%), Positives = 36/109 (33%), Gaps = 1/109 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX-GGGXGGXXXXGGGXXX 801 G G G G G G G G G G GG G G G G GG G Sbjct: 298 GKCEYGTGLAGNKGIGEHGTGLAGNKGIGEYGTGLGGNKGKGEYGTGLGGNKGIGEHGTG 357 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G G G G G G G G G G G G GG G Sbjct: 358 LAGNKGKGEYGTGLG----GNKGIDEYGTGLGGNKGKGEYGTGLGGNKG 402 Score = 44.8 bits (101), Expect = 1e-04 Identities = 41/123 (33%), Positives = 41/123 (33%), Gaps = 6/123 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG---GXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGG 813 GG G G G GG G G G G G G G G G G GG G Sbjct: 281 GGNKGKGEYGTGLGGNKGKCEYGTGLAGNKGIGEHGTGLAGNKGIGEYGTGLGGNKGKGE 340 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXG 639 GG G G G G G G G G G G G G GG G G G G Sbjct: 341 YGTGLGGNKGIGEHGTGLA----GNKGKGEYGTGLGGNKGIDEYGTGLGGNKGKGEYGTG 396 Query: 638 XXG 630 G Sbjct: 397 LGG 399 Score = 44.0 bits (99), Expect = 2e-04 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 6/113 (5%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGG---GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX 765 G G G GG G G G GG G G G G G GG G Sbjct: 26 GLGGNKGIGEYGTGLGGNKGKGEYDTGLGGNKGIGEYGTGLAGNKGIGEYGTGLGGNKGI 85 Query: 764 GGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXXGGXXGG 615 G G G G G G G G G G G GG G G G G G G Sbjct: 86 GEYGTGLAGNKGIGEYGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLAGNKGMG 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 42/123 (34%), Positives = 42/123 (34%), Gaps = 5/123 (4%) Frame = -3 Query: 968 GXGG--GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGGXXXX 798 G GG G G G G G GG G G G G G G G G G Sbjct: 26 GLGGNKGIGEYGTGLGGNKGKGEYDTGLGGNKGIGE-YGTGLAGNKGIGEYGTGLGGNKG 84 Query: 797 GGXXGGGGXGXGG-GXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G G G G G G G G G G G G G GG G G G G G G G Sbjct: 85 IGEYGTGLAGNKGIGEYGTGLGGNKGIGEYGTGLGGNKGIGEYGTGLA-GNKGMGEYGTG 143 Query: 623 XGG 615 G Sbjct: 144 LAG 146 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPP-PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P PP PP P PPP PP PPP PP PPP PP P Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPT---PPPTE--PPTPPPTDPPTQP 1059 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P P PP P P PPP P P P P PPP PP P Sbjct: 1009 PGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P P PP P PPP PP PPP PP PPP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPP--TEPPTPPPTEPPTPPPTDPP 1056 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P PP P P PP PP P PP P PPP PP Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDP---PTPPPTEPPTP--PPTEPPTPPPTDPP 1056 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPP--XPXPPPXXXXXPXXPXPPXXP 936 P P PP PP PP PPP P PPP P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P PP PP P PP P PPP P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P PPP PP P PP PP P Sbjct: 1009 PGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P PP P PP P PPP P PP Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 835 PXPPPXPPPXPPPX--PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP PP P PPP P P P P P P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPP---TEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P P P PP P P P P PPP PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPX-PPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P PP PP P PPP PP P P P P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPP---TPPPTEPPTPPPTDPPTQP 1059 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP PP P P PP P PP PP P P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P PP P PP PP P PP PP P PP P Sbjct: 1018 PLPTDPPTEPPTDPPTPP--PTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P PPP P P P PP P P Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 35.5 bits (78), Expect = 0.067 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP-PXPXXPP 981 P P P P PP P P P P P P PP P P PP Sbjct: 1016 PDPLPTDPPTEPPTD---PPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GGG G GGGG GG GG G G G GGGG Sbjct: 802 GGMGMSGGGSM---GAHGGGGMAGGGSSMGGAGSTVHG---GLDMDGGGG 845 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -1 Query: 976 GGXGX-GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GG G GGG G GG G G GG G G GGG Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGG 844 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GG G GG G GGG G GG G GG GG G G Sbjct: 802 GGMGMSGGGSMGAHG--GGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG--XGGGXGXXG 645 GG G GG G G G G G GG G G GG G G Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 785 GGGGXGXGG--GXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXG 654 GG G GG G GGGG GG G G GG G GG G Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG G GGG G GG G G GG GG G G Sbjct: 808 GGGSMGAHGGGGMAG--GGSSMGGAGSTVHGGLDMDGGGGVIG 848 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G GG GG GG GGG G G GG G G G Sbjct: 802 GGMGMSGGGSMGAHGG----GGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 >SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) Length = 277 Score = 50.4 bits (115), Expect = 2e-06 Identities = 38/122 (31%), Positives = 38/122 (31%), Gaps = 5/122 (4%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP-----PPPXXPPPXPXPPPPXXP 795 P P P P PP P P P P P P P P P P P P Sbjct: 105 PLHPSPLPATSIPPSRYIHPPSPLHPSPLPATSIPPSRYIHLPFPIHPSPFPLHPSPL-- 162 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P PP PP P P P P PP P P P P P PP Sbjct: 163 PATSIPPSRYIHPPFPLH---PSPLPATSIPPSRYIHPPFPLHP-SPLPATSIPPSRYIH 218 Query: 976 PP 981 PP Sbjct: 219 PP 220 Score = 48.8 bits (111), Expect = 7e-06 Identities = 37/114 (32%), Positives = 37/114 (32%), Gaps = 7/114 (6%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP---PXXXXPPPXXXX 831 P P P PP P P P P P P PP P P P PP Sbjct: 86 PSPLPATSIPPSRYIHLPFPLHPSPLPATSIPPSRYIHPPSPLHPSPLPATSIPPSRYIH 145 Query: 832 PPXP-PPXP-PPXPPPXPXP--PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P PP P P P P P PP PP Sbjct: 146 LPFPIHPSPFPLHPSPLPATSIPPSRYIHPPFPLHP-SPLPATSIPPSRYIHPP 198 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/94 (31%), Positives = 30/94 (31%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P PP P P P P P PP P P P P Sbjct: 78 PNPRPTLHPSPLPATSIPPSRYIHLPFPLHPSPL--PATSIPPSRYIHP--PSPLHPSPL 133 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P P P P P Sbjct: 134 PATSIPPSRYIHLPF----PIHPSPFPLHPSPLP 163 Score = 41.9 bits (94), Expect = 8e-04 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 4/117 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP---XPPPPXXPPPXPXPP-PPXXPPXXX 807 P P PP P P P P P PP P P P P PP Sbjct: 88 PLPATSIPPSRYIHLPFPLHPSPLPATSIPPSRYIHPPSPLHPSPLPATSIPPSRYIHLP 147 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P PP P P P P PP PP P P Sbjct: 148 FPIHPSPFPLHPSPLPATSIPPSRYIHPPFPLHP-SPLPATSIPPSRYIHPPFPLHP 203 Score = 39.5 bits (88), Expect = 0.004 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 1/110 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP-XX 792 PP P P P P P PP P P P P P P P PP Sbjct: 117 PPSRYIHPPSPLHPSP--LPATSIPPSRYIHLPFPIHPSPFPLHPSPLPATSIPPSRYIH 174 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P P P P PP P P P PPP Sbjct: 175 PPFPLHPSP---LPATSIPPSRYIHPPFPLHPSPLPATSIPPSRYIHPPP 221 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GGG GG GGG G GG GG G G GG G G G GGGG Sbjct: 92 GGGGSQGGGYRSGGG-GYGGSSRGGYGGGRGGGGYGGGRGGGG 133 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG GGG GG GG G GG GGGG G GG G G GGG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYG-GGRGGGGSYGGG 138 Score = 48.4 bits (110), Expect = 9e-06 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GG GGG G G G G G G GG GG GGG GG GGG GG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGG---GGYGGGRGGGGSYGGGRRDYGG 144 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/56 (48%), Positives = 27/56 (48%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GGG GGG G GGG GG G G GG GGG G GG GGG GG Sbjct: 92 GGGGSQGGGYRSG-GGGYGGSSRGGYGGGRGGGGYGGGRGG--GGSYGGGRRDYGG 144 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGGG GG GGGG G G G G G GGG G GGG G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRG-GYGGGRGGGGYGGGRGGG-GSYGGG 138 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG GG GGG G GG G G GGG GGG G G G G GG Sbjct: 92 GGGGSQGGGYRSGGGGYG-GSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGG GGG GG G GG GGGG G GG GGG G GGG G Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYG--GGRGGG-GSYGGGRRDYG 143 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G GG GGG G GG GG G G GG G GGG GGG G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGY----GGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GGG G GGG GG GGG GG GGG GGG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGR--GGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GGG GG GGG GG GGG G GGG GGG GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGR--GGGRGYGGGRGGGGRRDYGG 351 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G GG GGG GG GG GG GG GG GGGG GG Sbjct: 89 GERGGGGSQG-----GGYRSGGGGYGGSSRGGYGGGRGGGG----YGGGRGGGGSYGGGR 139 Query: 755 XXGGG 741 GG Sbjct: 140 RDYGG 144 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG GGG GGG GG G G G G G GGG GGG G Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -1 Query: 985 GGGGGXGXG--GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG G G G G G G G GG GGG G G GGG GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GGG GG GGG G GGG GG G G G G G GGG Sbjct: 312 GGGRG--GGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/42 (54%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGG-GGXXXXGXGGG 660 GGG G G GGGG G GG G G G GGG GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYG-GGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXG------GGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G GG GGG GGG G GGG G GG G G G GG G GG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGG GGG GG G G GG G G G G G G G GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 890 GGGXGXG--GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G G G GGG GGG GG GGG G GGG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GGG GG G G G GGG G GGG G G G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GGG GGG G GG GGG GG GGG G GG GGG G Sbjct: 312 GGGRGGGYRSGGGGG--YGGG--RGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG GG G GGG G G G GGG GG GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGG--GGRRDYGGG 352 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = -3 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG--XXGGXXXXXXXAXS 585 G GGGG GG G G GG G G G G G G GG GG + S Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGGASIS 148 Query: 584 XRSTW 570 + W Sbjct: 149 TKLFW 153 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GGG G G G G GG G G G GG GGGG GG Sbjct: 312 GGGRGGGYRSGGGGGYGG-GRGGGRGYGGGRGGGGRRDYGG 351 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 G GGG G G G GGG G GGG GGG GG G Sbjct: 314 GRGGGYRSGGGG-GYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 35.1 bits (77), Expect = 0.088 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 946 GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GG G GG GGG G GG GGG GG G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 GG GG GG G GG G G G GG GGG G G G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGY---GGGRGGGGRRDYGGGSRSG 356 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 916 GXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 G GG GG G GG GG GGG G GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GGG GG G GG G G GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 50.0 bits (114), Expect = 3e-06 Identities = 37/120 (30%), Positives = 37/120 (30%), Gaps = 2/120 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGGGXXXXG 795 G GG GG G G G G G GG GGG GGG Sbjct: 108 GGAGGSTSVGGAETDGGGADGGAAT-GTVLEVGTAVGGANTNGGGADNVAATGGGAVAGV 166 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GGG GG G G G GGG G G G GG G Sbjct: 167 GTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGGGAAG 226 Score = 48.4 bits (110), Expect = 9e-06 Identities = 37/116 (31%), Positives = 37/116 (31%), Gaps = 6/116 (5%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG--GXGGGXGGXXXXGGGXXXXG 795 G G GG GG G GGG G G G GG GGG Sbjct: 97 GTAVGGANTDGGGAGGSTSVGGAETDGGGADGGAATGTVLEVGTAVGGANTNGGGADNVA 156 Query: 794 GXXGGGGXGXG----GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G G GGG G GG G G G G GG G G Sbjct: 157 ATGGGAVAGVGTADDGANTDGGGAG-GGAVTGVGTPDDGANTDGGGAGGGSVTGVG 211 Score = 46.8 bits (106), Expect = 3e-05 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 10/132 (7%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG----GXXXX 819 G G G G GG GG G G GGG GGG G G G Sbjct: 161 GAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTD 220 Query: 818 GGGXXXXG----GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGX 651 GGG G G GGG GG G G GGG G Sbjct: 221 GGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPD 280 Query: 650 XGXGXXGGXXGG 615 G GG GG Sbjct: 281 DGANTDGGGAGG 292 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/108 (29%), Positives = 32/108 (29%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG G G GG GGG GG G G G GGG Sbjct: 101 GGANTDGGGAGGSTSVGGAETDGGGADGGAATGT----VLEVGTAVGGANTNGGGADNVA 156 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G GGG G G G GG GG Sbjct: 157 ATGGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGAGG 204 Score = 41.9 bits (94), Expect = 8e-04 Identities = 38/132 (28%), Positives = 38/132 (28%), Gaps = 10/132 (7%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGX----GGGXGGXXXX 819 G G G G GG GG G G GGG GG G G Sbjct: 183 GAVTGVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSPDDGANTD 242 Query: 818 GGGXXXXG----GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGX 651 GGG G G GGG GG G G GGG G Sbjct: 243 GGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAGGGAVTVVGSPD 302 Query: 650 XGXGXXGGXXGG 615 G GG GG Sbjct: 303 DGANTDGGGAGG 314 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/109 (28%), Positives = 31/109 (28%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GG G G GG G G GG GGG G G G Sbjct: 143 GGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGA---GGGAVTGVGTPDDGANTDG 199 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GG G G G GGG G G GG G Sbjct: 200 GGAGGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAAG 248 Score = 39.9 bits (89), Expect = 0.003 Identities = 35/130 (26%), Positives = 35/130 (26%), Gaps = 12/130 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG------------GGXGGGX 837 GG GGG G G G G G G GGG Sbjct: 143 GGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGA 202 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGX 657 GG G G G GGG GG G G G G GG G Sbjct: 203 GGGSVTGVGTPDDGANTDGGG-AAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGA 261 Query: 656 GXXGXGXXGG 627 G G GG Sbjct: 262 NTDGGGAAGG 271 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/118 (27%), Positives = 32/118 (27%), Gaps = 2/118 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G GG G GG G GG G GG G G Sbjct: 13 GGAATGSWTAANGGAATVGWTAANGGAVADVGAVTGG-GAATGGADNCGAAIESGAARTG 71 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG--XXGGXXGG 615 GG G G G G GG G GG G GG GG Sbjct: 72 GGTGDDWANIDGCGAATCVGAVLDIGTAVGGANTDGGGAGGSTSVGGAETDGGGADGG 129 Score = 37.9 bits (84), Expect = 0.012 Identities = 33/121 (27%), Positives = 33/121 (27%), Gaps = 3/121 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G G G G GGG GG GG GG Sbjct: 71 GGGTGDDWANIDGCGAATCVGAVLDIGTAVGGANTDGGGAGGSTS----VGGAETDGGGA 126 Query: 788 XGGGGXG---XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G GG GG GGG G G G GG Sbjct: 127 DGGAATGTVLEVGTAVGGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGAGGGAVT 186 Query: 617 G 615 G Sbjct: 187 G 187 Score = 36.7 bits (81), Expect = 0.029 Identities = 38/136 (27%), Positives = 38/136 (27%), Gaps = 14/136 (10%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG----GGXGXGGGXGGGX----GGGXGGXX 825 GG G G G GG G G G GGG GG G G Sbjct: 203 GGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGAN 262 Query: 824 XXGGGXXXXG----GXXGGGGXGXGGGXXGGG--GXGXGGXGXGXGXGGGGGXXXXGXGG 663 GGG G G GGG GG G G GG GG G G Sbjct: 263 TDGGGAAGGAVTVVGSPDDGANTDGGGAGGGAVTVVGSPDDGANTDGGGAGGGAVTGVGT 322 Query: 662 GXGXXGXGXXGGXXGG 615 G GG Sbjct: 323 PDDEANTDGGGAATGG 338 Score = 33.9 bits (74), Expect = 0.20 Identities = 24/95 (25%), Positives = 24/95 (25%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GG G GG G G G GG G G Sbjct: 31 GWTAANGGAVADVGAVTGGGAATGGADNCGAAIESGAARTGGGTGDDWANIDGCGAATCV 90 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G G GGG G G GGG Sbjct: 91 GAVLDIGTAVGGANTDGGGAGGSTSVGGAETDGGG 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 33/141 (23%), Positives = 35/141 (24%), Gaps = 5/141 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G GG G G GGG GG G G GG Sbjct: 18 GSWTAANGGAATVGWTAANGGAVADVGAVTGGGAATGGADNCGAAIESGAARTGGGTGDD 77 Query: 800 XGGXXGGGGXGXGG-----GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G G G G GG GG G GG G GG Sbjct: 78 WANIDGCGAATCVGAVLDIGTAVGGANTDGGGAGGSTSVGGAETDGGGADGGAATGTVLE 137 Query: 635 XGGXXGGXXXXXXXAXSXRST 573 G GG A + +T Sbjct: 138 VGTAVGGANTNGGGADNVAAT 158 Score = 29.5 bits (63), Expect = 4.4 Identities = 25/96 (26%), Positives = 25/96 (26%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG GG G G G G GG GG G G G Sbjct: 117 GGAETDGGGADGGAATGTVLEVGTAVGGANTNGGGADNVAATGGGAVAGVGTADDGANTD 176 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGG 695 GG G G G G GG G G Sbjct: 177 GG-GAGGGAVTGVGTPDDGANTDGGGAGGGSVTGVG 211 Score = 29.5 bits (63), Expect = 4.4 Identities = 28/117 (23%), Positives = 28/117 (23%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGX 794 G G GGG G G GG GGG G G GGG G Sbjct: 177 GGGAGGGAVTGVGTPDDGANTDG-GGAGGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSP 235 Query: 793 GXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXGG 623 G G GG G G GG GG Sbjct: 236 DDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAGG 292 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P PP PPPPP P P P PPPP P PPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAP---PPPPPIGGGAPPPPPP 705 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P PP P PPPP PPPP P PPP PP PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 49.2 bits (112), Expect = 5e-06 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 PP P PPP PPPP PP P P PP PPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P P PP P PPP P PPPP P PPP PPP PP Sbjct: 656 PEAGPPPP-PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PPPP PPP P PP P P PP PPP PPP P Sbjct: 656 PEAGPPPP--PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 46.0 bits (104), Expect = 5e-05 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PPPPP P P PPPP P PPPP PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 46.0 bits (104), Expect = 5e-05 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PPP P PPP PPP PP PPP P PPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP PPP PPP P PP PP PPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PPPPP P P PPPP P PPPP PPP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPPP P P PPPP PPP P P PP PPP P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPP--PPPLPGGAAP--PP----PPPIGGGAPPPPP 704 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PPPP PP PPP PPP PPP P PPP P PP Sbjct: 656 PEAGPPPP--PP----PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP PP PPP PPPP P P P P PPPP P PPP Sbjct: 660 PPPPPP---------PPPGGQAGGAPPPP-PPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PPP PPPP PP P P PPP PP PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPP------PPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPX---PPPXPPXXPXPPPPXPP 902 PP P P P PPP P PPP PP PPP PP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 864 PPXXPXPPPPXPP-XXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PPPP PP P P PP P P P PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 PPPPP P PPPP P PP P P P P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP P PPP P PP P PPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPPP PP P PP P P PPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 PPPPP P PPPP P PP P P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P PPP PPP P PP P P PPP P Sbjct: 656 PEAGPPPPP---PPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 50.0 bits (114), Expect = 3e-06 Identities = 34/107 (31%), Positives = 34/107 (31%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G G GG G G G GG GGG GG GG G Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPR--GGGRGGFGGDFGGDGGRFDAS 252 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G G GG G G GG Sbjct: 253 NMGGATGGTGNMFGGVGGTAAGGQTGQDFSQDMSGSGFGDSSFQAGG 299 Score = 48.4 bits (110), Expect = 9e-06 Identities = 40/124 (32%), Positives = 40/124 (32%), Gaps = 7/124 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX---GXXXXXGGGXGXGGGXGGGXGGGXGGXXXX--- 819 GG G G G GG GG G G GG G G G GG GG GG Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNM 254 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G GG G G G G GG GG G Sbjct: 255 GGATGGTGNMFGGVGGTAAGGQTGQDFSQDMSGSGFGDSSFQAGGQMNQWNQGGASSGGN 314 Query: 641 GXXG 630 G Sbjct: 315 TAGG 318 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 5/88 (5%) Frame = -3 Query: 878 GXGGGXGG-GXGGGX--GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG--XGXGGXGX 714 G GG GG G GGG GG GG G G GG GGG G GG G GG Sbjct: 192 GYDGGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGP-RGGGRGGFGGDFGGDGGRFD 250 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG G GG G G G Sbjct: 251 ASNMGGATGGTGNMFGGVGGTAAGGQTG 278 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG GG G G G G G GGG G G GG G G Sbjct: 201 GFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNMGGATGG 260 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 261 TGNMFGGVGG 270 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 2/77 (2%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P PP P PP P P PP P Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTG 639 Query: 841 PPPXPPPXPPPXPXPPP 891 P PPP P PPP Sbjct: 640 QHPPPPPAGYPGYGPPP 656 Score = 45.2 bits (102), Expect = 8e-05 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PPP P P P P P P P P P PP P Sbjct: 580 PAPTPSYPQPGT-YPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPT 638 Query: 799 XXXXPPPXXXXPPXPPP 849 PPP P PP Sbjct: 639 GQHPPPPPAGYPGYGPP 655 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPX 921 P P P P PPP PP P PPP P P P P Sbjct: 582 PTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQH 641 Query: 922 PPXXPPPXPXXPPP 963 PP P P PP Sbjct: 642 PPPPPAGYPGYGPP 655 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P P PPP P P PP P PPPP Sbjct: 589 PGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAG 648 Query: 796 PXXXXPPP 819 PPP Sbjct: 649 YPGYGPPP 656 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPP--XXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P PP P PPP P PP Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTG 639 Query: 960 PXPXPPP 980 P PPP Sbjct: 640 QHPPPPP 646 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/64 (45%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = -3 Query: 890 GGGXGXGG---GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGG 723 GGG G GG G GGG GGG GG GG G GG G GG GG G G Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDGDVDG 65 Query: 722 XGXG 711 G G Sbjct: 66 GGDG 69 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -3 Query: 794 GXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGG--GGGXXXXGXGGGXGXXG--XGXXG 630 G GGGG G GG G GGGG G G G G GG GG G GG G G G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDG 61 Query: 629 GXXGG 615 GG Sbjct: 62 DVDGG 66 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 5/67 (7%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG-----XGXGX 708 GGG G G G GG GGG G G GG GG GG G GG G G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGG--DGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDGD 62 Query: 707 GXGGGGG 687 GGG G Sbjct: 63 VDGGGDG 69 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGG---GXGGGXGGXXXXGGGXXXXGGXX---GGGG 774 G GG G GGG G GGG GG G GG G GG GG GG G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDG 61 Query: 773 XGXGGG 756 GGG Sbjct: 62 DVDGGG 67 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGG----XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GGG GG GGG G GGG G GG GG G GG GG G G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDG 61 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 3/71 (4%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG---GGXGXGGXGXGXGXG 699 G GGG G G GGG GG GG G GG GG GG G G G Sbjct: 2 GYDGGGGDGDGGDGDGGGGG---DGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERG 58 Query: 698 GGGGXXXXGXG 666 G G G G Sbjct: 59 GDGDVDGGGDG 69 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXG-XGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GGG G GGG G G G G GG GG G GG GGG Sbjct: 15 GDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDGDVDGGG 67 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P PPPP PP PP PPP PP PP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P PP PP PPP PP PPP PP PPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPP 765 P PPP P PPP PP P P PP P PP PPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P P P PPP PPP PPP P PPP PP P PPP Sbjct: 540 PIPAVAPAVTPSEEPPP--PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 46.0 bits (104), Expect = 5e-05 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPX----PXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P PPPPP P P P P PPPP PP PPPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P PP PPP P P PPPP P PPP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 46.0 bits (104), Expect = 5e-05 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P P P P PPP P P PPP P P PP PPPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPP---PEPPEECPPPP 590 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P P PPP PPP PP PPP PP P P P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PPPP P PP P P PPP P PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P PPP PP PPP P PP PP PPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PP P P P P PP PP P P PP P PPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECP---PPPP 591 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXP--PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P PPP P PPP P PPP PP PP PP PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPP---PPPEPPEECPPPPP 591 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P PPP PP P P P P P PPP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLP-PSEDPKPPPPPPEPP 583 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP PP PPP P P PP P PP PPPP Sbjct: 554 PPPPPPGVDIPPP------LPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P PP PPP PP PP P PPP P P P P P Sbjct: 542 PAVAPAVTPSEEPPP---PPPGVDIPPPLPPSEDPKPPP-PPPEPPEECPPPPP 591 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P PPP P PP PP PPP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPP-----PGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 6/38 (15%) Frame = +1 Query: 832 PPXPPPX---PPPXPP---PXPXPPPXXXXXPXXPXPP 927 PP PPP PPP PP P P PPP P PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPP 702 PP PP P P PPP P PPPPP Sbjct: 564 PPPLPPSED-PKPPPPPPEPPEECPPPPP 591 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PPP PPP PP P PPP P P P PPP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVD--IPPPLPPSEDP--KPPPP-----PPEP-PEECPPP 589 Query: 943 XP 948 P Sbjct: 590 PP 591 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P P PP P P PPPPP P P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECP 587 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = -3 Query: 884 GXGXGG---GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GG G GG GGG GG GGG G GGGG G GGGG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G G GG G GG GG GG G G G GGG GG GG G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G GG G GG GG G GGG G G GGG GGG GG GGG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDD---GGGIS-GCGDGGGGGGGAGGDDDDGGG 101 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG G G GGG G G G G G G GGGGG GG G Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G GG G G G GGG G GGG GG GG G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GG G G GG G GGG G GGG G G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGG 100 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G GG G GG G G G G G G G GGG G GG G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGD----GGGGGGGAGGDDDDGGGG 102 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G G G GG GG GG G G GGGG G GG G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G GG G GGG G G G G GG GG G GG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCG--DGGGGGGGAGGDDDDGGGG 102 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GG G GG GGG G G G GGGG G G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX---GXGXGXXXXGGXGGGGXGXXGGXGGG 851 GG G GG G GG G G GG GGGG G GGG Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 G GG G G G GG G G GG G GG GG G Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G GGG G GGG G G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G G G G GG GG G G G GGG GG GG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 G G GG G GG G GGG G GG GGG Sbjct: 56 GDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 934 GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G G G GGG G GGG G G G G G G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAG-GDDDDGGGG 102 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXG 791 G G G G G GG GG G G GGG G G G Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 822 GXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGGGG 691 G G G G G GG GGG G G G G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGG 94 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 807 GXXGXXXGXGGXXXGG-GXXGGGGXGXXGXGXGXXXGGGGGXXXXXXGXG 661 G G G G GG G G G G G G GGG G G G Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P PPP P P PPPP PP P PPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAP------PPPPAAAPPPPPPPPPVKKP 253 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P PPP P PPP P P PPPP PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P P PP P PP PPP P PPP PPP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 PP P P P PP PPP PP PPPP PP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPP---PPAAAPPPPPPPPPVKKP 253 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PP P P P P PPP P PPP P PPP Sbjct: 200 PSAAAPKQQKATPVNPPE---PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P PP P P PPP PPPP P P PP P P Sbjct: 212 PVNPPE-PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 P P P P P PPP P PPPPP P Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P PPPP P P P PP PP PPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPP--PPAAAPPPPPPPPP 249 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P PPP P P PPP P P PP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P P P P P PPP PP PPP P P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPP-----PPPAAAPPPPPPPPPVKKP 253 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P PPP PPP P PP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXP 917 P P P P P P P PP PP PPPP PP P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 832 PPXPPPXPPPXPPPX-PXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P PPP P PPP P PP PPP P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPP-----PPAAAPPPPPPPPPVKKP 253 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P PP P P P P P PPP P PP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAP--PPPPPPPP 249 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPX-XPXPPXPXPPXXPP 973 P P P P PPP P P PP P PP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 35.5 bits (78), Expect = 0.067 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P P P P P PP P P PPP PPP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P PP P P PP P P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P PP P PP P PP PP P P P PP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAA-PAPPPPPAAAPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 P PP P P PPP PPPPP P P Sbjct: 223 PTPPPPAAPAP----PPPPAAAPPPPPPPPPVKKP 253 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPP 719 P P P P P P PPPP PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 48.8 bits (111), Expect = 7e-06 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 3/86 (3%) Frame = +1 Query: 619 PXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPX-PPXPXPPPPXXPPPXPXPPPPX 789 P PP P P P PP P P P P P PP P PP P P Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAAS-YPPTAPSY 228 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXP 867 P PP PP P PP P Sbjct: 229 NPTAPSYPPTPSSYPPTQPSHPPTAP 254 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXP 834 PP P P P P PP PP P PP P PP P Sbjct: 173 PPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTA 232 Query: 835 PXPPPXPPPXPPPXPXPPP 891 P PP P PP P PP Sbjct: 233 PSYPPTPSSYPPTQPSHPP 251 Score = 46.4 bits (105), Expect = 4e-05 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = +1 Query: 724 PPXPXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXPP 888 PP PP P PP P PP P PP PP P PP PP P Sbjct: 173 PPTQPFYPPTQPFYPPTPSSYPPTQPSY---PPTAPSYPPTPSSYPPIAASYPPTAPSYN 229 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P PP P PP P Sbjct: 230 PTAPSYP--PTPSSYPPTQPSHPPTAP 254 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 4/82 (4%) Frame = +1 Query: 748 PXXPPPXPXPPP--PXXPPXXXX-PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P PP P PP P PP PP PP P PP P P Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYN 229 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P PP PP P PP Sbjct: 230 PTAPSYPPTPSSYPPTQPSHPP 251 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PP P P P P P PPP P PP PP PP P PP P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPS-----YPPTPSSYPPTQPSYPPTAP 562 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--PPPPXXPPPXPXPPPPXXP 795 P P P P PP P P P P P P PP PP P PP PP P Sbjct: 507 PSYP-PTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 811 PPPXXXXPPXPP---PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP PP P P P PPP P PP P P PP P PP P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPP---TQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPX-PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P P P P PP PP PP P PP P P P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP--PPXPPPXPPPXPXPPP 891 P P P P P P PPP P P PP P PP P PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 37.1 bits (82), Expect = 0.022 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXXPPXXXXPPPXXXXPPXPPPXP 855 PP P P P P P P PPP P PP P PP PP P PP P Sbjct: 510 PPTQPS-YP-PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP--TQPSYPPTAP 562 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP P P P P P PP PP P PP Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXP-PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 P P P P P P P P P P PP P P P P PP P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYP---------PTPSSYPPTQPSY 557 Query: 954 PPPXP 968 PP P Sbjct: 558 PPTAP 562 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P P P P PP P PP PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP 552 Score = 35.9 bits (79), Expect = 0.050 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 1/87 (1%) Frame = +2 Query: 725 PXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPX-PPXXXXXXXXXXXXXXXXXXXPPPXPX 901 P P P P PP P P P P PP PP P Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYP--PTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPS 227 Query: 902 XXPXPPPXPXXPXPPXPXPPXXPPXPP 982 P P P P P P PP P Sbjct: 228 YNPTAPSYPPTPSSYPPTQPSHPPTAP 254 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +1 Query: 616 PPXXPPXXP--XPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P P PP P P P P P PP P PP Sbjct: 194 PPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPP 251 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPP 780 PP P P P P PPP P P P PP P PP P P P Sbjct: 510 PPTQPSYPPTPSSYLP---TQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 PP P P P P PP P PP PP P PP P P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P P P PP P P P P P P P P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 32.3 bits (70), Expect = 0.62 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 4/65 (6%) Frame = +1 Query: 616 PPXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPP-P 783 P PP P P P PP P P P P P P P PP P PP Sbjct: 190 PSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYP---PTAPSYNPTAPSYPPTPSSYPPTQ 246 Query: 784 PXXPP 798 P PP Sbjct: 247 PSHPP 251 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P PP P P P P PP P P P P P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYP 558 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXXPPXXXXPPP 819 P P PP P P PP P P PP P PP PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 >SB_43730| Best HMM Match : Drf_FH1 (HMM E-Value=0.74) Length = 303 Score = 48.8 bits (111), Expect = 7e-06 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 3/123 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P P Sbjct: 92 PCTPDEPYKPDIPCTPDKPHK--PDKPCTPDKPPKPDIPCTPDKPHKPDIPCTPDKPHKP 149 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPP-PXPXXPPPXP 969 P P P P P P P P P P P P P PP P Sbjct: 150 DIPCTPDKPHKPDIPCTPDKPYKPDIPCTPDKPYKPDIPCTPDEPPKPDIPCTQDKPPKP 209 Query: 970 XXP 978 P Sbjct: 210 DIP 212 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/122 (27%), Positives = 33/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P P P P Sbjct: 119 PDKPPKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCTPDKPYKPDIPCT 178 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPX 972 P P P PP P P P P P P P P P P P Sbjct: 179 PDKPYKPDIPCTPDEPPKPDIPCTQDKP-PKPDIPCTPDKPYKPDRPCTPDEPSKPDIPC 237 Query: 973 XP 978 P Sbjct: 238 TP 239 Score = 41.5 bits (93), Expect = 0.001 Identities = 35/128 (27%), Positives = 35/128 (27%), Gaps = 8/128 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P PP P P Sbjct: 143 PDKPHKPDIPCTPDKPHKPDIPCTPDKPYKPDIPCTPDK-PYKPDIPCTPDEPPKPDIPC 201 Query: 799 XXXXPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-----PPXPXXP- 957 PP P P P P P P P P P P P P P Sbjct: 202 TQDKPPKPDIPCTPDKPYKPDRPCTPDEPSKPDIPCTPDKPYKPDRPCTQDKPHKPDIPC 261 Query: 958 -PPXPXXP 978 P P P Sbjct: 262 TPDKPDKP 269 Score = 34.7 bits (76), Expect = 0.12 Identities = 29/121 (23%), Positives = 29/121 (23%), Gaps = 4/121 (3%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P P P P P P P P P P Sbjct: 107 PDKPHKPDKPCTPDKPPKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCT 166 Query: 807 PXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXPXP 974 P P P P P P P PP P P P P P P P P P Sbjct: 167 PDKPYKPDIPCTPDKPYKPDIPCTPDEPPKPDIPCTQDKPPKPDIPCTPDKPYKPDRPCT 226 Query: 975 P 977 P Sbjct: 227 P 227 Score = 32.7 bits (71), Expect = 0.47 Identities = 27/119 (22%), Positives = 27/119 (22%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P P P P P PP P P P P Sbjct: 98 PYKPDIPCTPDKPHKPDKPCTPDKPPKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCTPDK 157 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P PP P P Sbjct: 158 PHKPDIPCTPDK-PYKPDIPCTPDKPYKPDIPCTPDEPPKPDIPCTQDKPPKPDIPCTP 215 Score = 30.3 bits (65), Expect = 2.5 Identities = 27/119 (22%), Positives = 27/119 (22%), Gaps = 2/119 (1%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P P P P P P P P P P Sbjct: 128 PCTPDKPHKPDIPCTPDKPHKPDIPCTPDKPHKPDIPCTPDKPYKPDIPCTPDKPYKPDI 187 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXPXPP 977 P P P P P PP P P P P P P P P P P Sbjct: 188 PCTPDEP-PKPDIPCTQDKPPKPDIPCTPDKPYKPDRPCTPDEPSKPDIPCTPDKPYKP 245 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P P PPPP PPP P PPP P PP PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP--TEAPPTAPP 165 Score = 48.4 bits (110), Expect = 9e-06 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPP--PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPP P PPPP P P P PP P PP P P PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPP--XXXXPPPXXXXPPXPPPXPPPXPPP 873 PPP PP PPPP PP PPP PP PP PP PP Sbjct: 122 PPP--PPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP-XPXPPPPXXPPXXXXPPPXXXXPPXPP 846 PPPPP P P P P P PPP P PP P PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP PP P PP P P P P P PP P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PPP PP PPP PP P PPP P P PP Sbjct: 122 PPP--PPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPP 780 P PP P P PP P PPPP P P P PP PP PP PP Sbjct: 122 PPPPPTGTLPPPPVTPP-PGPETPPPPDTPAP-PVPPTEAPPTAPPTGGSCVSKPP 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP PP PPP PP PP P P PP PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPP-PPDTPAPPVPPTEAPP 161 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 855 PPXPPXXPXPPPPX-PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP PP PPPP PP P P P P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPP PP PP PPP P P P P PP PP Sbjct: 124 PPPTGTLPP-PPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP P PP P PP P P P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PPP P PP P P P PP P P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXP-PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P PPP P P P PP P PP PP P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 831 PPPXXPXPPPX--PPXXP-XPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP PPP PP P PPPP P P P PP P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP-PTEAPPTAPPTGGSCVSKPP 175 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P PPP P P PP P P P PP P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP PP P P PP PPP P P PP PP Sbjct: 124 PPPTGTLPPPPVTP----PPGPETPPPPDTPAPPVPPTEAPP 161 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 PP PP P P P PP P PP PP P PP Sbjct: 133 PPVTPP--PGPETPPPPDTP---APPVPPTEAPPTAPP 165 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXP-PPXPPXXPXPPPPXPP 902 PP P PP P P PPP P PP PP PP PP Sbjct: 131 PPPPVTPPPGPETP----PPP--DTPAPPVPP--TEAPPTAPP 165 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 48.8 bits (111), Expect = 7e-06 Identities = 34/120 (28%), Positives = 34/120 (28%), Gaps = 3/120 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPX 789 P P P P P P PPP P P PP P P PP P Sbjct: 580 PSYSPSSPS-YSPSSPSFHHNLRPTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPP 638 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP PP P P P PPP P PP P P P Sbjct: 639 TPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPPLSTPQPRQSTALP 698 Score = 41.5 bits (93), Expect = 0.001 Identities = 33/121 (27%), Positives = 33/121 (27%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 531 PSYSPTSPS-YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSY 589 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P PPP P P PP P P PP P PPP P Sbjct: 590 SPSSPSFHHNLRPTPPPLPLSIPLLLQATPPHLQSTAQ-PRPTTV-PPLPPTPPPRQSTP 647 Query: 979 P 981 P Sbjct: 648 P 648 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 4/88 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP--XPPPPXXPPPXPXPPPPX 789 PP P P PP P P P P PP PPP P P P Sbjct: 604 PPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPL 663 Query: 790 XPPXXXXP--PPXXXXPPXPPPXPPPXP 867 PP P P PPP P P Sbjct: 664 PPPTVRHPQATPLPRLATHPPPLSTPQP 691 Score = 38.3 bits (85), Expect = 0.009 Identities = 33/124 (26%), Positives = 33/124 (26%), Gaps = 7/124 (5%) Frame = +1 Query: 619 PXXPPXXPX--PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P Sbjct: 552 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSFHHNLRPTPPPLPLSI 611 Query: 793 PPXXXXPPPXXXXPPXPPPXP----PPXPPPXPXPPPXXXXXPXXP-XPPXXPPPXPXXP 957 P PP P P PP PPP PP P P PPP P Sbjct: 612 PLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHP 671 Query: 958 PPXP 969 P Sbjct: 672 QATP 675 Score = 37.9 bits (84), Expect = 0.012 Identities = 30/116 (25%), Positives = 30/116 (25%), Gaps = 2/116 (1%) Frame = +1 Query: 640 PXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P Sbjct: 387 PTPGSPVSPGPTSPYIPSPAAASPGYSPSSPAFMPSSPSMSPASPSYSPTS--PGYSPSS 444 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P P P P Sbjct: 445 PSSGYSPASPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP 500 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P PP P P P PP PP P P P P Sbjct: 602 PTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTL 661 Query: 960 PXPXP 974 P P P Sbjct: 662 PLPPP 666 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 846 PXPPPXPPXXPX---PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPP P P PP P P PP P PP PPP Sbjct: 602 PTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPP 649 Score = 35.1 bits (77), Expect = 0.088 Identities = 32/126 (25%), Positives = 32/126 (25%), Gaps = 5/126 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 517 PSYSPTSPS-YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 575 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP--XXPXPP---XXPPPXPXXPPP 963 P P P P P PPP P PP P P PP Sbjct: 576 SPTSPSYSPSSPSYSPSSPSFHHNLRPTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPP 635 Query: 964 XPXXPP 981 P PP Sbjct: 636 LPPTPP 641 Score = 35.1 bits (77), Expect = 0.088 Identities = 30/124 (24%), Positives = 30/124 (24%), Gaps = 10/124 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P PP Sbjct: 566 PSYSPTSPSYSPTSPSYSPSSPSYSPSSPSFHHNLRPTPPPLPLSIPLLLQATPPHLQST 625 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPP----------PXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP PPP PP P PPP P P P P Sbjct: 626 AQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPP 685 Query: 949 XXPP 960 P Sbjct: 686 LSTP 689 Score = 33.9 bits (74), Expect = 0.20 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 2/124 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P PPP P P P P Sbjct: 577 PTSPSYSPSSPSYSPSSPSFHHNLRPTPPPL--PLSIPLLLQATPPHLQSTAQ--PRPTT 632 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXP--PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 PP P P PP PPP P P P PP P PPP Sbjct: 633 VPPLPPTP-----PPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPPLS 687 Query: 969 XPPP 980 P P Sbjct: 688 TPQP 691 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP----PXPPXXXXPXPXPXPPXXPXXPPPX 965 PP P P PP PP PPP P P P P P P P Sbjct: 619 PPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATPLPR 678 Query: 966 PXPPPP 983 PP Sbjct: 679 LATHPP 684 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 44.8 bits (101), Expect(2) = 7e-06 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGGG GGG GGGG G G GG G GGG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 890 GGGXGXGGGXGGG---XGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G GG GGG GGG G G G GG G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 35.5 bits (78), Expect(2) = 0.010 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG GGG GG G G G GG G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXG---GGGXGXXGGXGGG 851 GGG G GG G G G G GG G GG G GGG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGG-GXXGGGGXG---XGGXGXGXGXGGG 693 GGG G GGG G GG G GG G GG G GGG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GGG GGG G GG GG G G G G GG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGG 168 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 764 GGGXXGGGGXGXGG--XGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GGG G GG G G G GG GG G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDG 167 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGG-GXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G GGGG G G G G G GG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 G GGG GGG GG G G G G GG G G G Sbjct: 126 GDGGGGSDGGGGSDGG-GGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXG--XGGGXGGGXGGGXGGXXXXGGG 810 GGG GG G GGG G GG G GG GGG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GGG G GG GG G G GG G GGG Sbjct: 124 GGGDGGGGSDGGGGSDGG---GGDGEDDDGGDGDDDDGGDVEDDGDGGG 169 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -1 Query: 901 GGXGGGGXGXXGGX--GGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 GG GGGG GG GGG G G G G GG Sbjct: 125 GGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGG 168 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GGG GGG G G G GG G GGG Sbjct: 125 GGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDG--DGGG 169 Score = 23.4 bits (48), Expect(2) = 7e-06 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGG 852 G G G G GGG GGG Sbjct: 66 GGDGDNDDGGDGEDDGGGDGGG 87 Score = 21.8 bits (44), Expect(2) = 0.010 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGG 840 G G G G GGG GGG Sbjct: 62 GDDGGGDGDNDDGGDGEDDGGGDGGG 87 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 48.4 bits (110), Expect = 9e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P PPPPP P P P P PPPP PPP PPPP Sbjct: 188 PSPMAGMPPPPP-PPPPPGFPGGAPPPP--PPPFGAPPPP 224 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P PPPPP P P P PPPP PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPPP PP P PP PP PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P PPP P PPPP P PP P PP PPP PP Sbjct: 188 PSPMAGMPPPPP-----PPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP P PPPP P PPP PPP P PP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPP-------PPPFGAPPPPALNGGPP 231 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPP-XPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P PP PPP PPP P P PPP P P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PPPP PP P P PP PPP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P P P P PP PPPP P P PPP PP PPP P Sbjct: 188 PSPMAGMPPPPPP---PPPPGFPGGAPPPPP---PPFGAPPPPALNGGP 230 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PP PPP P PP P P PP PP P Sbjct: 188 PSPMAGMPPPPPP-PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 35.5 bits (78), Expect = 0.067 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P P PPP PP PPP P P PPP P P PP P Sbjct: 188 PSPMAGMPPPPPPP----PPPGF---PGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP 699 PP PP P PPP P PPPP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPX--PPPXPXXXXPPPPP 702 P PP P P P PPP P PPPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 48.4 bits (110), Expect = 9e-06 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P PP P P P P PPPP P P P PP PP PPP PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAP--AAPPAPPFGGPPSAPP-PPPAPP 209 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PP P PP P P P P P PP PP PPPP PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPP-PGAPAAPPAPPFGGPPSA-PPPPPAPP 209 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP---PPXXPPXXXXPP 816 P PP P P PP P P P P PPPP P P PP PP PP PP Sbjct: 155 PSIASQPPQP----PAPPAAPFMAPAAP-PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP P PP P P PP P PP P P P PPP P PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP PP P P PP P PP P PP PPPP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 739 PPPPXXPPPXPX--PPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPPXPXPP 888 PP P PP P P P PP PP PP PP PP PPP P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPP----PPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP PP P PP PPP P P P P P PP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPPPXPXPP 780 P P P P P PP PP P P P P PP PPP P PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +1 Query: 688 PPPPPXPXPXP--XPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PP PP P P P P PPP P P PP PP PPP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP P P PP P P PP PP PP P PP PP PP P Sbjct: 161 PPQP-PAPPAAPFMAPAAPPAPPPPGAPAAPPAP--PFGGPPSAPPPPPAPP 209 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P PP PP P P P PP P PP PP PPP P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPPXPXXPP 981 PP PP P P P PPP P P P PP P PP P PP Sbjct: 164 PPAPPAAPFMAPAAPPAPPP-----PGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PP P P P P P P PP P P PP PP P P P Sbjct: 161 PPQP---PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXX----PXPPPPXPP 902 PP P P PPP P PP PP PPPP PP Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPX-PPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 PP P P P P PPPP P PP P P PP Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP P P P P P PP P PP PP Sbjct: 161 PPQPPA--PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 864 PPXXPXPP-PPXPP----XXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP PP PP P P PP P PP P PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPP 199 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +3 Query: 615 PXXPPXXP-PXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P PP P P P P PP PP PP P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP 202 >SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) Length = 1102 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/99 (31%), Positives = 31/99 (31%), Gaps = 1/99 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G GG G G G G G G G G GG G G Sbjct: 956 GAGMENGAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMENGGGMENGAGMEN 1015 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G G G G G G G G G G G GGG Sbjct: 1016 GAGMENGAGMENGAGMENGAGMENGAGMENGAGMENGGG 1054 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/116 (28%), Positives = 33/116 (28%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G GGG G G G G G G G G Sbjct: 944 GAGMENGAGMENGAGMENGAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMEN 1003 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G G G G G G G G G G G GG G Sbjct: 1004 GGGMENGAGMENGAGM-ENGAGMENGAGMENGAGMENGAGMENGAGMENGGGMENG 1058 Score = 46.4 bits (105), Expect = 4e-05 Identities = 31/104 (29%), Positives = 31/104 (29%), Gaps = 1/104 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GG G G G G G G G G GGG Sbjct: 950 GAGMENGAGMENGAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMENGGGMEN 1009 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXG 672 G G G G G G G G G G G G G G Sbjct: 1010 GAGMENGAGMENGAGMENGAGMENGAGMENGAGMENGAGMENGG 1053 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 1/99 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G G G Sbjct: 944 GAGMENGAGMENGAGMENGAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMEN 1003 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 GG G G G G G G G G G G G G Sbjct: 1004 GGGMENGAGMENGAGMENGAGMENGAGMENGAGMENGAG 1042 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G GGG G G G G G G G G G G G G Sbjct: 962 GAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMENGGGMENGAGMENGAGMEN 1021 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 G G G G G G G G G G G G Sbjct: 1022 GAGMENGAGMENGAGMENGAGMENGAGMENGGGMENGAKMENGAG 1066 Score = 39.9 bits (89), Expect = 0.003 Identities = 33/107 (30%), Positives = 33/107 (30%), Gaps = 4/107 (3%) Frame = -3 Query: 935 GXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G G G G G G G G G G G G G G G Sbjct: 940 GMENGAGMENGAGMENGAGMENGAGMENGGGMENGAGMENGAGMENGAGMENGAGMENGA 999 Query: 758 GXXGGGGXGXG-GXGXGXGXGGGGG-XXXXGXGGGXG-XXGXGXXGG 627 G GGG G G G G G G G G G G G G Sbjct: 1000 GMENGGGMENGAGMENGAGMENGAGMENGAGMENGAGMENGAGMENG 1046 Score = 35.1 bits (77), Expect = 0.088 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G G G G G G G GGG G G G G G G G Sbjct: 934 GNSFDKGMENGAGMENGAGMENGAGMENGAGMENGGGMENGAGMENGAGM-ENGAGMENG 992 Query: 704 XGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG G G G Sbjct: 993 AGMENGAGMENGGGMENGAGMENGAGMENG 1022 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 47.6 bits (108), Expect = 2e-05 Identities = 34/115 (29%), Positives = 34/115 (29%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G G G G G G G GG GG G G G G Sbjct: 170 GGGGGASSGYNGMDGQSGESGTRSSGTNYGRTRAGGTGGNPGECNSAGSSYH---GGVGA 226 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GG GG G G GG G GG GG Sbjct: 227 GWNGAGCARLGSQHGERGGSITEGWVGGKAGGMNSGYNGGPPPGAVGGFGGWGGG 281 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/109 (32%), Positives = 35/109 (32%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G G G GG G Sbjct: 204 GGTGGNPGECNSAGSSYHGGVG--------AGWNGAGCARLGSQHGERGGSITEG----W 251 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GG G GG G G GG G G G G GGG G Sbjct: 252 VGGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 Score = 37.9 bits (84), Expect = 0.012 Identities = 37/122 (30%), Positives = 37/122 (30%), Gaps = 8/122 (6%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG--GXXXXGGXXG 783 G G GG G GGG G G G G G G GG G Sbjct: 149 GTGGGGGSFVYTSGRRLLVAAGGGGGASSGYNGMDGQSGESGTRSSGTNYGRTRAGGTGG 208 Query: 782 GGG--XGXGGGXXGGGGXGXGGXG---XGXGXGGGGGXXXXG-XGGGXGXXGXGXXGGXX 621 G G GG G G G G G G GG G GG G G GG Sbjct: 209 NPGECNSAGSSYHGGVGAGWNGAGCARLGSQHGERGGSITEGWVGGKAGGMNSGYNGGPP 268 Query: 620 GG 615 G Sbjct: 269 PG 270 Score = 35.9 bits (79), Expect = 0.050 Identities = 31/126 (24%), Positives = 31/126 (24%), Gaps = 5/126 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-----GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXX 821 GGGG G G G G G GG GG G G G Sbjct: 171 GGGGASSGYNGMDGQSGESGTRSSGTNYGRTRAGGTGGNPGECNSAGSSYHGGVGAGWNG 230 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G G GG G GG G GG G G Sbjct: 231 AGCARLGSQHGERGGSITEGWVGGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGG 290 Query: 640 GGXXGG 623 GG G Sbjct: 291 GGGYSG 296 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 47.6 bits (108), Expect = 2e-05 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G GGG GG GGG G G G GG GG G G G G G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDG---GGDGGDGGGGSDGGDGEGDDDG-DGEGDDDGDGEGDD 62 Query: 710 XGXGG 696 G GG Sbjct: 63 DGDGG 67 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXG-XGGXGXGXGXGGG 693 G G G GGG GG G GG GGG G G G G G G G G G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDG 66 Query: 692 G 690 G Sbjct: 67 G 67 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G G G GG G G GG GGG G GGG GG G G G G G Sbjct: 7 GDGDGEGG----GDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDD 62 Query: 674 GXGGG 660 GG Sbjct: 63 DGDGG 67 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G GG GGG G G G G G G G G G G G G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDG-DGEGDDDGDGG 67 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G G GG GGG GG GGG G G G G G G G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGG 67 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GG G G G GG G GG G G G G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGG-----DGGGGSDGGDGEGDDDGDGEGDDDGDGEGD 61 Query: 800 XGGXXG 783 G G Sbjct: 62 DDGDGG 67 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG---GGGXGXXGGXGGGXGXXGGG 830 GGG G GGG G G G G G G G G G G G G GG Sbjct: 13 GGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGG 67 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 746 GGGXGXGGXGXGXGXGG--GGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GG G GG GGG G GG G G G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEG 52 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG G GG G G G G G GG G G G G G G G G Sbjct: 13 GGGDGGDSGGGSDGGGDGGDGGG----GSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGG 67 >SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) Length = 654 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 1/108 (0%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG G GGG G G G GG GG G G G G Sbjct: 2 GDGGGDGDDGDGGGDDGVDGGGVGDDGDGDDSDCGDDGGGDDDGGDDDGVDGDGDGDGDG 61 Query: 767 XGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G GG G G G G G GG Sbjct: 62 VDGDGDGDGVDGDGDGDDDDDDDGGVDGRDYDGDSNDDG-DGDGVNGG 108 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/92 (32%), Positives = 30/92 (32%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G GGG G GG G GGG GG G G G G Sbjct: 4 GGGDGDDGD-GGGDDGVDGGGVGDDGDGDDSDCGDDGGGDDDGGDDDGVDGDGDGDGDGV 62 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G Sbjct: 63 DGDGDGDGVDGDGDGDDDDDDDGGVDGRDYDG 94 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P PPPP P PP PP P PPP PP P P P P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPP PPP P P PP PP P PPP P P P PP Sbjct: 777 PPP--PPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPP---PXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 PPPP P P P P P PP P P PPPP P P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP----TKPTKPSLPPVPP 827 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXP--PXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P PPP P P PP P P P P P PP P P PP P Sbjct: 777 PP--PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PPPP P PP P PP P PPP PPP P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNI---PSRPPGARPTPPP---PPPGKPTKPTKPSLPPVPP 827 Score = 43.2 bits (97), Expect = 3e-04 Identities = 35/130 (26%), Positives = 35/130 (26%), Gaps = 8/130 (6%) Frame = +1 Query: 616 PPXXP--PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX------PXPPPPXXPPPXP 771 PP P P PP PPP P P P P P P Sbjct: 696 PPPRPMAPKDASLHRASSPPGFTHKGSEPPPKPAPPARPGSVANVLGERKPLPGRRPGVE 755 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP P PPP PP P PP P P PPP Sbjct: 756 WPPLAKSSSDGAAIDKKALGAPPPPP-PPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Query: 952 XPPPXPXXPP 981 P P PP Sbjct: 815 TKPTKPSLPP 824 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P P P PP P P PP P P P P PP Sbjct: 777 PPPPPPPTKPATPRVP-PNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP-PPXPPPXPP 870 P P PP P P PP P PP P PPP P P P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARP---TPPPPPPGKPTKPTKPSLPPVPP 827 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP-XPPXXXXPXPXPXPP 938 P PP P P PP P PP P PPPP P P P PP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP-PXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPPP PPP P PP P PP P PPP P P P PP P Sbjct: 777 PPPP--------PPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 PPP P P PP P PP P P P P P P P P PP Sbjct: 781 PPPTKPATPRVPPNIPSRPPGARPTP--PPPPPGKPTKPTKPSLPPVPP 827 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PP P PP P P P PPPP P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP--PXPPPXPXPPP 891 PPPP P PP P PP PP PPP P P P P PP Sbjct: 778 PPPPPPTKPATPRVPPNIP---SRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P PPP P P P PP PP PP P P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPP---PPPPGKPTKPTKPSLPPVPP 827 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPP P P P P P P P P PPP P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRP-PGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 36.7 bits (81), Expect = 0.029 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PPP PP PPP P P P Sbjct: 658 PMRPAPGKIELPDWPRTDEDTPPPYSDVAMVPPVTRRPPP----PRPMAPKDASLHRASS 713 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 PP PPP P PP P Sbjct: 714 PPGFTHKGSEPPPKPA--PPARP 734 Score = 36.3 bits (80), Expect = 0.038 Identities = 38/146 (26%), Positives = 38/146 (26%), Gaps = 30/146 (20%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP-------PPXXPPPXPXPPPPX 789 P P PPP PP P P P P PP PPP Sbjct: 669 PDWPRTDEDTPPPYSDVAMVPPVTRRPPPPRPMAPKDASLHRASSPPGFTHKGSEPPPKP 728 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPP---XPP------------------PXPXPPPXXXXX 906 PP P P P PP P P PPP Sbjct: 729 APPARPGSVANVLGERKPLPGRRPGVEWPPLAKSSSDGAAIDKKALGAPPPPPPPTKPAT 788 Query: 907 PXXP--XPPXXPPPXPXXPPPXPXXP 978 P P P P P PPP P P Sbjct: 789 PRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 PP PP P P P P P PPP P P P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 P P P PPP P P P P PP PP Sbjct: 796 PSRPPGARPTPPPPPPGK-PTKPTKPSLPPVPP 827 Score = 28.7 bits (61), Expect = 7.6 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 3/69 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP---X 950 P P P PP P P PP P P PP Sbjct: 663 PGKIELPDWPRTDEDTPPPYSDVAMVPPVTRRPPPPRPMAPKDASLHRASSPPGFTHKGS 722 Query: 951 XPPPXPXPP 977 PPP P PP Sbjct: 723 EPPPKPAPP 731 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PP PPP PPP PP PP PP P P PPP P PP Sbjct: 209 PNAPPGLMPPPGMLPPPGGMPP-GRMPPQGLPFPP-PGPIPPP-PGAGGMRPPHGQMHMG 265 Query: 913 XPXPPXXPPP 942 P P PP Sbjct: 266 GPRPQMGRPP 275 Score = 46.0 bits (104), Expect = 5e-05 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP-XXPPPXPXPPPP 786 P PP P PPP P P PP PP PPP P PPPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP PP PP PP P P PP PPP P PPPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMP-PGRMPPQGLPFPPPGPIPPPP 250 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P PPP PP P P PP P P PP PP PP Sbjct: 208 PPNAPPGLMPPPGMLPPP---GGMPPGRMPPQGLPFPP-PGPIPP--PPGAGGMRPPHGQ 261 Query: 796 PXXXXPPPXXXXPP 837 P P PP Sbjct: 262 MHMGGPRPQMGRPP 275 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P PP P P P P PP PP P P PP P PPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLP-PPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX-PPXXXXPPPXXXXPPXPP 846 PP P PP PPP PP PP PP PPP PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 31.5 bits (68), Expect = 1.1 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 796 PXXXXPP--PXXXXPPXPPPXPPP-XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P PP P PPP PP PP P P PP PP PP Sbjct: 203 PNSQMPPNAPPGLMPP-PGMLPPPGGMPPGRMPPQGLPFPPPGPIPP--PPGAGGMRPP 258 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P PP P PP P PPP P P PP P P P Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPG-------PIPPPPGAGGMRP-PHGQMHMGGPR 268 Query: 960 PXPXPPP 980 P PP Sbjct: 269 PQMGRPP 275 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPP-XPPXXPXPPP--PXPPXXXXPXPXPXPPXXPXXPPP 962 P P PPP PPP P PP P PP P P P PP PP Sbjct: 209 PNAPPGLMPPPG-MLPPPGGMPPGRMPPQGLPFPP----PGPIPPPPGAGGMRPP 258 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/116 (29%), Positives = 34/116 (29%), Gaps = 5/116 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P P P P PP PP P P PP Sbjct: 912 PPISSTPYQAPPTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFP 971 Query: 808 XPPPXXXXPPXPPPX---PPPXPPPXPXPPPXXXXXPXXPXPPXXPP--PXPXXPP 960 P PP P P P P P P P PP P P PP Sbjct: 972 -PSSMGGFPPSSQPSMYNPGQVQPGYPGAMTPGAPSPGVPSPTGLPPSGPPPTGPP 1026 Score = 46.0 bits (104), Expect = 5e-05 Identities = 31/111 (27%), Positives = 31/111 (27%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P P P P P P P P P P Sbjct: 866 PPAAQQPAFQPPSPQPTQFYNPASYQPSAPSSMPAPVPLQPYNTPMPPISSTPYQAP-PT 924 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P P P PP P P PP Sbjct: 925 LPPTTLTTPSWSQPVP---VPSMYQPQPPGIMQPPTSIPPSQPMAPPSFPP 972 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/108 (29%), Positives = 32/108 (29%), Gaps = 1/108 (0%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP PP P P P P P P P P P P PP P Sbjct: 866 PPAAQQPAFQPPSPQPTQFYNPASYQPSAPSSMPA-PVPLQPYNTPM----PPISSTPYQ 920 Query: 841 PPPXPPPXPPPXP-XPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P P P PP P PP P PP Sbjct: 921 APPTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPP 968 Score = 41.5 bits (93), Expect = 0.001 Identities = 32/115 (27%), Positives = 32/115 (27%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P PP P PP PP Sbjct: 872 PAFQPPSPQPTQFYNP--ASYQPSAPSSMPAPVPLQPYNTPMPPI--SSTPYQAPPTLPP 927 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P PP PP PP PP PP Sbjct: 928 TTLTTPSWSQPVPVPSMYQP--QPPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPP 980 Score = 40.3 bits (90), Expect = 0.002 Identities = 37/136 (27%), Positives = 37/136 (27%), Gaps = 14/136 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP---PXXPPPXPXP--- 777 P P P P P P P PP P PP P P P P P Sbjct: 887 PASYQPSAPSSM-PAPVPLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQPVPVPSMY 945 Query: 778 ---PPPXXPPXXXXPPPXXXXPPXPPP-----XPPPXPPPXPXPPPXXXXXPXXPXPPXX 933 PP P PP PP PP PP P P P P Sbjct: 946 QPQPPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPPSSQPSMYNPGQVQPGYPGAMTPGAP 1005 Query: 934 PPPXPXXPPPXPXXPP 981 P P P PP Sbjct: 1006 SPGVPSPTGLPPSGPP 1021 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 8/96 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPP-- 780 PP P P P P P P P PP P PP PP P Sbjct: 876 PPSPQPTQFYNPASYQPSAPSSMPAPVPLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSW 935 Query: 781 --PPXXPPXXXXPPPXXXXPPXP-PPXPPPXPPPXP 879 P P PP PP PP P PP P Sbjct: 936 SQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFP 971 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/101 (31%), Positives = 32/101 (31%), Gaps = 9/101 (8%) Frame = +1 Query: 616 PPXXPPXX-PXPXXPXPPPXPXXXXPPPPPXPXPXPX--PPXPXPPPPXXPPPXPXPPPP 786 PP PP P P P P P PP P P P PP P PP Sbjct: 922 PPTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPPS 981 Query: 787 XXP----PXXXXPP-PXXXXPPXPPP-XPPPXPPPXPXPPP 891 P P P P P P P P P P PPP Sbjct: 982 SQPSMYNPGQVQPGYPGAMTPGAPSPGVPSPTGLPPSGPPP 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPX---PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P P P P PP P P P P P P P P PP P Sbjct: 961 PSQPMAPPSFPPSSMGGFPPSSQPSMYNPGQVQPGYPGAMTPGAPSPGVPSPTGLPPSGP 1020 Query: 948 XXPPPXP 968 PP P Sbjct: 1021 --PPTGP 1025 >SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 1 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPAS 60 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 61 NPKPNN-PSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPN 119 Query: 973 XP 978 P Sbjct: 120 NP 121 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 10 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 69 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 70 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPN 128 Query: 973 XP 978 P Sbjct: 129 NP 130 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 19 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPAS 78 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 79 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPN 137 Query: 973 XP 978 P Sbjct: 138 NP 139 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 28 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPAS 87 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 88 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 146 Query: 973 XP 978 P Sbjct: 147 NP 148 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 37 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPAS 96 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 97 NPKPNN-PASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 155 Query: 973 XP 978 P Sbjct: 156 NP 157 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 46 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPAS 105 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 106 NPKPNN-PASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 164 Query: 973 XP 978 P Sbjct: 165 NP 166 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 55 PNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPAS 114 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 115 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 173 Query: 973 XP 978 P Sbjct: 174 NP 175 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 64 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSS 123 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 124 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 182 Query: 973 XP 978 P Sbjct: 183 NP 184 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 73 PNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSS 132 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 133 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 191 Query: 973 XP 978 P Sbjct: 192 NP 193 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 82 PNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 141 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 142 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 200 Query: 973 XP 978 P Sbjct: 201 NP 202 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 109 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 168 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 169 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKSNNPSSNPKPNNPSSNPKPN 227 Query: 973 XP 978 P Sbjct: 228 NP 229 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 127 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 186 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P Sbjct: 187 NPKPNN-PSSNPKPNNPSSNPKSNNPSSNPKPNNPSSNPKPNNPSSNPKSNNPSSNPKPN 245 Query: 973 XP 978 P Sbjct: 246 NP 247 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 1 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPAS 60 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 61 NPKPNNPSS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNP 116 Query: 969 XPPPP 983 P P Sbjct: 117 KPNNP 121 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 10 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 69 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 70 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNP 125 Query: 969 XPPPP 983 P P Sbjct: 126 KPNNP 130 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 19 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPAS 78 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 79 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNP 134 Query: 969 XPPPP 983 P P Sbjct: 135 KPNNP 139 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 28 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPAS 87 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 88 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 143 Query: 969 XPPPP 983 P P Sbjct: 144 KPNNP 148 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 37 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPAS 96 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 97 NPKPNNPAS----NPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 152 Query: 969 XPPPP 983 P P Sbjct: 153 KPNNP 157 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 46 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPAS 105 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 106 NPKPNNPAS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 161 Query: 969 XPPPP 983 P P Sbjct: 162 KPNNP 166 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 55 PNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPAS 114 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 115 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 170 Query: 969 XPPPP 983 P P Sbjct: 171 KPNNP 175 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 64 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSS 123 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 124 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 179 Query: 969 XPPPP 983 P P Sbjct: 180 KPNNP 184 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 73 PNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSS 132 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 133 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 188 Query: 969 XPPPP 983 P P Sbjct: 189 KPNNP 193 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 82 PNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 141 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 142 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 197 Query: 969 XPPPP 983 P P Sbjct: 198 KPNNP 202 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 109 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 168 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 169 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKSNNPSSNPKPNNPSSNP 224 Query: 969 XPPPP 983 P P Sbjct: 225 KPNNP 229 >SB_20117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 37 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 96 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 97 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPN 155 Query: 973 XP 978 P Sbjct: 156 NP 157 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 46 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 105 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 106 NPKPNN-PSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPN 164 Query: 973 XP 978 P Sbjct: 165 NP 166 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 55 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSS 114 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 115 NPKPNN-PSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 173 Query: 973 XP 978 P Sbjct: 174 NP 175 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 64 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 123 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 124 NPKPNN-PASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPN 182 Query: 973 XP 978 P Sbjct: 183 NP 184 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 73 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 132 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 133 NPKPNN-PASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPN 191 Query: 973 XP 978 P Sbjct: 192 NP 193 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 82 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPAS 141 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 142 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPN 200 Query: 973 XP 978 P Sbjct: 201 NP 202 Score = 45.2 bits (102), Expect = 8e-05 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P P Sbjct: 31 PASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPK 90 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 91 PNN-PASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNP 148 Score = 41.9 bits (94), Expect = 8e-04 Identities = 32/119 (26%), Positives = 32/119 (26%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P Sbjct: 22 PAFNPKSNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPK 81 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 82 PNN-PSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNP 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 2/108 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 100 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSS 159 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P P P P P P P P P P Sbjct: 160 NPKPNN-PSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNP 206 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPX-PPPXPXXXXPPPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P Sbjct: 10 PNNPSSNPKSNNPAFNPKSNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSS 69 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 70 NPKPNN-PSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 128 Query: 973 XP 978 P Sbjct: 129 NP 130 Score = 38.3 bits (85), Expect = 0.009 Identities = 33/124 (26%), Positives = 33/124 (26%), Gaps = 4/124 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXP---PPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P Sbjct: 1 PNNPASNPKPNNPSS--NPKSNNPAFNPKSNNPASNPKPNNPASNPKPNNPASNPKPNNP 58 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P Sbjct: 59 SSNPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPK 117 Query: 967 PXXP 978 P P Sbjct: 118 PNNP 121 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 37 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 96 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 97 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNP 152 Query: 969 XPPPP 983 P P Sbjct: 153 KPNNP 157 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 46 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 105 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 106 NPKPNNPSS----NPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNP 161 Query: 969 XPPPP 983 P P Sbjct: 162 KPNNP 166 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 55 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSS 114 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 115 NPKPNNPSS----NPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 170 Query: 969 XPPPP 983 P P Sbjct: 171 KPNNP 175 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 64 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 123 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 124 NPKPNNPAS----NPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNP 179 Query: 969 XPPPP 983 P P Sbjct: 180 KPNNP 184 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 73 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 132 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 133 NPKPNNPAS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNP 188 Query: 969 XPPPP 983 P P Sbjct: 189 KPNNP 193 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 82 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPAS 141 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 142 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNP 197 Query: 969 XPPPP 983 P P Sbjct: 198 KPNNP 202 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 5/52 (9%) Frame = +1 Query: 673 PXXXXPPPPPX-----PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P PPPPP P P P PPPP P P PPPP PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P P P P PPP P P PPPP PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PPP P PPP P P P P P P P PPPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-----PXPPPXPXPP 888 P PPPP PPP P PP PP P PPP P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXX--PPPPPXPXPXPXPPXPXPPPPXXPP 762 PP P PPP PPPPP P P PP P PPP P Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +1 Query: 769 PXPPPPXXPP--XXXXPPPXXXXP---PXPPPXPPPXPPPXPXPPPXXXXXP 909 P PP PP PPP P P PPP P P P P PPP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PPP PPP P PP P P PP P PPP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P PPPP P PP P PPP P PPP PPP Sbjct: 280 PPPPPPLTGGMLP-PPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P P PPP PPP PP P P PPP P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 700 PXPXPXPXPPXPXP--PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P P PP PPP P PPPP P PPP PP PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPP----PPPPP 322 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PPP PPP P P P P P PPP PPPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPP---PPPP 322 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P PPPP P PPP PPP P P PPP PP P Sbjct: 276 PTSQPPPPP-PLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P P P P P P P P P P P P PPPP PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLP-AGVPAPPPPPPPPMLGGP 327 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPPPP PP P PPP P P PP PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 PP P PPP P PP PPP P P P P PP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPP-----PPPLPAGVPAPPPPPPPP 322 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = +1 Query: 832 PPXPPPX-----PPPX---PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP PPP PPP P P PPP P P PP PPP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP--PPPMLGGP 327 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP PPP P P P PPP P PPP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP--PPPMLGGP 327 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPP-PXXPXPPPXPPXXP-----XPPPPXPPXXXXP 917 P P PP P PP P P PP P PPPP PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P PPP PP P PP P P PP P PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP--PPP 322 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +2 Query: 698 PPXXXPXPXPXXPXP-PPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 P P P P PPP P PP P P P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPP 319 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G G GGG GG GGG GG GGG G GGG G G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G GGG G G G G G GGGGG GG G G G Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 968 GXGGGXXGX-GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG 846 G GGG G GGG GG G G GG G GGG GGG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGG-GRGGGRGGGRG 83 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G G G GGG GGG GGG G GGG GG GGG Sbjct: 36 GFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGG---RGGGRGGG 81 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G GGG G GG GGG G GG G G GG G GGG G Sbjct: 36 GFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGG-----GRGGGRG 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX--GGGXXGGGGXGXG 726 G G GGG GG G G GG GGGG GGG GG G G G Sbjct: 41 GAGRGGGRGGPRGGGRG----GGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G GGG G GG GGG G G G G GGG G Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRG-GGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G G G GGG G G G GGG G GGG GGG GG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGG-GRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGGXG 845 G G GGG G GG G G G GG G G GG GGG G Sbjct: 41 GAGRGGGRGGPRGG-GRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG 866 GGG G GGG G GG G G GG GGG G G Sbjct: 45 GGGRGGPRGGGRGGGRGGGG-GFKSPRGGGRGGGRGGGRG 83 Score = 35.5 bits (78), Expect = 0.067 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -1 Query: 898 GXGGGGXG-XXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 G GGG G GG GGG G GG G GG G G G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G G G G GG G GG G G G GGG G GG G Sbjct: 41 GAGRGGGRGGPRGGGRGG-GRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G GGG G G GG G G GG GG Sbjct: 36 GFSPRGAGRGGGRGGPRGGGRGGGRG----GGGGFKSPRGGGRGGGRGGG 81 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 928 GXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 G G G G GGG G GG GG GGG G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GGG G GGG G GG GG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 934 GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 G G G G GG GGG G G GGG GG G G G Sbjct: 41 GAGRGGGR---GGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGX 714 G G GG G GGG GGG G GGG G G G GGG G GG G Sbjct: 1073 GMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGM 1132 Query: 713 GXGXGGGGGXXXXGXGGGXG 654 G G G G G G Sbjct: 1133 QDGGMGMGDGMMQGMQGMQG 1152 Score = 46.4 bits (105), Expect = 4e-05 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 2/77 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G GG GG G G G G GGG GGG G GGG GG Sbjct: 1073 GMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMG---MQGGGMGMQGGG 1129 Query: 788 XG--GGGXGXGGGXXGG 744 G GG G G G G Sbjct: 1130 MGMQDGGMGMGDGMMQG 1146 Score = 41.9 bits (94), Expect = 8e-04 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGGG GGG G G G GGG G G GGG G GGG Sbjct: 1080 GGGGAAMGGGGQQPMM-MGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGMQ----D 1134 Query: 802 GGXGXGXG 779 GG G G G Sbjct: 1135 GGMGMGDG 1142 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 7/71 (9%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGG------XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG-G 687 GG G GGG GG GG G G GG G G G G G G GGG G Sbjct: 1072 GGMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMG 1131 Query: 686 XXXXGXGGGXG 654 G G G G Sbjct: 1132 MQDGGMGMGDG 1142 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GGG GG GG GG G GG GG G GG GGG Sbjct: 1072 GGMGMPQMGGGGAAMGG--GGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGG 1129 Query: 737 XGXGGXGXGXGXG 699 G G G G G Sbjct: 1130 MGMQDGGMGMGDG 1142 Score = 34.7 bits (76), Expect = 0.12 Identities = 27/62 (43%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = -3 Query: 785 GGGGXGXGGGXXG----GGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GGGG GGG GGG G G G G GGG G GGG G G G G Sbjct: 1080 GGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGM----QGGGMGMQG-GGMGMQD 1134 Query: 620 GG 615 GG Sbjct: 1135 GG 1136 Score = 33.1 bits (72), Expect = 0.36 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG--XGGGXGXXGXGXXGGXXG 618 G G GGGG GG G GGG G GGG G G G GG G Sbjct: 1073 GMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMG-GGMGMQGGGMG 1124 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G GGGG GGG G GG GG Sbjct: 1072 GGMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGG 1114 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G G G GG G G G GGG GG G G G G Sbjct: 1097 GGGQGMMMGNAMGGGMGG-GMGMQGGGMGMQGGGMGMQDGGMGMGDGMMQG 1146 >SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) Length = 811 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 349 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 408 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 409 NPKPNN-PASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 467 Query: 973 XP 978 P Sbjct: 468 NP 469 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 358 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 417 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 418 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPN 476 Query: 973 XP 978 P Sbjct: 477 NP 478 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 367 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 426 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 427 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPN 485 Query: 973 XP 978 P Sbjct: 486 NP 487 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 376 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSS 435 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 436 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPN 494 Query: 973 XP 978 P Sbjct: 495 NP 496 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 385 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 444 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 445 NPKPNN-PSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPN 503 Query: 973 XP 978 P Sbjct: 504 NP 505 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 394 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 453 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 454 NPKPNN-PSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPN 512 Query: 973 XP 978 P Sbjct: 513 NP 514 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 403 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 462 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 463 NPKPNN-PASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPN 521 Query: 973 XP 978 P Sbjct: 522 NP 523 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 412 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 471 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 472 NPKPNN-PASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPN 530 Query: 973 XP 978 P Sbjct: 531 NP 532 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 421 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPAS 480 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 481 NPKPNN-PSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPN 539 Query: 973 XP 978 P Sbjct: 540 NP 541 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 430 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSS 489 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 490 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 548 Query: 973 XP 978 P Sbjct: 549 NP 550 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 439 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPAS 498 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 499 NPKPNN-PASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPN 557 Query: 973 XP 978 P Sbjct: 558 NP 559 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 448 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPAS 507 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 508 NPKPNN-PASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPN 566 Query: 973 XP 978 P Sbjct: 567 NP 568 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 457 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPAS 516 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 517 NPKPNN-PSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPN 575 Query: 973 XP 978 P Sbjct: 576 NP 577 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 484 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 543 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 544 NPKPNN-PASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKSNNPSSNPKPNNPSSNPRPN 602 Query: 973 XP 978 P Sbjct: 603 NP 604 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 661 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPAS 720 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 721 NPKPNN-PSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPN 779 Query: 973 XP 978 P Sbjct: 780 NP 781 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 670 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSS 729 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 730 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPN 788 Query: 973 XP 978 P Sbjct: 789 NP 790 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 679 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPAS 738 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 739 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPN 797 Query: 973 XP 978 P Sbjct: 798 NP 799 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 688 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPAS 747 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 748 NPKPNN-PASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPN 806 Query: 973 XP 978 P Sbjct: 807 NP 808 Score = 45.2 bits (102), Expect = 8e-05 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P P Sbjct: 343 PASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPK 402 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 403 PNN-PSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNP 460 Score = 45.2 bits (102), Expect = 8e-05 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P P Sbjct: 655 PSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPK 714 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 715 PNN-PASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNP 772 Score = 43.2 bits (97), Expect = 3e-04 Identities = 37/127 (29%), Positives = 37/127 (29%), Gaps = 7/127 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 511 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPAS 570 Query: 793 PPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPP---PXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P P Sbjct: 571 NPKPNNPSSNPKSNNPSSNPKPNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSS 630 Query: 958 PPXPXXP 978 P P P Sbjct: 631 NPKPNNP 637 Score = 42.7 bits (96), Expect = 4e-04 Identities = 37/122 (30%), Positives = 37/122 (30%), Gaps = 5/122 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 520 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSS 579 Query: 793 PPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPP 963 P P P P P P P P P P P P P P Sbjct: 580 NPKSNNPSSNPKPNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSS 639 Query: 964 XP 969 P Sbjct: 640 NP 641 Score = 41.9 bits (94), Expect = 8e-04 Identities = 32/119 (26%), Positives = 32/119 (26%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P Sbjct: 646 PASNPKSNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPK 705 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 706 PNN-PSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNP 763 Score = 40.7 bits (91), Expect = 0.002 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 4/124 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 466 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSS 525 Query: 793 PPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P Sbjct: 526 NPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNP---SSNPKPNNPASNPKPNNPSSNPK 582 Query: 967 PXXP 978 P Sbjct: 583 SNNP 586 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P Sbjct: 625 PNNPSSNPKPNNPSSNPKSNSPASNPKSNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSS 684 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 685 NPKPNN-PASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPN 743 Query: 973 XP 978 P Sbjct: 744 NP 745 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P Sbjct: 634 PNNPSSNPKSNSPASNPKSNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPAS 693 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P Sbjct: 694 NPKPNN-PASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPN 752 Query: 973 XP 978 P Sbjct: 753 NP 754 Score = 40.3 bits (90), Expect = 0.002 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P Sbjct: 502 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 561 Query: 793 PPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P Sbjct: 562 NPKPNNPASNPKPNNPSSNPKSNNPSSNPKPNNP---SSNPRPNNPSSNPKPNNPXXXXN 618 Query: 967 PXXPP 981 P P Sbjct: 619 PSSNP 623 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/127 (25%), Positives = 33/127 (25%), Gaps = 7/127 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P Sbjct: 547 PNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKSNNPSSNPKPNNPSSNPRPNNPSS 606 Query: 793 PPXXXXP-----PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P Sbjct: 607 NPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSSNPKSNSPASNPKSNNPSSNPKPNNPAS 666 Query: 958 PPXPXXP 978 P P P Sbjct: 667 NPKPNNP 673 Score = 36.7 bits (81), Expect = 0.029 Identities = 31/121 (25%), Positives = 31/121 (25%), Gaps = 1/121 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX-PXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P Sbjct: 574 PNNPSSNPKSNNPSSNPKPNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPK 633 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P P P P P P P P P P P P P Sbjct: 634 PNNPSSNPKSNSPASNPKSNNPSSNPKPNNP---ASNPKPNNPSSNPKPNNPSSNPKPNN 690 Query: 976 P 978 P Sbjct: 691 P 691 Score = 36.7 bits (81), Expect = 0.029 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P P P P P P P P P P P P P P Sbjct: 586 PSSNPKPNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKP-NNPSSNPKPNNPSSNPKSN 644 Query: 808 XPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P Sbjct: 645 SPASNPKSNNPSSNPKPNNPASNPKPNNP---SSNPKPNNPSSNPKPNNPASNPKPNNP 700 Score = 35.9 bits (79), Expect = 0.050 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPX----PPPXPXXXXP---PPPPXPXPXPXPPXPXP-PPPXXPPPXPX 774 P P P P P P P P P P P P P P P P Sbjct: 601 PNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSSNPKSNSPASNPKSNNPSSNPK 660 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P P P P P P P P P P P P Sbjct: 661 PNNPASNPKPNN-PSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPA 719 Query: 955 PPPXPXXP 978 P P P Sbjct: 720 SNPKPNNP 727 Score = 33.9 bits (74), Expect = 0.20 Identities = 32/127 (25%), Positives = 32/127 (25%), Gaps = 7/127 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPPPXXPPPXPXP-PP 783 P P P P P P P P P P P P P P P Sbjct: 592 PNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSSNPKSNSPASNPK 651 Query: 784 PXXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P P Sbjct: 652 SNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSS 711 Query: 958 PPXPXXP 978 P P P Sbjct: 712 NPKPNNP 718 Score = 31.9 bits (69), Expect = 0.82 Identities = 28/120 (23%), Positives = 28/120 (23%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P Sbjct: 529 PNNPSSNPKPNNPSS--NPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKSNNP 586 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P Sbjct: 587 SSNPKPNNPSSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSSNPKSNSP 646 Score = 31.5 bits (68), Expect = 1.1 Identities = 34/129 (26%), Positives = 34/129 (26%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXP---PPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P Sbjct: 538 PNNPSSNPKPNNPAS--NPKPNNPSSNPKPNNPASNPKPNNPSSNPKSNNPSSNPKPNNP 595 Query: 787 XXPPXXXXP-----PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P P P P P P P P P P Sbjct: 596 SSNPRPNNPSSNPKPNNPXXXXNPSSNPKPNNPSSNPKPNNPSSNPKSNSPASNPKSNNP 655 Query: 952 XPPPXPXXP 978 P P P Sbjct: 656 SSNPKPNNP 664 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 349 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 408 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 409 NPKPNNPAS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 464 Query: 969 XPPPP 983 P P Sbjct: 465 KPNNP 469 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 358 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 417 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 418 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNP 473 Query: 969 XPPPP 983 P P Sbjct: 474 KPNNP 478 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 367 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSS 426 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 427 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNP 482 Query: 969 XPPPP 983 P P Sbjct: 483 KPNNP 487 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 376 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSS 435 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 436 NPKPNNPSS----NPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNP 491 Query: 969 XPPPP 983 P P Sbjct: 492 KPNNP 496 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 385 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSS 444 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 445 NPKPNNPSS----NPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNP 500 Query: 969 XPPPP 983 P P Sbjct: 501 KPNNP 505 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 394 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 453 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 454 NPKPNNPSS----NPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNP 509 Query: 969 XPPPP 983 P P Sbjct: 510 KPNNP 514 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 403 PNNPSSNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSS 462 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 463 NPKPNNPAS----NPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNP 518 Query: 969 XPPPP 983 P P Sbjct: 519 KPNNP 523 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 412 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPAS 471 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 472 NPKPNNPAS----NPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNP 527 Query: 969 XPPPP 983 P P Sbjct: 528 KPNNP 532 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 421 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPAS 480 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 481 NPKPNNPSS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNP 536 Query: 969 XPPPP 983 P P Sbjct: 537 KPNNP 541 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 430 PNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSS 489 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 490 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 545 Query: 969 XPPPP 983 P P Sbjct: 546 KPNNP 550 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 661 PNNPASNPKPNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPAS 720 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 721 NPKPNNPSS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNP 776 Query: 969 XPPPP 983 P P Sbjct: 777 KPNNP 781 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 670 PNNPSSNPKPNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSS 729 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 730 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNP 785 Query: 969 XPPPP 983 P P Sbjct: 786 KPNNP 790 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 679 PNNPSSNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPAS 738 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 739 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNP 794 Query: 969 XPPPP 983 P P Sbjct: 795 KPNNP 799 Score = 29.9 bits (64), Expect = 3.3 Identities = 28/125 (22%), Positives = 28/125 (22%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P Sbjct: 688 PNNPASNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPSSNPKPNNPASNPKPNNPAS 747 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P Sbjct: 748 NPKPNNPAS----NPKPNNPASNPKPNNPASNPKPNNPSSNPKPNNPSSNPKPNNPSSNP 803 Query: 969 XPPPP 983 P P Sbjct: 804 KPNNP 808 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGG G GG G GG G G G G GGG G G GGG G G G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRG----GFGGGAGPQGEG 381 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXG 717 G GGG GG G GG GG G GGG G GGG G G G Sbjct: 334 GDSRGGGRGGRGGR-PGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXX-GGXGGGXGXXGGG 830 G GGG G G G G G G GG G G GG GGG G G G Sbjct: 334 GDSRGGGRGGRGGRPGRG-GRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GGG G G G G G G G GGG GG GG G G Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 37.1 bits (82), Expect = 0.022 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GGG GG G GG G G GG G GG G G G GGG G G Sbjct: 338 GGGRGGRGGRPGRGGRG---GRGASGGRGRGG-GRG-GFGGGAGPQGEG 381 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GGG G GG G GG GG GG G G GG G G G G G Sbjct: 338 GGGRGGRGGRPG--RGGRGGRGASGG----RGRGGGRGGFGGGAGPQGEG 381 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGG 697 GG G G G GG GG GGG G G G G G Sbjct: 339 GGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 G G G G G G G G GG G G GG GGG G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRG-GGRGGFGGGAGPQG 379 >SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 46.8 bits (106), Expect = 3e-05 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 3/121 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 P PP P P P P PPP P P P P P P P Sbjct: 844 PCAPPPATALCPTPCYGPVPHHLLRPCAPPPATALCPTPCYGPVPHPLLRPCAPPPATAL 903 Query: 790 XPPXXXXPPPXXXXPPX-PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P PPP P P P P P P P P P P Sbjct: 904 CPTPCYGPVPHPLLRPCAPPPATALCPTPCYGPVPHPLLRPCAPPPATALCPTPCYGPYS 963 Query: 967 P 969 P Sbjct: 964 P 964 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/109 (29%), Positives = 32/109 (29%), Gaps = 2/109 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP- 837 P P P PPP P P P P P P P P P P Sbjct: 836 PVPHPLLRPCAPPPATALCPTPCYGPVPHHLLRPCAPPPATALCPTPCYGPVPHPLLRPC 895 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXPPPXPXXPP 981 PPP P P P P P P P P P P P P P Sbjct: 896 APPPATALCPTPCYGPVPHPLLRPCAPPPATALCPTPCYGPVPHPLLRP 944 Score = 38.3 bits (85), Expect = 0.009 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 2/90 (2%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX-PPPXPPPXPPPXPXPPPX 894 P P P P P P P P P P P PPP P P P P Sbjct: 830 PTPCYGPVPHPLLRPCAPPPATALCPTPCYGPVPHHLLRPCAPPPATALCPTPCYGPVPH 889 Query: 895 XXXXPXXPXPPXXPPPXP-XXPPPXPXXPP 981 P P P P P P P P P Sbjct: 890 PLLRPCAPPPATALCPTPCYGPVPHPLLRP 919 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P P PPP P P P P P Sbjct: 888 PHPLLRPCAPPPATALCPTPCY-GPVPHPLLRPCAPPPATA--LCPTPCYGPVPHPLLRP 944 Query: 960 PXPXP 974 P P Sbjct: 945 CAPPP 949 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 46.8 bits (106), Expect = 3e-05 Identities = 33/105 (31%), Positives = 33/105 (31%), Gaps = 2/105 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGX--GGXXXXGGGX 807 G G G G G G G G G GG GGG GG GGG Sbjct: 599 GSGGGSQWGSFGQAAPTSQSSGFGGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGGGF 658 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G G GG GG G G G GGG G G Sbjct: 659 PTSQAQADGFGTSQGGFGASQGGFGASQGGFGAKMGGGMGGQQYG 703 Score = 45.6 bits (103), Expect = 6e-05 Identities = 36/114 (31%), Positives = 36/114 (31%), Gaps = 1/114 (0%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GGG G G G GG G GG G G GGG Sbjct: 596 GVSGSGGGSQWGSFGQAAPTSQSSGFGGQGGMFGTPGGQQSGFH----------GGIGGG 645 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGG-GXXXXGXGGGXGXXGXGXXGGXXG 618 G G G GGG G G GG G G G G G GG G Sbjct: 646 GMGGGFSGQGGGFPTSQAQADGFGTSQGGFGASQGGFGASQGGFGAKMGGGMGG 699 Score = 35.1 bits (77), Expect = 0.088 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 13/120 (10%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXG---GGXGXGGGXGGGXGGGXGGXXXXGGGXXXX----GGXXGGG 777 G GG G G G G G G G GG GG GG G Sbjct: 537 GPQGGFGQFGGQASSGMQPGQQGFGAQQAVGMQGGFGGMSQMGGAGQPQMPPTSASTQWG 596 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG------GGXGXXGXGXXGGXXGG 615 G GGG G G GG GG G GG G G G GG Sbjct: 597 VSGSGGGSQWGSFGQAAPTSQSSGFGGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGG 656 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXP 741 PPP P P P PP P P Sbjct: 178 PPPSSQPAPAPAPPQPAP 195 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +1 Query: 646 PXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P P PP P P PP P P PP PP PPP P P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPP---PPPRPAADESQEMSRTRGPKDG 909 Query: 823 XXXPPXPPP 849 PP PPP Sbjct: 910 RKPPPPPPP 918 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P PP PP P P P P PP PPPP P P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDG 909 Query: 847 PXPPPXPPP 873 PPP PPP Sbjct: 910 RKPPPPPPP 918 Score = 43.6 bits (98), Expect = 3e-04 Identities = 30/101 (29%), Positives = 30/101 (29%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P PPP P P P PP PP P Sbjct: 824 PEPESAVELSRPDSLTMEAPTTKTDRPLSPSAPPPLP-PRPVGAPPSL---PPRPRTRPL 879 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P PPP P PP P PPP Sbjct: 880 PPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPP--PPP 918 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P P PP P P P P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDG 909 Query: 835 PXPPPXPPP 861 PPP PPP Sbjct: 910 RKPPPPPPP 918 Score = 37.1 bits (82), Expect = 0.022 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P PPP PP P PP PP P Sbjct: 824 PEPESAVELSRPDSLTMEAPTTKTDRPLSPSA--PPPL--PPRPVGAPPSLPP---RPRT 876 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P PPP P P P PPP Sbjct: 877 RPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPP 917 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 867 PXXPXPPPPXPP-XXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PPP PP P P P PP PPPP Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPP 889 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 PPP PP PP PP P P PP PP P P Sbjct: 856 PPPLPPRPVGAPPSLPPR---PRTRPLPPKSDT--PPPPPRP 892 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P P PP PP P P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKP 912 Query: 795 XPPXP 809 PP P Sbjct: 913 PPPPP 917 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXP 969 P P PPP P P P P P PP PPP P Sbjct: 850 PLSPSAPPP-LPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 >SB_1366| Best HMM Match : Collagen (HMM E-Value=6.2e-05) Length = 442 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/86 (33%), Positives = 29/86 (33%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GG G G G GG G G G GG G Sbjct: 26 GGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNKGI 85 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGG 723 G GG G G GG G GG Sbjct: 86 VGNKGIGGNKGIVGNKGIGGNKGIGG 111 Score = 46.4 bits (105), Expect = 4e-05 Identities = 39/127 (30%), Positives = 45/127 (35%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG G G G GG GG G G G GG GG G GG G Sbjct: 24 GIGGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNK 83 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWSXQ*TSXXXLLSTQAAF 519 G G G GG G G GG G + S T+ ++T+AA Sbjct: 84 GIVG--NKGIGGNKGIVGNKGIGGNKGIGGNKGIGEPTIGSEEDKTTTTKELAVTTEAA- 140 Query: 518 RDEQSNP 498 D +S P Sbjct: 141 -DGKSEP 146 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/92 (35%), Positives = 33/92 (35%), Gaps = 3/92 (3%) Frame = -3 Query: 959 GGXXGXGGGXX-GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG--GX 789 GG G GG GG G GG G G G G G GG GG G G Sbjct: 26 GGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNKGI 85 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G G G G G G G G G G G Sbjct: 86 VGNKGIGGNKGIVGNKGIG-GNKGIGGNKGIG 116 Score = 45.6 bits (103), Expect = 6e-05 Identities = 31/96 (32%), Positives = 31/96 (32%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G GG G GG G G G G GG G GG G G Sbjct: 26 GGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNKGI 85 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G G GG G G G G Sbjct: 86 VGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGEPTIG 121 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/88 (34%), Positives = 30/88 (34%), Gaps = 2/88 (2%) Frame = -3 Query: 947 GXGGGXX-GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G GG GG G GG G GG G G GG GG G G Sbjct: 24 GIGGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNK 83 Query: 770 GXGGGXXGGGGXG-XGGXGXGXGXGGGG 690 G G GG G G G G G GG Sbjct: 84 GIVGNKGIGGNKGIVGNKGIGGNKGIGG 111 Score = 41.5 bits (93), Expect = 0.001 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 2/87 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG--GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GG G GG G G G G GG G GG G G G G G Sbjct: 32 GGNKGIGGNK-GIGGNKGIGGNKGIVGNKGI-GGNKGIGGNKGIGGNKGIVGNKGIVGNK 89 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXG 726 G G G GG GG G G Sbjct: 90 GIGGNKGIVGNKGIGGNKGIGGNKGIG 116 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 46.4 bits (105), Expect = 4e-05 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPPPP P P PP P P P PP P PPP P Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPP-----PPPFIVDDTESPQE 99 Query: 853 PPPXPPPXP 879 PP P P Sbjct: 100 QPPTTPVSP 108 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP PP P P P PP P PP PPP P Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 PPPP P P P P P P PP P PPP P PP P Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEA-PPQLPPPPP--FIVDDTESPQEQPPTTPVS 107 Query: 955 P 957 P Sbjct: 108 P 108 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PPP P P P PP P P P P PPP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAP--PQLPPPPP 88 Score = 35.5 bits (78), Expect = 0.067 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P P P P P PPPP P PP P P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPF-IVDDTESPQEQPPTTPVSP 108 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PP P P P P P P P PP PPP Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPP 87 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P P P P P P PP P PP Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP-PPXPXXXXPPP--PPX-PXPXPXPPXPXPPPPXXPPPXPXPP 780 PP P P P PP P P P PP P P P P PP P P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXP----PXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP P P P P PP P P P P PP P PP Sbjct: 45 PHYHQPPP--PPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPP 102 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 6/61 (9%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXP---XPXPXPPXPXPPPP---XXPPPXPXPPPPXX 792 P P P P P PP P P P P PPPP P PP Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTT 104 Query: 793 P 795 P Sbjct: 105 P 105 >SB_27662| Best HMM Match : Pentapeptide_2 (HMM E-Value=6.4) Length = 241 Score = 46.4 bits (105), Expect = 4e-05 Identities = 35/118 (29%), Positives = 35/118 (29%), Gaps = 1/118 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G GG G G G GG G GG GG Sbjct: 98 GDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVD 157 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGGXGXXGXGXXGG 627 G GGG G G G G G GGG G GG G G GG Sbjct: 158 KGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGG-GSVDKGDDGG 214 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/115 (30%), Positives = 35/115 (30%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGX---GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 GGG G G G G G G G G GGG GGG G Sbjct: 111 GGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGD 170 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G G G GGG G GG G G GG Sbjct: 171 DGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGG-GSVDKGDDGG 224 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/108 (28%), Positives = 31/108 (28%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G GG G G G G G G GGG G Sbjct: 129 GDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVA 188 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GGG G G G G G GGG G G G Sbjct: 189 KGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSG 236 Score = 42.3 bits (95), Expect = 6e-04 Identities = 30/107 (28%), Positives = 30/107 (28%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG G G G G G G G GG G GGG Sbjct: 88 GDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVD 147 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G GGG G G G G GG Sbjct: 148 KGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGG 194 Score = 42.3 bits (95), Expect = 6e-04 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 1/117 (0%) Frame = -3 Query: 977 GXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GG G G G G G G GGG GGG Sbjct: 118 GDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVD 177 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G G GGG G GG G G G Sbjct: 178 KGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGG-GSVDKGDDG 233 Score = 37.1 bits (82), Expect = 0.022 Identities = 29/93 (31%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG--GXXGGGGXGXGGGXXGGGGXGXGGXGX 714 G G G G GGG GGG G G G G GG G GG Sbjct: 88 GDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKG-DDGGGSV 146 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG GGG G G G Sbjct: 147 DKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKG 179 Score = 35.9 bits (79), Expect = 0.050 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 8/124 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXXXGX 812 GGG G G G G GGG G GGG G GGG G Sbjct: 101 GGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGD 160 Query: 811 XGXGGXGXG-XGGXXXXXXXXXXXXXGXXGXXGG----XXXGGGGGXXXXXXGXGXXXXX 647 G G G GG G GG GGG G G Sbjct: 161 DGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKG 220 Query: 646 GXGG 635 GG Sbjct: 221 DDGG 224 Score = 34.7 bits (76), Expect = 0.12 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXXXGX 812 GGG G G G G GGG G GGG G GGG G Sbjct: 162 GGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGD 221 Query: 811 XGXGGXGXGXGG 776 G G G G Sbjct: 222 DGGGSVDKGDDG 233 Score = 32.3 bits (70), Expect = 0.62 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -1 Query: 982 GGGGXGXGG-GXXGXXGGXGXGXGXXXXGGXGGGG--XGXXGGXGGGXGXXGGGXXXXGX 812 GGG G G G G G G GGG G GG G GGG G Sbjct: 172 GGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGD 231 Query: 811 XGXGG 797 G G Sbjct: 232 DGDSG 236 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GGGG G GGG GGGG G GG G G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GG GGGG G GGG GGGG G GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 GGG G GGG GGG GGG GG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG GG GGGG G GGG GGGG G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGG--GGGGDGDDDDGDDDDDDDDGG 94 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 GG GGGG G GG GGG G GGG G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 734 GXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GG G G G GGGGG G GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GGG GGG GGG GG GGG GG GGGG G Sbjct: 53 GGGGGGGGGGGGGG----GGG----GGGGGGGGDG 79 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G G GG GGGG G GG GGG G G Sbjct: 53 GGGGGGGG----GGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG 899 GGGGG G GGG G GG G G G G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 GG G G GGG G GGG GGG GGG G G Sbjct: 53 GGGGGGG-----GGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GGG GGG GG GGG GG GGGG G G G G Sbjct: 53 GGGGGGGGGG----GGG----GGGGGGGGGGGGDGDDDDG 84 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG 914 GGGGG G GGG G GG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG 914 GGGGG G GGG G GG G G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 36.3 bits (80), Expect = 0.038 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 GGG G GGG GG G GGG G GGG G G GG Sbjct: 53 GGGGGGGGGGGGGGGG--------GGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 36.3 bits (80), Expect = 0.038 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 725 GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G GGGGG G GGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GGG GGG GG GGG GG G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG 855 GG G GGG G GGG GG G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 GGG G GGG G GG G G G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G GGG GG G G GGG G GGG G G GG Sbjct: 53 GGGGGGGGGGGGGGG----GGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGGG G GGG G G G G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 701 GGGGGXXXXGXGGGXGXXGXGXXGG 627 GGGGG G GGG G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GGGGG G GGG G G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGGG G GGG G G G GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG 884 GGGGG G GGG G G G GG Sbjct: 61 GGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/120 (27%), Positives = 33/120 (27%), Gaps = 3/120 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP--XPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P PP PP P PP Sbjct: 64 PLMPLAPPMPLAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPVPLAPPMPLAPPVQQ 123 Query: 793 PPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P PP P P P PP P P P Sbjct: 124 APCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPMPLAPPVQQAPCGAGPMQAP 183 Score = 46.0 bits (104), Expect = 5e-05 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 3/124 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P P PP P PP PP P PP P Sbjct: 67 PLAPPMPLAPPVQQAPCGAGTMQAPCAGQQMPLA-PPMPLAPPVPLAPPMPLAPPVQQAP 125 Query: 799 XXXXP---PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P P P P P P P P P Sbjct: 126 CGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPMPLAPPVQQAPCGAGPMQAPCG 185 Query: 970 XXPP 981 PP Sbjct: 186 GGPP 189 Score = 43.6 bits (98), Expect = 3e-04 Identities = 33/117 (28%), Positives = 33/117 (28%), Gaps = 6/117 (5%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP--- 816 P P PP P P P P PP PP P PP PP Sbjct: 64 PLMPLAPPMPLAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPVPLAPPMPLAPPVQQ 123 Query: 817 -PXXXXPPXPP--PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P PP P P P P P P P Sbjct: 124 APCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALP-MPLAPPMPLAPPVQQAPCGAGP 179 Score = 39.5 bits (88), Expect = 0.004 Identities = 32/103 (31%), Positives = 32/103 (31%), Gaps = 9/103 (8%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP---XXXXPPPXXXXPPXPPPXP--PPX 864 P P P P PP P PP P P P PP P PP Sbjct: 50 PMQAPCAGQQMPLAPLMPLAPPMPLAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPV 109 Query: 865 P--PPXPXPPPXXXXXPXXPXPPXXPPPXPXXP--PPXPXXPP 981 P PP P PP P P P P PP P PP Sbjct: 110 PLAPPMPLAPP-VQQAPCGAGPMQAPCAGQQMPLAPPMPLAPP 151 Score = 36.3 bits (80), Expect = 0.038 Identities = 28/109 (25%), Positives = 28/109 (25%), Gaps = 3/109 (2%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P P PP P P P P P PP P PP PP Sbjct: 61 PLAPLMPLAPPMPLAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPVPLAPPMPLAPP 120 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXPPPXPXXPP 981 P P P P P P P PP P PP Sbjct: 121 VQQAPCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPMPLAPP 169 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/38 (57%), Positives = 22/38 (57%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG G GGG GGG G GG G G G GGGGG G G Sbjct: 337 GGSGRGGGG--GGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GGGG G GGG GGGG G GG G G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G GG G G G GGGGG G GGG G G Sbjct: 337 GGSGRGGGGGGGGGG-GGGGGGGGRGGGGGFSSRGRG 372 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG G GGG GGGG G G G G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G G GGG GGG GGG GG GGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG GG GGGG G GGG GGG G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GGGG G GG G G G G GGG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GGGG G GGG GGGG G GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGG--GGGGRGGGGGFSSRGRG 372 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G G GG GGGG G G GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG G GGG GGG GGG GG GGG GG GGGG G Sbjct: 337 GGSGRGGG-GGGGGGGGGG----GGG----GGRGGGGGFSSRG 370 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G GGG G GGG GGG GG GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 892 GGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GG G G GG GGG G GGG G G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G GGG GGG GG GGG GG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG 875 GG G G GGG G GG G G G GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXG 718 GG G G G G GG GGG GGGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G G GGG GG GGG GG GGGG G GGG G Sbjct: 338 GSGRGGGGGG----GGG---GGGGGGGGGRGGGGGFSSRG 370 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG 899 GGGGG G GGG G GG G G G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 898 GXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 G GGGG G GG GGG G GG G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 35.5 bits (78), Expect = 0.067 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXG 791 GG G GG G GG GGG G GGG G G G Sbjct: 337 GGSGRGGGGG-GGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 35.1 bits (77), Expect = 0.088 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 GG G GGG GG G G G GG GGGG G G Sbjct: 337 GGSGRGGGG----GGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 G G GGG GG G G GGG G GG GG G G Sbjct: 337 GGSGRGGGGGGGGGGGG-----GGGGGGRGGGGGFSSRGRG 372 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GGGGG G GGG G G G GG G Sbjct: 338 GSGRGGGGG----GGGGGGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 695 GGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GGG G G G GG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G GGG G G G G GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 46.0 bits (104), Expect = 5e-05 Identities = 36/107 (33%), Positives = 36/107 (33%), Gaps = 4/107 (3%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGX--GXGGGXGGGXGG--GXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GGG GG GG G G GG GGG GGGG Sbjct: 315 GGAATDNYQSMMGGGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTL 374 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G GGGG GG G G GG G Sbjct: 375 GGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLGGGGGGAG 421 Score = 42.3 bits (95), Expect = 6e-04 Identities = 41/113 (36%), Positives = 41/113 (36%), Gaps = 2/113 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 GGG GG GG G G GGG GG GG GG GGG GG Sbjct: 327 GGGSMQSLGGDAGGSMQGLAG-----GGGIQSFGGGGGADLQTLGG----GGGVQTLGGQ 377 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GGG G G GG G GG G G GGG G G Sbjct: 378 TMQGVQSYGGG-AGMQSFGGGGMA-GMQFGGMQGFPSLGGGGGGAGMMAGQMG 428 Score = 37.5 bits (83), Expect = 0.017 Identities = 30/99 (30%), Positives = 30/99 (30%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG GG G G G G GG GG GG GG GG G Sbjct: 327 GGGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTL--GGQTMQGVQS 384 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 GG G G G GGGGG Sbjct: 385 YGG-----GAGMQSFGGGGMAGMQFGGMQGFPSLGGGGG 418 Score = 33.1 bits (72), Expect = 0.36 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXG 795 G GGG G GG G G G G G GGG G G G G Sbjct: 355 GGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLG 414 Query: 794 GXXGGGGXGXGGGXXG 747 G GGGG G G G Sbjct: 415 G--GGGGAGMMAGQMG 428 Score = 32.7 bits (71), Expect = 0.47 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 11/79 (13%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXX-----GGGGXGXGGXGXGXGXGGGGGXXXXGX---GG 663 GG GG GG G GG GGGG G G G GG G GG Sbjct: 328 GGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGG 387 Query: 662 GXGXX---GXGXXGGXXGG 615 G G G G G GG Sbjct: 388 GAGMQSFGGGGMAGMQFGG 406 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 46.0 bits (104), Expect = 5e-05 Identities = 32/104 (30%), Positives = 32/104 (30%), Gaps = 8/104 (7%) Frame = +1 Query: 661 PPPXPXXXXPPP---PPXPXPXPXP-PXPXPPPPXXPPPXP----XPPPPXXPPXXXXPP 816 PP P P P PP P P PP PPP P PPPP P PP Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPP 82 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P PP P P P P P Sbjct: 83 PSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPP 126 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 4/92 (4%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXX----PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P PP P PP P PP PP PPP PPP P P P Sbjct: 24 PAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPP--PGIAPGIGGP 81 Query: 886 PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP P PP Sbjct: 82 PPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPP 113 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 5/96 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPX-----PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P PP P PPP P P PP P PP P Sbjct: 31 PPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAP 90 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PP P P PPP Sbjct: 91 PTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPP 126 Score = 34.3 bits (75), Expect = 0.15 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPX-XXXPPPPP-XPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P PPP P PPPP P PP P P PP Sbjct: 45 PPSGGYGYP-PAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSG 103 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P PP PP P PPP Sbjct: 104 YPGYQQHPP-----PPQPSAQSYNAPPP 126 Score = 33.5 bits (73), Expect = 0.27 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 5/83 (6%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-----PPXPXPPPXXXXXP 909 PP P P P P PP P PPP P PP P P P Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPP 82 Query: 910 XXPXPPXXPPPXPXXPPPXPXXP 978 P P PP P Sbjct: 83 PSGQYGAPPTSQPYGAPPTSGYP 105 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP PP P PP P PP PP P P P Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPP 112 Query: 957 PPXP 968 PP P Sbjct: 113 PPQP 116 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP P PP PP P PP PP PP P PP P Sbjct: 23 PPAAP--GGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGG 80 Query: 952 XPPPXPXXPP 981 PP P Sbjct: 81 PPPSGQYGAP 90 Score = 29.9 bits (64), Expect = 3.3 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 6/96 (6%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX-----PPXPXXPXXXXPPPXXP-XP 854 PP P PP PP P P PP P PPP Sbjct: 31 PPAPGGYPPAPGGYPPSGGYGYPPAGGYPP-PQPGYAGGPPPPGIAPGIGGPPPSGQYGA 89 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PP PP P P P P PP Sbjct: 90 PPTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPP 125 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 834 PPXXPXP-PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P PP P P P PP P P P P PPPP Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYP-PAGGYPPPQPGYAGGPPPP 72 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P PP P P P PP P P P Sbjct: 722 PAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/75 (30%), Positives = 23/75 (30%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P Sbjct: 703 PEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPA-PTPAPTQAQNPAPTPAPTQAQPPVPS 761 Query: 811 PPPXXXXPPXPPPXP 855 P P PP P P P Sbjct: 762 PAPTQAQPPAPSPAP 776 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P P P P P P PP P P P PP P P P Sbjct: 722 PAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P P P P P P P P PP P P P P Sbjct: 716 PTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPA 775 Query: 925 P 927 P Sbjct: 776 P 776 Score = 35.1 bits (77), Expect = 0.088 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXP 936 P P P P P P P P P P P P P P P Sbjct: 697 PTQSIVPEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQ 756 Query: 937 PPXPXXPPPXPXXPP 981 PP P P P PP Sbjct: 757 PPVP-SPAPTQAQPP 770 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P P P P P P P P P P P P P PP Sbjct: 703 PEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPA--PTQAQNPAPTPAPTQAQPPVP 760 Query: 898 XXXPXXPXPPXXPPPXP 948 P PP P P P Sbjct: 761 SPAPTQAQPP-APSPAP 776 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P PP P P Sbjct: 726 PAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/80 (23%), Positives = 19/80 (23%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPX 921 P P P P P P P P P P P P Sbjct: 697 PTQSIVPEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQ 756 Query: 922 PPXXPPPXPXXPPPXPXXPP 981 PP P PP P P Sbjct: 757 PPVPSPAPTQAQPPAPSPAP 776 >SB_10368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 413 Score = 45.6 bits (103), Expect = 6e-05 Identities = 35/115 (30%), Positives = 35/115 (30%), Gaps = 3/115 (2%) Frame = +1 Query: 628 PPXXPXPXX-PXPPPXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPP 798 P P P P P P P P P P P P P PP P P P P Sbjct: 178 PAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAIRPVPAMRPLPAMPPVPAMRPLPAMRPL 237 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P PP P P P P P P P PP P P Sbjct: 238 PAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLP 292 Score = 45.2 bits (102), Expect = 8e-05 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 10/115 (8%) Frame = +1 Query: 628 PPXXPXPXX-PXPPPXPXXXXPPPP---PXPXPXPXPP-XPXP---PPPXXPP-PXPXPP 780 P P P P P P PP P P P P P P P P P PP P P Sbjct: 202 PAMRPLPAIRPVPAMRPLPAMPPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPL 261 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPP 942 P P P P P PP P P P P P P P P P P Sbjct: 262 PAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLP 316 Score = 42.7 bits (96), Expect = 4e-04 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 3/121 (2%) Frame = +1 Query: 628 PPXXPXPXX-PXPPPXPXXXXPP-PPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P PP P P P P P P P P P P P P Sbjct: 262 PAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPL 321 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 322 PAMRPLPAMCPLPAMRPLSAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPVPAMRPP 381 Query: 979 P 981 P Sbjct: 382 P 382 Score = 41.9 bits (94), Expect = 8e-04 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 1/116 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P P PP P P P P P P P P P P P P P P Sbjct: 268 PAMRPLPAMRPLPAMPPLPAMR-PLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRP 326 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P PPP Sbjct: 327 LPAMCPLPAMRPLSAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPVPAMRPPP 382 Score = 41.5 bits (93), Expect = 0.001 Identities = 32/116 (27%), Positives = 32/116 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P Sbjct: 184 PAMRPLPAMRPLSAMRPLPAMRPLPAIRPVPAMRPLPAMP-PVPAMRPLPAMRPLPAMRP 242 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P P P P Sbjct: 243 LPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLP 298 Score = 41.5 bits (93), Expect = 0.001 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 2/110 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P P P P P P P Sbjct: 220 PAMPPVPAMRPLPAMRPLPAMR-PLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRP 278 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPP 942 P P P P P P P P P P P P P P Sbjct: 279 LPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLP 328 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/99 (30%), Positives = 30/99 (30%), Gaps = 2/99 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P P P P P P P P P P P P P P P P P P Sbjct: 158 PLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAIRPVPAMR 217 Query: 865 PPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P Sbjct: 218 PLPAMPPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLP 256 Score = 39.5 bits (88), Expect = 0.004 Identities = 36/127 (28%), Positives = 36/127 (28%), Gaps = 10/127 (7%) Frame = +1 Query: 628 PPXXPXPXX-PXPPPXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P Sbjct: 160 PAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAIRPVPAMRPL 219 Query: 802 XXXPPPXXXXP-----PXPPPXPPPXPPPXPXPPPXXXXXP---XXPXPPXXPPPXPXXP 957 PP P P P P P P P PP P P P P P Sbjct: 220 PAMPPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPL 279 Query: 958 PPXPXXP 978 P P P Sbjct: 280 PAMPPLP 286 Score = 38.3 bits (85), Expect = 0.009 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 2/110 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P P P P P P P Sbjct: 250 PAMPPLPAMRPLPAMRPLPAMR-PLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRP 308 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPP 942 P P P P P P P P P P P P P Sbjct: 309 LPAMRPLPAMRPLPAMRPLPAMCPLPAMRPLSAMRPLPAMRPLPAMRPLP 358 Score = 33.9 bits (74), Expect = 0.20 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +1 Query: 706 PXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPX 882 P P P P P P P P P P P P P P P P P Sbjct: 152 PLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAIR 211 Query: 883 PPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P Sbjct: 212 PVPAMRPLPAMPPVPAMRPLPAMRPLP 238 Score = 33.5 bits (73), Expect = 0.27 Identities = 32/122 (26%), Positives = 32/122 (26%), Gaps = 6/122 (4%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXX-PPXXPXXXXXXXXXXXXXXXXPPXPX--PX 797 P P P P PP P P P PP P P Sbjct: 202 PAMRPLPAIRPVPAMRPLPAMPPVPAMRPLPAMRPLPAMRPLPAMRPLPAMPPLPAMRPL 261 Query: 798 PPXPXXPXXXXPPPXXPXP--PPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P PP P P P P P P P P P P P Sbjct: 262 PAMRPLPAMRPLPAMRPLPAMPPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRP-LPAMRP 320 Query: 969 XP 974 P Sbjct: 321 LP 322 Score = 32.7 bits (71), Expect = 0.47 Identities = 34/126 (26%), Positives = 34/126 (26%), Gaps = 5/126 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P Sbjct: 100 PAMRPLSAMPQLPAMHPLSAMR-PLPAMRPLSAMRPLPAMRPVPAMRPLLAMRPLPAMRP 158 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXPP---P 963 P P P P P P P P P P P P P P P Sbjct: 159 LPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLSAMRPLPAMRPLPAIRPVPAMRP 218 Query: 964 XPXXPP 981 P PP Sbjct: 219 LPAMPP 224 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/105 (26%), Positives = 28/105 (26%), Gaps = 2/105 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPP-PPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 P P P P P P P P P P P P P P P P Sbjct: 98 PVPAMRPLSAMPQLPAMHPLSAMRPLPAMRPLSAMRPLPAMRPVPAMRPLLAMRPLPAMR 157 Query: 829 XPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P Sbjct: 158 PLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLPAMRPLSAMRPLP 202 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/93 (31%), Positives = 29/93 (31%), Gaps = 9/93 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP---- 795 P P PPP PP P P P P P PPPP P Sbjct: 138 PTSATTPIPQIPPPPTYLHPSQYPPSPPPWELPRVPSANATLPPHLQYGPPPPTSPGLCN 197 Query: 796 ---PXXXXPPPXXXXPPXP--PPXPPPXPPPXP 879 P P P PP PPP PPP P Sbjct: 198 QGYNLHQRSQPVHSMEPFPDQPPGPPPGPPPLP 230 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = +1 Query: 640 PXPXXPXPPPX--PXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P PP P P PPP P P PP PP P P Sbjct: 144 PIPQIPPPPTYLHPSQYPPSPPPWELPRVPSANATLPPHLQYGPPPPTSPGLCNQGYNLH 203 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PPP P P P Sbjct: 204 QRSQPVHSMEPFPDQPPGPPPGPPPLP 230 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P PP P P PPP P P PP PPP P Sbjct: 138 PTSATTPIPQIPPPPTYLHPSQYPPSPPPWELPRV--PSANATLPPHLQYGPPPPTSPGL 195 Query: 880 XPPPXXXXXPXXPXP-----PXXPPPXPXXPPPXP 969 P P PP P PPP P Sbjct: 196 CNQGYNLHQRSQPVHSMEPFPDQPPGPPPGPPPLP 230 Score = 31.1 bits (67), Expect = 1.4 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 9/90 (10%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXP-PPXXXXPPXP---PPXPP-----PXPPPXPXPPP 891 P P P PPP P P PP P P PP P PP P Sbjct: 138 PTSATTPIPQIPPPPTYLHPSQYPPSPPPWELPRVPSANATLPPHLQYGPPPPTSPGLCN 197 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP P PP Sbjct: 198 QGYNLHQRSQPVHSMEPFPDQPPGPPPGPP 227 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P PPPP P P PPPP PPPP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPPP P P P P P PPP PPP PPP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRG--FYDDYPPPPP 82 Query: 868 PP 873 PP Sbjct: 83 PP 84 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP P P P PP P PPP P PPPP PPP P Sbjct: 27 PPPPTRPFERNIHPRTEPRDRERPP-PPPPPRFYDNDIPPPPPPRRGFYDDYPPP----P 81 Query: 835 PXP 843 P P Sbjct: 82 PPP 84 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P PP P P P P P PPPP P P P PP P Sbjct: 25 PPPPPPTRPFERN---IHPRTEPRDRERPPPPPP-PRFYDNDIPPPPPPRRGFYDDYPPP 80 Query: 972 PPPP 983 PPPP Sbjct: 81 PPPP 84 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P P P P P PPP P P PPP PP PP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGF-YDDYPPPPPP 83 Query: 940 P 942 P Sbjct: 84 P 84 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P P PPPP PPPP PP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRF-YDNDIPPPP--------PPRRGFYD 75 Query: 835 PXPPPXPPP 861 PPP PPP Sbjct: 76 DYPPPPPPP 84 Score = 35.5 bits (78), Expect = 0.067 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP------PXPPPXP 879 P PP P P P P PP PPP PPP PP PPP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPP--PPPPPRFYDNDIPPPPPPRRGFYDDYPPPPP 82 Query: 880 XP 885 P Sbjct: 83 PP 84 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP---XPXXPPP 963 PP P PPP PP P P P PP PPP PPP Sbjct: 9 PPGFQHPGSVSNNLLRPPPPPPTRPFERNIHPRTEPRDRERPPPP--PPPRFYDNDIPPP 66 Query: 964 XP 969 P Sbjct: 67 PP 68 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP PP P P P P P P P PPP Sbjct: 56 PLKPPSNTPQQLTTPPHQSNTPRPLTPPSRQSNNPRPHTPPSCQSNTPRPLTPPPRQSNT 115 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXP-PXXPPPXPXXPPPXP 969 PP PP P P P P P P PPP P Sbjct: 116 TQPPAYPPRQSYALQQTTPLHTSQPLRPTPRRPSDTPQPFTPPPRP 161 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXXPPXX 804 PP P PP P P P P P PPP P PP Sbjct: 70 PPHQSNTPRPLTPPSRQSNNPRPHTPPSCQSNTPRPLTPPPRQSNTTQPPAYPPRQSYAL 129 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P PP Sbjct: 130 QQTTPLHTSQPLRPTPRRPSDTPQPFTPP 158 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPX-PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P PP P P PP P P P P P PPP Sbjct: 59 PPSNTPQQLTTPPHQSNTPRPLTPPSRQSNNPRPHTPPSCQSNTPRPLTPPP 110 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P PPPP P PP P PPP P P PPPP Sbjct: 644 PPNPFFGGIPPPP-PGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXP-XPXPXPPXPXPP 744 PP P PPP PPPPP P P PP P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P P PPP PPPPP P P P PPPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 PP P PPPP P P P P PP PP P PP Sbjct: 644 PPNPFFGGIPPPP-PGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P PPP PPP P PP P P PP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP P PP PP PPP P P P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P PPP P PPPP PP P P PP Sbjct: 653 PPPPPGGGMFPPPPPP-PPGGGVPGPPKPPP 682 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP PPP P P P PPP P P PP PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP--PP 683 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 760 PPXPX----PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P PPPP P PPP P P PP PPP Sbjct: 644 PPNPFFGGIPPPP--PGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PP P PP P P PPP P PPP P PPP Sbjct: 644 PPNPFFGGIPPPP-PGGGMFPPPPP-PPPGGGVPGPPKPPP 682 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 724 PPXPX----PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP P PPPP P PPPP PPP P PP PPP Sbjct: 644 PPNPFFGGIPPPP--PGGGMFPPPP--------PPPPGGGVPGPPKPPPP 683 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXP---XPPPPXPP 902 PP P PPP PP PP P P PP PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P P PP PP PPP PP P P P P Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP P P P PPP PP PP P Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 844 PPXP--PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P PPP PP P P PP P P PPP Sbjct: 644 PPNPFFGGIPPP---PPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXP---XPPPXXXXXPXXPXPPXXPPP 942 PP P P PPP PPP P PP PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 692 PPPPXXX--PXPXPXXPXPPPPXXPPPXXXPPXPXXXP 799 PP P P P P PPP PPP P P P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 856 PPXP--PPXPXPPPXXXXXPXXPXPPXXP--PPXPXXPPP 963 PP P P PPP P P PP P P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 45.2 bits (102), Expect = 8e-05 Identities = 32/100 (32%), Positives = 32/100 (32%), Gaps = 10/100 (10%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-- 885 P PP P PPPP P PP P PP P P PPP Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFM 739 Query: 886 ---PPXXXXXPXXPXPPXXPPPXPXXP-----PPXPXXPP 981 P PP PPP P P PP P PP Sbjct: 740 LTWTPLTNTSSAANVPP--PPPPPAVPGEGARPPPPPPPP 777 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/98 (31%), Positives = 31/98 (31%), Gaps = 11/98 (11%) Frame = +1 Query: 628 PPXXPXPXXPXPPPX----PXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXPPP 783 P P P P PPP P PP P PP P PPPP Sbjct: 680 PSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFM 739 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPP 888 P PP PPP P PPP P PP Sbjct: 740 LTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 >SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) Length = 1259 Score = 45.2 bits (102), Expect = 8e-05 Identities = 37/94 (39%), Positives = 37/94 (39%), Gaps = 8/94 (8%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG---XGGGXGGGXGGXXXXGGG 810 GG GGG GGG G G GGG GGG GGG GG GGG Sbjct: 847 GGELTIGGGELTIGGGELTIGG--GELTIGGGGLTIGGGEVTIGGGEVTIGGGEVTIGGG 904 Query: 809 XXXXGG---XXGGGGXGXGGG--XXGGGGXGXGG 723 GG GGG GGG GGG GG Sbjct: 905 ELTIGGGELTIGGGELTIGGGELTIGGGELTIGG 938 Score = 43.6 bits (98), Expect = 3e-04 Identities = 41/110 (37%), Positives = 41/110 (37%), Gaps = 11/110 (10%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX---GGGXGGGXGGXXXXGGGXXXXGG 792 GGG GGG G G GG GGG GGG GG GGG GG Sbjct: 832 GGGELTIGGGELTIGG--GELTIGGGELTIGGGELTIGGGELTIGGGGLTIGGGEVTIGG 889 Query: 791 ---XXGGGGXGXGGG--XXGGGGXGXGGXGXGXGXGG---GGGXXXXGXG 666 GGG GGG GGG GG G G GGG G G Sbjct: 890 GEVTIGGGEVTIGGGELTIGGGELTIGGGELTIGGGELTIGGGELTIGGG 939 Score = 31.9 bits (69), Expect = 0.82 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX-GXGXGXXXXGGX----GGGGXGXXGGX---GGGXGXXGGGX 827 GGG GGG GG G G GG GGGG GG GGG GGG Sbjct: 839 GGGELTIGGGELTIGGGELTIGGGELTIGGGELTIGGGGLTIGGGEVTIGGGEVTIGGGE 898 Query: 826 XXXG 815 G Sbjct: 899 VTIG 902 Score = 31.5 bits (68), Expect = 1.1 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX-GXGXGXXXXGGXG---GGGXGXXGGX----GGGXGXXGGGX 827 GGG GGG GG G G GG G GGG GG GGG GGG Sbjct: 846 GGGELTIGGGELTIGGGELTIGGGELTIGGGGLTIGGGEVTIGGGEVTIGGGEVTIGGGE 905 Query: 826 XXXG 815 G Sbjct: 906 LTIG 909 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 7/124 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXP-XXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P PP P P P P P P P P P P Sbjct: 98 PLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHR 157 Query: 796 PXXXXPPPXXXXP-----PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXPXXP 957 P P P P P P P P P P P P PP P Sbjct: 158 PLEPPRPQEQHRPLESHRPLEPTRPQESHRPLEPPRPQEPHRPQEPHRPLEPPRPQEQHR 217 Query: 958 PPXP 969 P P Sbjct: 218 PQEP 221 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P Sbjct: 29 PHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPQE 88 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPPXPX 972 P P PP P P PP P P P P P PP P P P Sbjct: 89 PHRPLEPHRPLEPPRPQEPHRPQEPPRPQEP----HRPQEPHRPLEPPRPQEQHRPQEPH 144 Query: 973 XP 978 P Sbjct: 145 RP 146 Score = 44.4 bits (100), Expect = 1e-04 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P PP P P PP P P P P PP Sbjct: 80 PLEPHRPQEPHRPLEPHRP--LEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRPQEQ 137 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPP-----XXPPPXPXXP 957 P P P P PP P P P P P PP P P Sbjct: 138 HRPQEPHRPLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHRPLEPPRPQEP 197 Query: 958 --PPXPXXP 978 P P P Sbjct: 198 HRPQEPHRP 206 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/122 (25%), Positives = 31/122 (25%), Gaps = 1/122 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P Sbjct: 11 PHRPQEPHRPLEPHRPQEPHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPHRPLEPHRPLE 70 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P P P P P P PP PP P P P Sbjct: 71 PHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLE 130 Query: 976 PP 981 PP Sbjct: 131 PP 132 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/106 (28%), Positives = 30/106 (28%), Gaps = 3/106 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP-XPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P PP P P PP Sbjct: 59 PHRPLEPHRPLEPHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQE 118 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPP 927 P P PP P P P P P P P P P Sbjct: 119 PHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRP 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/127 (27%), Positives = 35/127 (27%), Gaps = 10/127 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P PP P PP P P P P PP P P Sbjct: 86 PQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPHR 145 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXP--PPXPXX 954 P PP P P P P P P P P P P P Sbjct: 146 PLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHRPLEPPRPQEPHRPQEPHR 205 Query: 955 P--PPXP 969 P PP P Sbjct: 206 PLEPPRP 212 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 1/108 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P PP P P PP Sbjct: 56 PLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPQEPHRPL-EPHRPLEPPRPQEPHRPQEPP 114 Query: 799 XXXXP-PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P PP P P P P P PP Sbjct: 115 RPQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPP 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/117 (25%), Positives = 30/117 (25%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P Sbjct: 20 PLEPHRPQEPHRPLEPHRPLE--PHRPQEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEP 77 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P PP P P P P P PP P Sbjct: 78 HRPLEPHRPQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRP 134 Score = 39.9 bits (89), Expect = 0.003 Identities = 35/128 (27%), Positives = 35/128 (27%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P Sbjct: 35 PHRPLEPHRPQEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPQEPHRPLE 94 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXP--PPXPXXPPP 963 P PP P P P P P P P P P P P P P P Sbjct: 95 PHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQE 154 Query: 964 --XPXXPP 981 P PP Sbjct: 155 SHRPLEPP 162 Score = 38.7 bits (86), Expect = 0.007 Identities = 36/130 (27%), Positives = 36/130 (27%), Gaps = 10/130 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXPPXP----XPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P PP P P P Sbjct: 68 PLEPHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHR 127 Query: 784 PXXPPXXXXP-PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP--PPXPXX 954 P PP P P P P P P P P P P P Sbjct: 128 PLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHR 187 Query: 955 P--PPXPXXP 978 P PP P P Sbjct: 188 PLEPPRPQEP 197 Score = 36.7 bits (81), Expect = 0.029 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 9/122 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P Sbjct: 125 PHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEP-PRPQEQHRPLESHRPLEPTRPQ 183 Query: 799 XXXXP--PPXXXXP--PXPPPXP--PPXPPPXPXP-PPXXXXXPXXPXPPXXP--PPXPX 951 P PP P P P P PP P P P P P P P P P Sbjct: 184 ESHRPLEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPPKTLEPHRPQEPHRPQEPRRPL 243 Query: 952 XP 957 P Sbjct: 244 EP 245 Score = 35.9 bits (79), Expect = 0.050 Identities = 31/116 (26%), Positives = 31/116 (26%), Gaps = 5/116 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPP-PPPXPXPXPXP---PXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P P P P PP P P P P P PP P Sbjct: 143 PHRPLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHRPLEPPRPQEPHRPQE 202 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P PP P P PP P P P P P P P P P Sbjct: 203 PHRPLEPPRPQEQHRPQEPPKTL-EPHRPQEPHRPQEPRRPLEPHRQLEPHRPQEP 257 Score = 32.7 bits (71), Expect = 0.47 Identities = 27/121 (22%), Positives = 27/121 (22%), Gaps = 2/121 (1%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P PP P P PP P P P P Sbjct: 110 PQEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRPQEQHR 169 Query: 807 PXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P PP P P P P P P PP P Sbjct: 170 PLESHRPLEPTRPQESHRPLEPPRPQEPHRPQEPHRPLEPPRPQEQHRPQEPPKTLEPHR 229 Query: 981 P 983 P Sbjct: 230 P 230 Score = 32.7 bits (71), Expect = 0.47 Identities = 30/118 (25%), Positives = 30/118 (25%), Gaps = 5/118 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXP 795 P P P PP P P P P P P P P P Sbjct: 146 PLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHRPLEPPRPQEPHRPQEPHR 205 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXP--PPXPXXP 957 P P P PP P P P P P P P P P P P Sbjct: 206 PLEPPRPQEQHRPQEPPKTLEPHRPQEPHRPQEPRRPLEPHRQLEPHRPQEPHRPLEP 263 Score = 31.5 bits (68), Expect = 1.1 Identities = 27/119 (22%), Positives = 27/119 (22%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P P P P P P P P P P P Sbjct: 47 PHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPPRPQE 106 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P PP P P P P PP P Sbjct: 107 PHRPQEP-PRPQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRP 164 Score = 29.1 bits (62), Expect = 5.8 Identities = 27/119 (22%), Positives = 27/119 (22%), Gaps = 2/119 (1%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P PP P P P P P P P Sbjct: 128 PLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRPQEQHRPLESHRPLEPTRPQESHR 187 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXPXPP 977 P P P P P P P PP P P P P P P P P Sbjct: 188 PLEP----PRPQEPHRPQEPHRPLEPPRPQEQHRPQEPPKTLEPHRPQEPHRPQEPRRP 242 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -3 Query: 770 GXGGGXXGGGGX-GXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G GG G GG G G GGG G G GGG G G G GG G Sbjct: 388 GVSGMRRGRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G GG G GG GG GGG G GGG G G G GG Sbjct: 388 GVSGMRRGRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGG 436 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G GG G GGG G G G G GGGG G G Sbjct: 395 GRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGG 831 G G G GG G G G GGG G GG GGG GGG G Sbjct: 388 GVSGMRRGRGG--YRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRG 432 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 967 GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G G G G G G G GGG GG GGG G G G Sbjct: 388 GVSGMRRGRGGYRGRG-GRGGYRGRGGGRGYYRGGRGGGRGGGGRG 432 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXGGXGXG 711 G G GG GG GG G GGG G G GGG G G G G Sbjct: 391 GMRRGRGGYRGRGG----RGGYRGRGGGRGYYRGGRGGGRGGGGRGGRG 435 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG G GGG GGG GG G G G GGGG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGG-XGGGXGGXXXXGGGXXXXGGXXGGGG 774 GGG GG G G GGG G GGG GG G G G GG GG Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGG 82 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG G GGG GGGG G GG G G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG G GG G G G GGGG G GGG G G G Sbjct: 25 GGGGHG-GGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G G GGG GG GG GGG G G GG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGGKYN 85 Query: 710 XGXGG 696 GG Sbjct: 86 KWRGG 90 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GG GGG GG GGGG G GG G G G GG Sbjct: 26 GGGHGGGHGYGGGPNGGGGG-GGGGGGGGGDEDDSGKNGKEYSGKNKWNNGG 76 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G GGG GGG GGG GGG G G G G GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG----KNGKEYSGKNKWNNGGEYNN 80 Query: 743 GG 738 GG Sbjct: 81 GG 82 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GGG G GGG G GGG GGGG G G G GG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGG 82 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGG G GG G G GGGGG G G G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G GGG GG GGGG G GGG GG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G G GG GGG G GG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GGG G G GG GGG GG GGGG G G Sbjct: 26 GGGHGGGHGYG-GGPNGGGGG----GGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNN 80 Query: 692 GGXXXXGXGG 663 GG GG Sbjct: 81 GGKYNKWRGG 90 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GGG G GGG G GG G GG GGGG G G Sbjct: 28 GHGGGHGYGGGPNGGGGGGG--------GGGGGGGDEDDSGKNG 63 Score = 35.1 bits (77), Expect = 0.088 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG G GGG G GGG GG G G G G GG Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGG 76 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 978 GXGGXXGGXGXGGXGXXGXGGGXGXXXGXGGG 883 G GG GG G GG G G GGG G G GGG Sbjct: 25 GGGGHGGGHGYGG-GPNGGGGGGG-GGGGGGG 54 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -1 Query: 985 GGGGGXGXG--GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G G G GG G GG G G G G G GG GG Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGG 82 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = -3 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWS 567 GG G G G G GGG GG G G G GG S ++ W+ Sbjct: 25 GGGGHGGGHGYGGGP-----NGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWN 73 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 3/104 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 PPP P P P P P P P P PP P Sbjct: 1365 PPPMADPCATMAAPCAPPVMMAAPAPMLAPMLAPMPAPCAPPECHTHSVQVKQTHHMAPA 1424 Query: 838 XPPP--XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PPP PP P P PP PPP P PPP Sbjct: 1425 PPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCPPP 1468 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/79 (32%), Positives = 26/79 (32%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PPPP PP P P P PP PPP PP PPP Sbjct: 1423 PAPPPPMAFPPMP-PAPGQVITHLQHIVHHKILPPPPPPPAPPCPPPCHVQSTQHTVDHS 1481 Query: 913 XPXPPXXPPPXPXXPPPXP 969 P P P PP P Sbjct: 1482 W-APSPVSAPLPMAAPPSP 1499 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/105 (29%), Positives = 31/105 (29%), Gaps = 11/105 (10%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPX-----------PPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P PP PP P PP P PP P PPP Sbjct: 1423 PAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCPPPCHVQSTQHTVDHSW 1482 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP PP P PP PPP Sbjct: 1483 APSP--VSAPL-PMAAPPSPPQRIHHVHTIVHHHVHPPPPAPPPP 1524 Score = 35.5 bits (78), Expect = 0.067 Identities = 33/130 (25%), Positives = 33/130 (25%), Gaps = 7/130 (5%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXP-PPPPXXXPPXXPXXXXXXXXXXXXXXXX---PP 782 P P PP P PPPP PP P PP Sbjct: 1398 PMPAPCAPPECHTHSVQVKQTHHMAPAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPP 1457 Query: 783 XPXPXPPXPXXPXXXXPPPXXPX---PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 P P PP P P P P PP PP Sbjct: 1458 PPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHV---HTIVHHHV 1514 Query: 954 PPPXPXPPPP 983 PP P PPPP Sbjct: 1515 HPPPPAPPPP 1524 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXP-----PXPXPXPPXPXXPXXXXPPPXXPXP 854 PPPPP PP P P P P PP P Sbjct: 1455 PPPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHVHTIVHHHV 1514 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 P PP PPP P P P P P Sbjct: 1515 HPPPPAP--PPPVCMPMCAVAAPAPCPAACP 1543 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 17/81 (20%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXP-------PPPPXPXPXPXPPXPXPPPPXXP--------- 759 PP P P P PPP P P P P P PP Sbjct: 1455 PPPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHVHTIVHHHV 1514 Query: 760 -PPXPXPPPPXXPPXXXXPPP 819 PP P PPPP P P Sbjct: 1515 HPPPPAPPPPVCMPMCAVAAP 1535 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 12/90 (13%) Frame = +2 Query: 749 PXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXXXXXP-PPXPXXXPXPPPX 925 P PP P P P P P P PP P P PP Sbjct: 1378 PCAPPVMMAAPAPMLAPMLAPMPAPCAPPECHTHSVQVKQTHHMAPAPPPPMAFPPMPPA 1437 Query: 926 PXXPXP-----------PXPXPPXXPPXPP 982 P P P PP PP PP Sbjct: 1438 PGQVITHLQHIVHHKILPPPPPPPAPPCPP 1467 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P P PP PPP P PPP P P P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKE-PTPPPSSKPSPVKEIKPKKPIEKFISRPKPPT 984 Query: 955 PPP 963 PPP Sbjct: 985 PPP 987 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P PPP P PP PP P P P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPT-PPPSP-PPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPP 983 Query: 880 XPPP 891 PPP Sbjct: 984 TPPP 987 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = +1 Query: 655 PXPPPXPXXXXP-PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P PP PPP P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSP-PPKEPTPPPSSKPSPVKEIKPKKPIEKFISRP---K 981 Query: 832 PPXPPPXPPPXPPPXPXPP 888 PP PPP P P P Sbjct: 982 PPTPPPVVSPHKQTRPISP 1000 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 4/72 (5%) Frame = +1 Query: 688 PPPPPXPXPX----PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P P P P P P PPP P P P P P PP P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTP 985 Query: 856 PPXPPPXPXPPP 891 PP P P Sbjct: 986 PPVVSPHKQTRP 997 Score = 35.9 bits (79), Expect = 0.050 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXX 906 P P P P P PPP PPP P PPP P P P Sbjct: 928 PEPLPEVDIMRSPTPTPPPS--------PPPKE---PTPPPSSKPSPVKEIKPKKPIEKF 976 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP P P Sbjct: 977 ISRPKPPTPPPVVSPHKQTRPISP 1000 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX----PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P PP P P P PPP P P P P P PPP P P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSPHKQTRPIS 999 Query: 784 P 786 P Sbjct: 1000 P 1000 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP PP PPP P P P P PPP Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 11/77 (14%) Frame = +3 Query: 780 PXPXPXP-------PXPXXPXXXXPPPXXPXPPPXPPXXP----XPPPPXPPXXXXPXPX 926 P P P P P P P PPP P PPP P P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPTPP--PSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPP 983 Query: 927 PXPPXXPXXPPPXPXPP 977 PP P P Sbjct: 984 TPPPVVSPHKQTRPISP 1000 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P PP PP P PP P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSP 963 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 P P P PP P P P PP P P Sbjct: 1904 PQPLDVNTNSCPTPPREPTPPPPPPTPLP 1932 >SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) Length = 562 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/118 (28%), Positives = 34/118 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 244 GGCVASGGRVASGGRVASGGRVARGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 303 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 304 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 359 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/118 (28%), Positives = 34/118 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 262 GGRVARGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 321 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 322 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 377 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/118 (28%), Positives = 34/118 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 280 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 339 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 340 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 395 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/118 (28%), Positives = 34/118 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 298 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 357 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 358 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 413 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/118 (28%), Positives = 34/118 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 238 GGRVARGGCVASGGRVASGGRVASGGRVARGGRVASGGRVASGGRVASGGRVASGGRVAS 297 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 298 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 353 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/103 (29%), Positives = 30/103 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 316 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 375 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG GG G GG G Sbjct: 376 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASG 418 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/103 (29%), Positives = 30/103 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 322 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 381 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG GG G GG G Sbjct: 382 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASG 424 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/103 (29%), Positives = 30/103 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 328 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 387 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG GG G GG G Sbjct: 388 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASG 430 Score = 41.9 bits (94), Expect = 8e-04 Identities = 29/103 (28%), Positives = 29/103 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 334 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 393 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG GG G G G Sbjct: 394 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGARVASG 436 Score = 40.7 bits (91), Expect = 0.002 Identities = 33/118 (27%), Positives = 33/118 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GG G GG GG G GG GG Sbjct: 226 GGRVASGWRVASGGRVARGGCVASGGRVASGGRVASGGRVARGGRVASGGRVASGGRVAS 285 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG GG GG GG G GG GG G GG Sbjct: 286 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGG--RVASGGRVASGGRVASGG 341 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/103 (27%), Positives = 28/103 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 346 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 405 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG G GG G Sbjct: 406 GGRVASGGRVASGGRVASGGRVASGARVASGARVASGGRVASG 448 Score = 38.7 bits (86), Expect = 0.007 Identities = 29/105 (27%), Positives = 29/105 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 340 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVA-SGGRVA 398 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG GG GG GG G G G G Sbjct: 399 SGGRVASGGRVASGGRVASGGRVASGGRVASGARVASGARVASGG 443 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 352 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVAS 411 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG GG G G G GG Sbjct: 412 GGRVASGGRVASGGRVASGARVASGARVASGGRVASGG 449 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG G Sbjct: 376 GGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVASGGRVA-SGARVA 434 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G GG GG GG G Sbjct: 435 SGARVASGGRVASGGRVASSYRIPGGRG 462 >SB_14418| Best HMM Match : GRP (HMM E-Value=1.8) Length = 145 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG-GXGXGGGXXGGGGXG 732 G G G GGG G G G G G GGG G G G GGG G Sbjct: 70 GHGDGDGDGDSDGGGDGDGDGDGDGDSDSDGGGDGDGDGDGRWSMVDGDGDSDSDGGGDG 129 Query: 731 XG-GXGXGXGXGGG 693 G G G G G G G Sbjct: 130 DGDGDGDGDGDGDG 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG---GGGGX 684 G G G G GGG G G GGG G G G G G GGG Sbjct: 70 GHGDGDGDGDSDGGGDGDGDGDGDGDSDSDGGGDGDGDGDGRWSMVDGDGDSDSDGGGDG 129 Query: 683 XXXGXGGGXG 654 G G G G Sbjct: 130 DGDGDGDGDG 139 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 44.4 bits (100), Expect = 1e-04 Identities = 38/114 (33%), Positives = 38/114 (33%), Gaps = 17/114 (14%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXX---GGXGXXGXXXXXGGGXGXGGGXGGGXGGG----------- 840 G G GGG G GG GG G G G GGG GG GGG Sbjct: 494 GGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSG-GGGASGGRGGGTIELSIGNSLH 552 Query: 839 -XGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG--XGXGGXGXGXGXGGGGG 687 G GG G GG G G GG G G G GG GG Sbjct: 553 LDGQILNTGGNAESNSGGGSGGSILISATLFSGHGVISASGGAGSGTGGGGSGG 606 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXG--GGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGG G GG GG G G G GGG G GGG Sbjct: 494 GGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRGGG 541 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGG G GG GG G G G GG G GG GGG Sbjct: 499 GGGHGGEGGPSSLAAGGAGYG-SYLLPVHPGSGGGGASGGRGGG 541 Score = 32.3 bits (70), Expect = 0.62 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G GG GG GG GG G G G GGG GG G G G Sbjct: 490 GQEKGGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGG-GASGGRGGGTIELSIG 548 Query: 704 XGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G GG Sbjct: 549 NSLHLDGQILNTGGNAESNSGGGSGG 574 Score = 30.7 bits (66), Expect = 1.9 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 10/118 (8%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG-GXGXG 762 G GG G G GG G G G G GG GG GG G Sbjct: 490 GQEKGGTGSGGGHGGEGGPSSLAAG-GAGYGSYLLPVHPGSGGGGASGGRGGGTIELSIG 548 Query: 761 GG-XXGGGGXGXGGXGXGXGXGGGGG------XXXXGXG--GGXGXXGXGXXGGXXGG 615 G GG GG GG G G G G G GG GG Sbjct: 549 NSLHLDGQILNTGGNAESNSGGGSGGSILISATLFSGHGVISASGGAGSGTGGGGSGG 606 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGG-GXXXXGGXXGGGGXGXGGGXXGG 744 GG G G GG G G G G GG G G GG GG Sbjct: 88 GGSGAGHATLGGNGESLEGGLEYGSIYEPILAGAHGGSGPGGSGGRGGG 136 Score = 30.3 bits (65), Expect = 2.5 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 16/114 (14%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG GG G G G G G G GG G Sbjct: 879 GTGAGHGGEGAASQANTSGGLPYGSVYKPLDYGSGGGNGRGRGGAGGGLLHWRIGQEIEL 938 Query: 800 XG----GXXGGGGXGXGGGXXGG--------GGXG----XGGXGXGXGXGGGGG 687 G G G GGG G G G GG G G G GG GG Sbjct: 939 DGLLTLRGLNGTGTDSGGGSGGSILIECTNFTGYGEVNVQGGDGVGEGSGGAGG 992 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = -1 Query: 982 GGGGXGX---GGGXXGXXGGXGXGX--GXXXXGGXGGGGXGXXGGXGGG 851 GG G G GG GG G G GG G G GG GGG Sbjct: 88 GGSGAGHATLGGNGESLEGGLEYGSIYEPILAGAHGGSGPGGSGGRGGG 136 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G GG G G G G G G G GG G Sbjct: 76 GFFSGSGRNSSSGGSGAGHATLGGNGESLEGGLEYGSIYEPILAGAHGGSGPGGSGGRGG 135 Query: 617 G 615 G Sbjct: 136 G 136 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 G GGG G GG G G G G G G G G GG Sbjct: 497 GSGGGHGGEGGPSSLAAG-GAGYGSYLLPVHPGSGGGGASGGRGG 540 Score = 28.7 bits (61), Expect = 7.6 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 3/95 (3%) Frame = -3 Query: 890 GGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGX--GXGGGXXGGGGXGXGGX 720 G G G GG G GGG GG GG G G G G GGG G G Sbjct: 484 GMGPAPGQEKGGTGSGGGHGGE---GGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRGG 540 Query: 719 GXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GG GG Sbjct: 541 GT-IELSIGNSLHLDGQILNTGGNAESNSGGGSGG 574 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G G GGG G G GG Sbjct: 877 GVGTGAGHGGEGAASQANTSGGLPYGSVYKPLDYGSGGGNGRGRGGAGGG 926 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP-XXPPXXXXPPPXXXXPPXPPP 849 P PPP P P P P PPP P P P P PPP P Sbjct: 505 PSDVAESPPPIP-PIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTER 563 Query: 850 XPPPXPP 870 PPP PP Sbjct: 564 RPPPLPP 570 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP P PPPP P P PP P P P PP Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPA 571 Query: 892 XXXXXPXXPXPPXXP 936 P P P Sbjct: 572 PKRALDLKPNLPPVP 586 Score = 37.1 bits (82), Expect = 0.022 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 2/82 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPP--PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P PPP P P P P PP P P P P PP P Sbjct: 505 PSDVAESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERR 564 Query: 814 PPXXXXPPXPPPXPPPXPPPXP 879 PP P P PP P Sbjct: 565 PPPLPPAPKRALDLKPNLPPVP 586 Score = 36.7 bits (81), Expect = 0.029 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 4/84 (4%) Frame = +1 Query: 616 PPXXPPXX----PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP PP P P PP PPP P P P PPP P P Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPP------PPPVPKPQFDDTPTRAPPPPDMQTNPDTERRP 565 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXP 855 P PP P P PP P Sbjct: 566 PPLPP---APKRALDLKPNLPPVP 586 Score = 36.7 bits (81), Expect = 0.029 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 6/73 (8%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXP-----PPXPXPPPXXXXXPXXP-XPPXXPPP 942 PP PP P PPP P P P P PPP P PP PP Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPA 571 Query: 943 XPXXPPPXPXXPP 981 P PP Sbjct: 572 PKRALDLKPNLPP 584 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +3 Query: 831 PPPXXPXP------PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P P P P PP P P P P PP P PPP Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPP 567 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P PP P P P P PP P P PP P P Sbjct: 513 PPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAP 572 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXP-XPXPPXXPXXPPPXPXP 974 PP P P P PP PP P P P P P P PPP P Sbjct: 513 PPIPPIRCSSVSRPVRPTGPP-PPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPA 571 Query: 975 P 977 P Sbjct: 572 P 572 Score = 32.3 bits (70), Expect = 0.62 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PP P P PP PPP P P PP P Sbjct: 505 PSDVAESPPPIPPIRCSSVSRPVRPTGPP----PPPVPKPQFDDTPTRAPPPPDMQTNPD 560 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P Sbjct: 561 TERRPPPLPPAPKRALDLKPNLPPVP 586 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P PPP PP P P P PPP P P Sbjct: 505 PSDVAESPPPIPPIRCSSVSRPVRPTGP-PPPPVPKP 540 >SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 1/100 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXPPP 849 P P PPP P P P PP P P PP P P P PP Sbjct: 2 PPATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPEVDPILPEIDPIPPD 61 Query: 850 XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P Sbjct: 62 ITPIDPTPPCADPIPAVADPIPPNMEPIPDSIPKGTNPIP 101 Score = 38.3 bits (85), Expect = 0.009 Identities = 31/105 (29%), Positives = 31/105 (29%), Gaps = 10/105 (9%) Frame = +1 Query: 640 PXPXXPXPP----PXPXXXXPPPPP----XPXPXPXPPXPXPPPPXXPP--PXPXPPPPX 789 P P PP P P P PP P P PP P P P P P PP Sbjct: 2 PPATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPEVDPILPEIDPIPPD 61 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P PP P P PP P P P P Sbjct: 62 ITPIDPTPPCADPIPAVADPIPPNMEPIPDSIPKGTNPIPLRSDP 106 Score = 36.7 bits (81), Expect = 0.029 Identities = 24/92 (26%), Positives = 24/92 (26%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P PP P P P P P PP P P P P P Sbjct: 3 PATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPEVDPILPEIDPIPPDI 62 Query: 886 PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P Sbjct: 63 TPIDPTPPCADPIPAVADPIPPNMEPIPDSIP 94 Score = 35.9 bits (79), Expect = 0.050 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 4/92 (4%) Frame = +1 Query: 718 PXPPXPXPPPPXXP-PPXPXPPPPXXP---PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P PPP P PP P PP P PP P P P P P P Sbjct: 2 PPATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDIN--PILPEVDPILPEIDPIP 59 Query: 886 PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP P P P P Sbjct: 60 P---DITPIDPTPPCADPIPAVADPIPPNMEP 88 Score = 31.9 bits (69), Expect = 0.82 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 4/109 (3%) Frame = +3 Query: 669 PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXP 848 P PPP PP PP P P P P P Sbjct: 2 PPATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPE-VDPIL---PEIDP 57 Query: 849 XPPPXPPXXPXPPPPXP-PXXXXPXP---XPXPPXXPXXPPPXPXPPPP 983 PP P P PP P P P P P P P P P P Sbjct: 58 IPPDITPIDPTPPCADPIPAVADPIPPNMEPIPDSIPKGTNPIPLRSDP 106 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG--XGGXGXGXGXG 699 G G GG GG GG GGG G GGG GG G G G G Sbjct: 1240 GSRNRGRRHGGGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFA 1299 Query: 698 GGGGXXXXGXGGGXG 654 G GG GGG G Sbjct: 1300 GYGGQYGGPRGGGSG 1314 Score = 37.9 bits (84), Expect = 0.012 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 1/76 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXX 786 G G G GG GG GG GGG G G GG GG G Sbjct: 1240 GSRNRGRRHGGGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFA 1299 Query: 785 GGGGXGXGGGXXGGGG 738 G GG GG GG G Sbjct: 1300 GYGGQ-YGGPRGGGSG 1314 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGGGXGXXG 645 GGG G GGG GGGG G G G G GG GG G GG G Sbjct: 1251 GGGAFSSRDYRQHRGGSSGGGMHGGGG-GYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPR 1309 Query: 644 XGXXG 630 G G Sbjct: 1310 GGGSG 1314 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG--XXGGXGGGXG 845 GGG GGG G GG G G G GG G G G G GGG G Sbjct: 1269 GGGMHGGGGGYGNYGGYG-GYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GG G G GGG G GG GG G GG G G G Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPR 1309 Query: 788 XGGGG 774 GG G Sbjct: 1310 GGGSG 1314 Score = 35.9 bits (79), Expect = 0.050 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG G GGG G GG G G GG GG G G G Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGGGMHGGGGGY--GNYGGYG-GYGGNPQGGYGFAGYGGQYG 1306 Query: 710 XGXGGGGG 687 GGG G Sbjct: 1307 GPRGGGSG 1314 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG 864 GG G GG G GG GG G G GG G G G Sbjct: 1276 GGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 35.5 bits (78), Expect = 0.067 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 1/68 (1%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GGG G G GGGG G GG GG G GG G G Sbjct: 1245 GRRHGGGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQ 1304 Query: 802 GGXGXGXG 779 G G G Sbjct: 1305 YGGPRGGG 1312 Score = 35.5 bits (78), Expect = 0.067 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 GG G GGG GG GG G G G G GG GG GGG G Sbjct: 1270 GGMHGGGGGYGNYGG--YGGYG--GNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 34.7 bits (76), Expect = 0.12 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXG---GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 G G GGGG GG G G G G G G GG G G G G Sbjct: 1240 GSRNRGRRHGGGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYG-GNPQGGYGF 1298 Query: 641 GXXGGXXGG 615 GG GG Sbjct: 1299 AGYGGQYGG 1307 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 734 GXGGXGXGXGXGGGGGXXXX-GXGGGXGXXGXGXXGGXXGG 615 G GG GGGGG G GGG G G GG G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYSG 833 Score = 32.3 bits (70), Expect = 0.62 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = -3 Query: 869 GGXGGGXGG-GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GG G G G GGGG G G GGG G GG G G Sbjct: 775 GGYGGPPRDQNWGRDPREGWGGNRDNYSRGGGG-GYNRGYGSGGGYGGGGYNKRGGRYSG 833 Query: 692 GGXXXXGXGG 663 G G Sbjct: 834 GSNWGSSPAG 843 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GGGG G G G G GGGG G G G G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWGSSPAG 843 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 922 GXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 G G GGG G G G G G GGG G GG G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYSGGSNWG 838 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G GG GG GG G GG GGGG GG GG Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGS----GGGYGGGGYNKRGGRYSGG 834 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 G G GGG G G G G G G GG GG Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGG 829 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G GG G G GGG G GGG G GG G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYG------GGGYNKRGGRYSGGSNWG 838 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSX 582 GG G G G GG G GGG G G GG GG S Sbjct: 775 GGYGGPPRDQNWGRDPREGWGGNRDNYSRGGGGGYN-RGYGSGGGYGGGGYNKRGGRYSG 833 Query: 581 RSTW 570 S W Sbjct: 834 GSNW 837 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG-GXGXGGGXXGGGG 738 GG G G G G G G G G G G GG GGG G G GG G G Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXG 654 G G G G G G G G G G G G G G GG GG G GG G Sbjct: 210 GDGGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVG 258 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G G G G G G G G G G G G GGG G G G G Sbjct: 210 GDGGDGNGDGEGEGEGEGDGD---GDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXGXG 705 GG G G G G G G G G G GGG GG G G GG G G G Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDG-GGGDGGGDGDGDDGGVGDGDG 262 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 869 GGXGGGXGGGXG-GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GG G G G G G G G G GGGG G G G GG G G Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDG 260 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G GG G G G G G G GGG GGG G G G G G Sbjct: 210 GDGGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG--GXGXXGGXGGGXG 845 G G G G G G G G G G G GG GG G G GG G G G Sbjct: 215 GNGDGEGEGEGE-GDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG G G G G G G G G GGG GG G G G G G Sbjct: 210 GDGGDGN-GDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDG 260 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG-XXXXGXXGXGGXGXGXG 779 GG G G G G G G G G G G G GGG G GG G G G Sbjct: 212 GGDGNGDGE---GEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 7/122 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXX 792 P P P P P P P P P P P P P Sbjct: 123 PGQQPGGPPPSYDSTMQQGGSYPPGQQPYPGQQAYPGQPGASPQGQPYPGQSYPQGQEPY 182 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPX--PPPXPXPPPXXXXXPXXPXPPXXPPP---XPXXP 957 P PP P P P PPP PPP P PP PPP P P Sbjct: 183 PEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPP--PPPGAGDPAYP 240 Query: 958 PP 963 PP Sbjct: 241 PP 242 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 1/87 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P PP P P P PPP PPP Sbjct: 161 PGASPQGQPYPGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGG 220 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP PP PP P P PPP Sbjct: 221 PPGGYPPP-----PPPPGAGDPAYPPP 242 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P P PPP PP P PPPP PP P P Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P PP P P P P P PP P P PPP Sbjct: 171 PGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPP 230 Query: 981 P 983 P Sbjct: 231 P 231 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P P PP PP PP P P P P PPP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P PP P P PP P Sbjct: 176 PQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAG 235 Query: 957 PPXPXPP 977 P PP Sbjct: 236 DPAYPPP 242 >SB_504| Best HMM Match : GRP (HMM E-Value=2.8) Length = 107 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GGG G G G GGGG G GG GGGG G GG GGG Sbjct: 21 GGGSDGVGGDDDGDDDDSG--GGGGDGVGGDDDGGGGDGCGGDDDSDDDDGGG 71 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G GG G G G G G GGG GG GGG Sbjct: 21 GGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGGDDDSDDDDGGG 71 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG G GG GGG G GGGG G GG G G Sbjct: 21 GGGSDGVGGDDDGDDDDSGG----GGGDGVGGDDDGGGGDGCGGDDDSDDDDGGGDDNDD 76 Query: 710 XG 705 G Sbjct: 77 NG 78 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG G GG G G GG G GGG G G GG Sbjct: 16 GDDDDGGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGGDDDSDDDDGG 70 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G GGG GG G GGG G GG GG G G GG GGG Sbjct: 16 GDDDDGGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGC---GGDDDSDDDDGGG 71 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -3 Query: 956 GXXGXGGGXXGGXG---XXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G GGG G G GGG G GG GG G G GG Sbjct: 16 GDDDDGGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGG 60 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G G G GGG G G GG GGG G G G G Sbjct: 23 GSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGGDDDSDDDDGGGDDNDDNG 78 Score = 29.5 bits (63), Expect = 4.4 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGG-----GXGGGXG-GXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G GG G GG G G GGG G G GGG GG GG Sbjct: 16 GDDDDGGGSDGVGGDDDGDDDDSGGGGGDGVGGDDDGGGGDGCGGDDDSDDDDGGGDDND 75 Query: 746 GGG 738 G Sbjct: 76 DNG 78 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GGG G GG G G G GG GG Sbjct: 3219 GGYSAGGGGGGAGGAAYAEMTTTTYTESYAAYSTVSGTGASGSGAAVGGAGGAGGASAYM 3278 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G G G G GGGGG Sbjct: 3279 MSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGGG 3315 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/117 (26%), Positives = 31/117 (26%), Gaps = 6/117 (5%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX------GGGXXXXGGXX 786 G GGG G GG GGG GG G G Sbjct: 3199 GEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGGAAYAEMTTTTYTESYAAYSTVSGTGA 3258 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG GG G G G G G GG G G GG Sbjct: 3259 SGSGAAVGGAGGAGGASAYMMSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGGG 3315 Score = 32.3 bits (70), Expect = 0.62 Identities = 31/108 (28%), Positives = 31/108 (28%), Gaps = 18/108 (16%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXG---GGXXXXGGXXGGGGXGXG--------------GG 756 G G G GGG GG G GG GG G GG Sbjct: 3193 GDEDGAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAGGAAYAEMTTTTYTESYAAYST 3252 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG-GXXGG 615 G G G G G G GG GG G G G GG Sbjct: 3253 VSGTGASGSGAAVGGAGGAGGASAYMMSASGGGAAGSSGSIGAGAAGG 3300 Score = 32.3 bits (70), Expect = 0.62 Identities = 29/103 (28%), Positives = 29/103 (28%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G GGG GG G G G G G GG Sbjct: 3219 GGYSAGGGGGGAGGAAYAEMTTTTYTESYAAYSTVSGTGASGSGAAVGGAGGA--GGASA 3276 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG G G G G G G G GGG G Sbjct: 3277 YMMSASGGGA--AGSSGSIGAGAAGGAGAVAAVAVSGGGGGGG 3317 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG GG G G G G GG G G GGG Sbjct: 3266 GGAGGAGGASAYMMSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGGGGG 3317 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-PXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PP P P P P PP P PP P PP PP PP P P P Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGM 441 Query: 868 PP 873 PP Sbjct: 442 PP 443 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXX 792 PP P P P P P P PP P PP P PP P PPP Sbjct: 369 PPLDSMRDMGPGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHG 428 Query: 793 PPXXXXPPPXXXXPPXPP 846 P P PP P Sbjct: 429 GPPRGPMGPGPGMPPMRP 446 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +1 Query: 664 PPXPXXXXPPPPPX-PXPXPXPPXPXPPPPXXPPPXPXPP-PPXXPPXXXXPPPXXXXPP 837 P P PP P P P PP P PP PP P PP PP P Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPP---RGPM 435 Query: 838 XPPPXPPPXPP 870 P P PP P Sbjct: 436 GPGPGMPPMRP 446 Score = 36.7 bits (81), Expect = 0.029 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PP P PP PP P P P P PP PP P Sbjct: 369 PPLDSMRDMGPGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHG 428 Query: 919 XPPXXPP-PXPXXPPPXP 969 PP P P P PP P Sbjct: 429 GPPRGPMGPGPGMPPMRP 446 Score = 36.7 bits (81), Expect = 0.029 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PP 873 P P P P P P PP P PP PP PP P PP P P Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPP-PHGGPPRGPMGP 437 Query: 874 XPXPPP 891 P PP Sbjct: 438 GPGMPP 443 Score = 36.3 bits (80), Expect = 0.038 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPPXXXXXP 909 P PP PP P P PP P P PP P PPP PP P Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPP-HGGPPRGPMGP 437 Query: 910 XXPXPPXXP 936 PP P Sbjct: 438 GPGMPPMRP 446 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP-- 861 PP P P PP P P P P PP PP P PPP Sbjct: 369 PPLDSMRDMGPGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHG 428 Query: 862 XPPPXPXPP 888 PP P P Sbjct: 429 GPPRGPMGP 437 Score = 32.3 bits (70), Expect = 0.62 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P P P P P PP P P P PP P P Sbjct: 382 PPRGMP-PKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGP---RGPPPHGGPPRGPMGP 437 Query: 957 PPXPXPPPP 983 P P P Sbjct: 438 GPGMPPMRP 446 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXX 903 PP PP P P PP PP P P PP PP P Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGM 441 Query: 904 XPXXP 918 P P Sbjct: 442 PPMRP 446 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXP----PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP P P P P P P PP P PPP P Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPP 431 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPX-PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP PP P P P PP P PP P PP Sbjct: 369 PPLDSMRDMGPGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPP 425 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PP P P P P P P PP P PPP Sbjct: 379 PGFP-PRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPP 426 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 43.6 bits (98), Expect = 3e-04 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 3/116 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PPP PP P P P P P P P PP P P Sbjct: 655 PLPKNRYPPPYKQVP-PPYKQVPHPYKQVPHPYKQVPAPYKQVPLPYKQVPPPYKQVPHP 713 Query: 820 XXXXPPXPPPXPPP---XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PPP P P P PPP P P P Sbjct: 714 YKQVPATYKQVSPPFKQVPPPYKQVPHPYKQVP--PPYKQVPPPYKQVPHPYKQVP 767 Score = 43.6 bits (98), Expect = 3e-04 Identities = 38/124 (30%), Positives = 38/124 (30%), Gaps = 16/124 (12%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXP----PPPXXPPPXPXPPPP--- 786 P P PPP P P P P P P P PPP P P P Sbjct: 662 PPPYKQVPPPYKQVPHPYKQVPHPYKQVPAPYKQVPLPYKQVPPPYKQVPHPYKQVPATY 721 Query: 787 --XXPPXXXXPPPXXXXPPXPPPXPPP---XPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PPP P PPP PPP P P P P P Sbjct: 722 KQVSPPFKQVPPPYKQVPHPYKQVPPPYKQVPPPYKQVPHPYKQVP-APY-KQVPAPYKQ 779 Query: 952 XPPP 963 PPP Sbjct: 780 VPPP 783 Score = 39.9 bits (89), Expect = 0.003 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 4/109 (3%) Frame = +1 Query: 667 PXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP- 834 P P P P P P PP PPP P P P P P P P Sbjct: 641 PLPTNRYPIPTNRYPLPKNRYPPPYKQVPPPYKQVPHPYKQVPH--PYKQVPAPYKQVPL 698 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P PPP P P PP Sbjct: 699 PYKQVPPPYKQVPHPYKQVPATYKQVSPPFKQVPPPYKQVPHPYKQVPP 747 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXP 771 PPPP P P PP P P PPP P Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PPP P PP PPP P PPP Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPP 729 P PPP P PPPPP P PP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXP 923 P P P PPP PPP P P PPPP P P Sbjct: 182 PGSPTEDTPWTSVPPP----PPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXP----XPPPP 750 PPPPP P P PP P PPPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P PPPPP P P PPPP P PPP Sbjct: 190 PWTSVPPPPP-----PGPGGIPPPPPPIRGGVPPPPP 221 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P PP P PP P P PP PPP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPP----PPP 221 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P P P P PP P P PPP P PPP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIP--PPPPPIRGGVPPPPP 221 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P PPPP P PPP PPP P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P PPP PP PPP PP P P Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPP 704 PP PP P P P PPPPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P P PPP PPP P P P PP PP PPP Sbjct: 185 PTEDTPWTSVPPP------PPPGPGGIPPPPPPIRGGVPP--PPP 221 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P PPPP P P P P P PPP P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPP--PIRGGVPPPPP 221 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 890 PXPXXXPXPPPXPX-XPXPPXPXPPXXPPXPP 982 P P PPP P P PP P PP PP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P PPP P PPP PP PPP P Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPP---PPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP 699 P PP P P PPP PPPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXP-XPXPPXXPXXPPP 962 P P P P PPP P P PP P P P PPP Sbjct: 690 PAPYKQVPL-PYKQVPPPYKQVPHPYKQVPATYKQVSPPFKQVPPPYKQVPHPYKQVPPP 748 Query: 963 XPXPPPP 983 PPP Sbjct: 749 YKQVPPP 755 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P P P P P P PPP P PPPP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXP 924 PP PPP P P PPP P P Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 1/57 (1%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXP-XPXPPXXPXXPPPXPXPPPP 983 P PPP P P P PP P P P P P PPP Sbjct: 727 PFKQVPPPYKQVPHPYKQVPPPYKQVPPPYKQVPHPYKQVPAPYKQVPAPYKQVPPP 783 >SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 43.6 bits (98), Expect = 3e-04 Identities = 31/106 (29%), Positives = 31/106 (29%), Gaps = 5/106 (4%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX--PXPPPPXXPPPXPXPPPPXX-PPXXXX 810 P P P P P P P P P P P P PP Sbjct: 782 PPPQVDIMNPLALLGMNPVIPNTYPSPLNPAFQSSTPDVNAVPSAPYPQASGVAPPYPLY 841 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPP 942 P PP P PPP P P PP P PP PPP Sbjct: 842 TPADAAFPPAQAPYPPPYPTPAGGYPPDQGGYPLQTMGPPPDAPPP 887 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPX-PPPXPXXXXPPPPPXPXPXPX-PPXPXPPPPXXP-PPXPXPPPPX 789 P P P P P P P P P PP P P PP P PP Sbjct: 799 PVIPNTYPSPLNPAFQSSTPDVNAVPSAPYPQASGVAPPYPLYTPADAAFPPAQAPYPPP 858 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P PP P PPP PP Sbjct: 859 YPTPAGGYPPDQGGYPLQTMGPPPDAPP 886 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP--XXPXPPXXPPPXPX 951 P P P P P P P PP P P P P PP P P Sbjct: 806 PSPLNPAFQSSTPDVNAVPSAPYPQASGVAPPYPLYTPADAAFPPAQAPYPPPYPTPAGG 865 Query: 952 XPPPXPXXP 978 PP P Sbjct: 866 YPPDQGGYP 874 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXX-PXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXXPPPX 965 P P P P P P PP PPP P P P P PPP Sbjct: 824 PSAPYPQASGVAPPYPLYTPADAAFPPAQAPYPPPYPTPAGGYPPDQGGYPLQTMGPPPD 883 Query: 966 PXPP 977 PP Sbjct: 884 APPP 887 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP-PXPXPP 888 P P P P P P PP P PP P P P P Sbjct: 802 PNTYPSPLNPAFQSSTPDVNAVPSAPYPQASGVAPPYPLYTPADAAFPPAQAPYPPPYPT 861 Query: 889 PXXXXXPXXPXPPXXP-PPXPXXPPP 963 P P P P P PPP Sbjct: 862 PAGGYPPDQGGYPLQTMGPPPDAPPP 887 Score = 29.5 bits (63), Expect = 4.4 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 3/82 (3%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP--PPXPPPXPPPX-PXPPPXXXXXPX 912 P P P P P P PP P P PP P PPP Sbjct: 806 PSPLNPAFQSSTPDVNAVPSAPYPQASGVAPPYPLYTPADAAFPPAQAPYPPPYPTPAGG 865 Query: 913 XPXPPXXPPPXPXXPPPXPXXP 978 P P PPP P Sbjct: 866 YPPDQGGYPLQTMGPPPDAPPP 887 >SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGG 693 G G G G G G G G G G G G GGG G G G G G G G G Sbjct: 769 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXG 711 G G G G G G G G G G G G G GGG G G G G G G G Sbjct: 769 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 Score = 37.5 bits (83), Expect = 0.017 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G G G G G G G G G G G G G G GGG G G G G Sbjct: 769 GDGDGDGDGDGDGDGD-GDGDGDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G G G G G G G G G G G G G GGG G G G G G Sbjct: 771 GDGDGD-GDGDGDGDGDGD-GDGDGDGDGDGAGAGDGGGDGDGDGDGDGDGDG 821 Score = 36.3 bits (80), Expect = 0.038 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 G G G G G G G G G G G G G GGG G G G G G G Sbjct: 771 GDGDGDGDGD-GDGDGDGDGDGD-GDGDGDGAGAGDGGGDGDGDGDGDGDGDGAG 823 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G G G G G G G G G G G G G G GGG G G G G G Sbjct: 769 GDGDGDGDGD-GDGDGDGDGDGDGDGDGDGDGAGAG----DGGGDGDGDGDGDGDGDGAG 823 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P PP P PP P PP P P P P P P P Sbjct: 143 PSPPNPTEAPEPET-VPPQPETVPPQPETVPP--QPGSEEPEPVSQAPEPPKPKTSAPEP 199 Query: 871 PXP 879 P P Sbjct: 200 PKP 202 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P P P P P PP P PP P P PP P PP Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPP 200 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +1 Query: 718 PXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P P P PP P PP P P P PP P PP Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPP 200 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPP-PXPXPP-PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P P P P PP P PP P PP P PP P P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXX-PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P P PP PP PP P P P PP P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +3 Query: 792 PXPPXPXX-PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PP P P PP PP P P P P P P P PP P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P P P P P PP P P P P PP P P P P Sbjct: 148 PTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.5 bits (78), Expect = 0.067 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P P PP P P PP P P P P PP P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 35.1 bits (77), Expect = 0.088 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPP---PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P PP P P P P P P P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAP 197 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P PP P P P P P P P P P PP Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPP 200 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP---PPXPXP-XPXPPXPXPPPPXXPPPXPXPPPP 786 P P P PP P P P PP P P P P PP P PP P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 145 PPNPTEAPEPETVPPQPETVPPQPETVP-PQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 814 PPXXXXPPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP P P PP P PP PP P PP P P P P Sbjct: 145 PPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 936 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G G GGG G GG G G G GG G GG G G G Sbjct: 490 GDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGCG 549 Query: 710 XGXGGGGG 687 GGG Sbjct: 550 CDESSGGG 557 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 10/69 (14%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG----------XXGGGGXGXGGX 720 GG GGG G GG G G G GG G GGG GGGG G Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGC 548 Query: 719 GXGXGXGGG 693 G GGG Sbjct: 549 GCDESSGGG 557 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG-XGGGGGXXXXGX 669 GG GG G G G G G GGG G G G G G GGGG G Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGC 548 Query: 668 G 666 G Sbjct: 549 G 549 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGG G G G G G GG G GGG G G GG Sbjct: 490 GDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGG 541 Score = 32.7 bits (71), Expect = 0.47 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX-GGGXGGXXXXGGGXXXXGGXXGGGGXGX 765 GG G G G G G GGG G GG G G G G G Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGC 548 Query: 764 GGGXXGGGG 738 G GGG Sbjct: 549 GCDESSGGG 557 Score = 31.9 bits (69), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG-XGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGG G GGG GG G G G GGG G G G G Sbjct: 492 GGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGCGCD 551 Query: 808 GXGGXG 791 G G Sbjct: 552 ESSGGG 557 Score = 31.5 bits (68), Expect = 1.1 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Frame = -3 Query: 968 GXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXG 795 G GGG G GGG G G G G G G GGG G G GGG Sbjct: 490 GDGGGDDDGDGGGDDDGDGGVDDD---GDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDV 546 Query: 794 GXXGGGGXGXGGG 756 G G GGG Sbjct: 547 GC--GCDESSGGG 557 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GGG G G G G G GGG G G G G Sbjct: 489 GGDGG-GDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVG 547 Query: 746 GGGXGXGGXG 717 G G G Sbjct: 548 CGCDESSGGG 557 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGX 642 GG GGG GG G G G G G G G GGG G Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGC 548 Query: 641 GXXGGXXGG 615 G GG Sbjct: 549 GCDESSGGG 557 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P PP P P PP P Sbjct: 309 PSEPESSNKSSEPDSTPATNAP-PSDSPSTTTPTTPQPPTPTTPKTHPQ-----LGPPPP 362 Query: 844 PPXPPPXPPP 873 PP PPP PPP Sbjct: 363 PPPPPPTPPP 372 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PP P P P PP P P P PPP P PPP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P PP P P PPPP PPP P PPP Sbjct: 331 PSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPP-PPPPPTPPP 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP--XPPPPXXPPXX 804 P P P PP P P PP P P P PPPP PP Sbjct: 309 PSEPESSNKSSEPDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 Query: 805 XXPP 816 PP Sbjct: 369 TPPP 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P P P P PP P P P P PPPP PPP P P Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPP--PPPTPPP 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P P P P PP P PPPP PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 P P P P PP P P PP P PPP PPP Sbjct: 309 PSEPESSNKSSEPDSTPATNAPPSDSPSTTT--PTTPQPPTPTTPKTHPQLGPPPPPPPP 366 Query: 877 PXPPP 891 P PP Sbjct: 367 PPTPP 371 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P P P P P P P PPPP PP PPP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP---TPPP 372 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP 890 P P P P P P PPP PP P PPP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP P P P P P PP PPP P PP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P P P P P P P P PP PPP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P PP PPP P PPP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPP--PPPPPPTPPP 372 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P P P P P P P PP P P PPP P Sbjct: 309 PSEPESSNKSSEPDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPP-----PP 363 Query: 913 XPXPPXXPP 939 P PP PP Sbjct: 364 PPPPPTPPP 372 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPX--PPXXPPPXPXXPPPXPXXPP 981 PP P P P P P PPP P PPP P PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPP--PPPPPTPPP 372 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P P P P P P PPPP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPP 363 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P P P P PPP P PP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PPPP P P PP P PPP PP P P P P Sbjct: 95 PPPPATPPPPTMPPTP-PPPQTPAPPGPDTPAPPAP 129 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPP PPPP PP PPP PP P PP P Sbjct: 95 PPPPATPPPPTMPP--TPPPPQTPAPPGPDTPAPPAP 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PPPP PPP PP P P P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 PPP P PP PP P P P PP P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAP-PAP 129 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PP P PPP PP P PP PP P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P P P PP P PPPP P P P P P PP P Sbjct: 96 PPPATPPPPTMPPT--PPPPQTPAP-PGPDTPAPPAP 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXP 771 PP P PPPP P P P P PP P P PP P Sbjct: 95 PPPPAT--PPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP PP P P PPP P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P PP P PP P P P PP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PPPP P PPP P PP P P P P PP Sbjct: 95 PPPPATP-----PPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXP-PPXPXPPPP 983 PPPP P P P PP P P P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 PP P P PPP P PP PP P PP P P P Sbjct: 95 PPPPATP----PPPTMPPTPP-PPQTPAPPGPDTPAPPAP 129 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PPP PP PP PPP P P PP P P Sbjct: 96 PPPATPPPPTMPPTPPP--PQTPAPPGPDTPAPPAP 129 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PP PPPP PP P P P P PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PPP P PPP P P P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 PPP P PP P P P P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P P PP P P PPP P PP P P PP P Sbjct: 95 PPPPATPPPPTMPPTP-PPPQTPAPPG--PDTPAPPAP 129 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PP P PPP P P P P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 P P P P P PP P PP P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAP-PAP 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 PP P P PP P P PP P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGP-DTPAPPAP 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 858 PXPPXXPXPP--PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PP P PP PP PP P P PP PP P Sbjct: 95 PPPPATPPPPTMPPTPP----PPQTPAPPGPDTPAPPAP 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 PP PPP P P PPPP P P P PP Sbjct: 95 PPPPATPPP-PTMPPTPPPPQTPAPPGP-DTPAPP 127 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP 714 PP PP P P PP P P P P P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P PP PP PP P P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PPP P P P P P PP P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P PPP P P P P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHTRIVGGTKAPPGAWP 152 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 719 PXPXXPXPPP-PXXPPPXXXPPXPXXXPXXPXXPXP 823 P P P PP P PPP P P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPP--GPDTPAPPAP 129 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 43.6 bits (98), Expect = 3e-04 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG GG G G G G G G G GG Sbjct: 369 GGSSGGGFGSSMTNGFGGASGLTNGDDSGRRKGFGRGSRTDTLPKSDSKPGGAFGGSSGG 428 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G G GG G G G G G GGG Sbjct: 429 GFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 Score = 41.9 bits (94), Expect = 8e-04 Identities = 33/95 (34%), Positives = 33/95 (34%), Gaps = 4/95 (4%) Frame = -3 Query: 959 GGXXGXGGGXX---GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 GG G G G G G G G G G G GG GG Sbjct: 369 GGSSGGGFGSSMTNGFGGASGLTNGDDSGRRKGFGRGSRTDTLPKSDSKPGGAF---GGS 425 Query: 788 XGGGGXGXGGGXXGGGGXGX-GGXGXGXGXGGGGG 687 GGG G GG GG G GG G G GGGG Sbjct: 426 SGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGG 460 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/80 (31%), Positives = 25/80 (31%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G GG GG GG G G Sbjct: 383 GFGGASGLTNGDDSGRRKGFGRGSRTDTLPKSDSKPGGAFGGSSGGGFGGSSGGSFGGSS 442 Query: 797 GGXXGGGGXGXGGGXXGGGG 738 GG GG G G GGGG Sbjct: 443 GGSFGGSGFGSKSSGGGGGG 462 Score = 37.5 bits (83), Expect = 0.017 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 7/97 (7%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX-------GGGXXGGGGXGXG 726 G GGG G G GG G G G G G GG G Sbjct: 369 GGSSGGGFGSSMTNGFGGASGLTNGDD--SGRRKGFGRGSRTDTLPKSDSKPGGAFGGSS 426 Query: 725 GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GG G G GG G G GG GG Sbjct: 427 GGGFGGSSGGSFGGSSGGSFGGSGF-GSKSSGGGGGG 462 Score = 36.7 bits (81), Expect = 0.029 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 GG G GGG G GG G GG G G GG GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GG GGG GGG G GGG GGGG Sbjct: 506 GGGGGGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGGG 549 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P PPP P PPPP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPPPPXXP 795 PP P P P P P P PP PPP P P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P PP PPP PPP P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PP P P P P P P PP PPP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 897 PPXXXXPXPXPXP--PXXPXXPPPXPXPPPP 983 PP P P P P P PPP P PPPP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPP 387 Score = 35.1 bits (77), Expect = 0.088 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 834 PPXXPXPPPXP----PXXPXPPPPXPPXXXXPXPXPXP 935 PP P P P P P P PPP PP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P P P PP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPP--PPPPPPPPPAPGSTP 394 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P PPP PP PPP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAP---FAPPP----PPPPPPPPAPGSTP 394 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P P P P P P P P P P PP P P P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPP-PPPPPPAPGSTP 394 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P P PPPP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPP--PPPAPGSTP 394 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 PP P P P P P PPPPP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCA-PFAPPPPPPPPPPPAP 390 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PP P P P PP PPP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPP-PPPPPAP 390 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 PP P P P PPPP P P P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P P P P P P P PPP PP PPP P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPP---PPPPAPGSTP 394 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PP P P P P PP PPP PPP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAP----FAPPPPPP-PPPPPAPGSTP 394 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PP P P P PP PPP P PP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 885 PPPXPPXXXXPXPX-PXPPXXPXXPPPXPXPPPP 983 PP P P P P P PPP P PP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP P P P P P PPP P PPP Sbjct: 357 PPSTPAPTPAPLSST--PCAPFAPPPPPPPPPP 387 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 777 PPXPXPXP-PXPXXPXXXXPPPXXPXPPPXPPXXPXPPP 890 P P P P P P PP P PPP PP P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPP--PPPPPPPPPAPGSTP 394 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPX-PXPXPPXXPXXPPPXPXPPP 980 PP P P P P P P PP P PPP P P Sbjct: 357 PPSTPAPTPA--PLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 P P P P PP P PPPPP P P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPP--PPPPPAPGSTP 394 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 P P P P P P PP PP PPPP P P Sbjct: 358 PSTPAPT-PAPLSSTPCAPFAPPPPP----PPPPPPAPGSTP 394 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPP-PPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P PP PPP PP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPP----PPP----PPPPPPAPGSTP 394 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG--XGXGGGXXGGGGXGXGG 723 GGG GGG GGG G G G GG G GG G G G GGGG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHG-GDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG GGG GG G G G GG G GG G G GG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDV--GGDDGDGGNCDGDGYGDVGGGG 84 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGG 759 G G G G G G G G GG GG GG G G GGGG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGG-XGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G GGG G G G GG G G GG G GG G G Sbjct: 40 GGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 35.5 bits (78), Expect = 0.067 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G G GGG G G G G G GG G G GG G G Sbjct: 39 GGGHGGGHGGG-RGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGG-XXXXGXGGGXGXXGXGXXGG 627 GGG GGG G GG G G G G GG G GG G G GG Sbjct: 39 GGGH--GGGHG-GGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGG 82 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 6/86 (6%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXP--XPXPPXPXPPPPXXP-PPXP---XPPPPXXPPXXX 807 P P P P PP PP P PP PP PP P PP P Sbjct: 215 PGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRRD 274 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXP 885 PPP PP PP PP P Sbjct: 275 MPPPGAPPGMLPPGMPPHGMPPGFGP 300 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXX 906 P P P PP P P PP P PP PP PP P PP Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISG-PPTTSMSGPPIPVHHGMPPQYGPGR 272 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P Sbjct: 273 RDMPPPGAPPGMLPPGMPPHGMPP 296 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPP-PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 PP P PP P P P P PP PP P P PP P Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYG---P 270 Query: 838 XPPPXPPPXPPPXPXPP 888 PPP PP PP Sbjct: 271 GRRDMPPPGAPPGMLPP 287 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 7/73 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 PP PP P P P PP PP P PP P PPP P Sbjct: 224 PPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRRDMPPPGAPPG 283 Query: 781 --PPXXPPXXXXP 813 PP PP P Sbjct: 284 MLPPGMPPHGMPP 296 Score = 36.7 bits (81), Expect = 0.029 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 5/87 (5%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPP-PPXXPPPXPXPPPPXXPPXXXXP-PPXXXXPPXPPPXPP--- 858 PP P PP PP PP P PP PP PP PP P Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRR 273 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPP P P PP P Sbjct: 274 DMPPPGAPPGMLPPGMPPHGMPPGFGP 300 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXX-PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 PP P P P PP PP P PP P P P P P Sbjct: 229 PPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRRDMPPPGAPPGMLPPG 288 Query: 954 PPPXPXPP 977 PP PP Sbjct: 289 MPPHGMPP 296 Score = 30.7 bits (66), Expect = 1.9 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P PP PP P PP PP P P P P Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGH--HPPISGPPTTSMSGPPIPVHHGMPPQYGPG 271 Query: 928 XXPPPXPXXPPP--XPXXPP 981 P P PP P PP Sbjct: 272 RRDMPPPGAPPGMLPPGMPP 291 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPP 762 P PPPPP P P P P PPPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 PP P PPPP P P PPPP PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXP 947 P PPPP PP P P P PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +1 Query: 655 PXPPPX-----PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P PPP PPPPP PP P PP P PPP Sbjct: 568 PLPPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PPP PP P P PPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPP 101 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P P PP PPPP PP P PPP Sbjct: 582 PIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P P PPP PPPP P P PP P PP Sbjct: 77 PAAVIPPPPP------PPPPASNVPAPPPPPPVMPP 106 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PPPP PPP P PPP PP PP Sbjct: 77 PAAVIPPPPP-------PPPPASNVPAPPPPPPVMPP 106 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 P PPP PPP PP P PP PP P Sbjct: 77 PAAVIPPP----PPPPPPASNVPAPPPPPPVMPP 106 Score = 33.1 bits (72), Expect = 0.36 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 733 PXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P PPP P PPPP PPP P P P PPP Sbjct: 568 PLPPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKP-PAPLPPP 615 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PP P PPP P P PP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +3 Query: 846 PXPPPX----PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPP P PPPP P P P PP P PPP Sbjct: 568 PLPPPEFSDLESSAPIPPPP-PQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P PP P PPPP PPPP PP P PPP Sbjct: 568 PLPPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPP-----APLPPP 615 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PPPP PP P P PP P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAP-PPPPPVMPP 106 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PPP P PPP P PPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 887 PPXPXXXPXPPPXPXXPXPPXPXPPXXPP 973 PP P P PPP P PP P PP PP Sbjct: 82 PPPP---PPPPPASNVPAPP-PPPPVMPP 106 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 916 PXPPXXPPPX---PXXPPPXPXXPP 981 P PP PPP P PPP P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PP PPP PPP P PP PP Sbjct: 77 PAAVIPPPPPP---PPPASNVPAPPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 921 PXPXPPXXPXXPPPXPXPPPP 983 P P PP P P P PPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 P P P PPP PPPP P P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PPP P P PPP PP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP P PPP P PPP P PP Sbjct: 82 PPPPPPPPPASNV-------PAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P PPP PP PP PPP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP 690 PP PP P P PPP P P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 914 PPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P P PP PP P Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP P PPPP PPP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP PPP P P P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 >SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1642 Score = 43.2 bits (97), Expect = 3e-04 Identities = 45/121 (37%), Positives = 45/121 (37%), Gaps = 16/121 (13%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX--GGXGXX--GXXXXXGGGX-GXGGGX---GGGXGGGXGGXX 825 GG GGG GGG GG G GGG GGG GGG GG Sbjct: 992 GGELTLGGGELTLGGGELTLGGVELTLGGVELTLGGGELTLGGGELTIGGGELTIGGGEL 1051 Query: 824 XXGGGXXXXGG---XXGGGGXGXGGG--XXGGGGXGXGGXGXGXGXGG---GGGXXXXGX 669 GGG GG GGG GGG GGG GG G G GGG G Sbjct: 1052 TIGGGELTIGGGELTLGGGELTLGGGALTIGGGELTLGGGELTLGGGELTLGGGELTIGG 1111 Query: 668 G 666 G Sbjct: 1112 G 1112 Score = 43.2 bits (97), Expect = 3e-04 Identities = 45/121 (37%), Positives = 45/121 (37%), Gaps = 16/121 (13%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX--GGXGXX--GXXXXXGGGX-GXGGGX---GGGXGGGXGGXX 825 GG GGG GGG GG G GGG GGG GGG GG Sbjct: 1200 GGELTLGGGELTLGGGELTLGGVELTLGGVELTLGGGELTLGGGELTIGGGELTIGGGEL 1259 Query: 824 XXGGGXXXXGG---XXGGGGXGXGGG--XXGGGGXGXGGXGXGXGXGG---GGGXXXXGX 669 GGG GG GGG GGG GGG GG G G GGG G Sbjct: 1260 TIGGGELTIGGGELTLGGGELTLGGGALTIGGGELTLGGGELTLGGGELTLGGGELTIGG 1319 Query: 668 G 666 G Sbjct: 1320 G 1320 Score = 29.1 bits (62), Expect = 5.8 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX-GXGXGXXXXGGX----GGGGXGXXGGX---GGGXGXXGGGX 827 GGG GGG GG G G GG GGG GG GGG GGG Sbjct: 1040 GGGELTIGGGELTIGGGELTIGGGELTLGGGELTLGGGALTIGGGELTLGGGELTLGGGE 1099 Query: 826 XXXG 815 G Sbjct: 1100 LTLG 1103 Score = 29.1 bits (62), Expect = 5.8 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX-GXGXGXXXXGGX----GGGGXGXXGGX---GGGXGXXGGGX 827 GGG GGG GG G G GG GGG GG GGG GGG Sbjct: 1248 GGGELTIGGGELTIGGGELTIGGGELTLGGGELTLGGGALTIGGGELTLGGGELTLGGGE 1307 Query: 826 XXXG 815 G Sbjct: 1308 LTLG 1311 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG--G 774 GGG G G GGG G G GGG GG GG G GG Sbjct: 8 GGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDD 67 Query: 773 XGXGGGXXGGGGXGXGG 723 G G GGG GG Sbjct: 68 DGDGNDDDGGGNADRGG 84 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 2/75 (2%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG--XXGGGGXGXGGXGXG 711 G GGG GG G GG G GGGG GG GGG G G Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDG 63 Query: 710 XGXGGGGGXXXXGXG 666 G G G G Sbjct: 64 GYDDDGDGNDDDGGG 78 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GGG G G G GGG G G GG GG G G Sbjct: 4 GDDGGGGGGGNDDDG--GNDNDDGGGK----DDGANGDDGGGGNDDDGGNDDDDGGGKDD 57 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G G GG Sbjct: 58 GANNDGGYDDDGDGNDDDGGGNADRGG 84 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/88 (31%), Positives = 28/88 (31%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G GGG G G GG GG GG G G G Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGG-----GGNDDDGGNDDDDGGGKDDG 58 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG G G GGG G Sbjct: 59 ANNDGGYDDDGDGNDD--DGGGNADRGG 84 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G GGG G G G G G G GG GGG Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDG 63 Query: 802 GGXGXGXG 779 G G G Sbjct: 64 GYDDDGDG 71 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXX---GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG--XX 804 G GGG GG GG GGG GG GGG GG Sbjct: 9 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDDD 68 Query: 803 XXGGXXGGGGXGXGGG 756 G GGG GG Sbjct: 69 GDGNDDDGGGNADRGG 84 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG GG GG G GG G GGG G Sbjct: 10 GGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDDDG 69 Query: 805 XGGXGXGXG 779 G G G Sbjct: 70 DGNDDDGGG 78 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 GGGGG G G G G G GGGG GG G G G G Sbjct: 8 GGGGGGNDDDG--GNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGY 65 Query: 811 XGXGGXGXGXGG 776 G GG Sbjct: 66 DDDGDGNDDDGG 77 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GGGG G GGG G GG G G GG Sbjct: 4 GDDGG--GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGG 53 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG 843 GG GG GGG G G G G GG GG Sbjct: 39 GGNDDDGGNDDDDGGGKDDGANNDGGYDDDGDGNDDDGGGNADRGG 84 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG--G 774 GGG G G GGG G G GGG GG GG G GG Sbjct: 48 GGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDD 107 Query: 773 XGXGGGXXGGGGXGXGG 723 G G GGG GG Sbjct: 108 DGDGNDDDGGGNADRGG 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 2/75 (2%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG--XXGGGGXGXGGXGXG 711 G GGG GG G GG G GGGG GG GGG G G Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDG 103 Query: 710 XGXGGGGGXXXXGXG 666 G G G G Sbjct: 104 GYDDDGDGNDDDGGG 118 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GGG G G G GGG G G GG GG G G Sbjct: 44 GDDGGGGGGGNDDDG--GNDNDDGGGK----DDGANGDDGGGGNDDDGGNDDDDGGGKDD 97 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G G GG Sbjct: 98 GANNDGGYDDDGDGNDDDGGGNADRGG 124 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/88 (31%), Positives = 28/88 (31%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G GGG G G GG GG GG G G G Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGG-----GGNDDDGGNDDDDGGGKDDG 98 Query: 755 XXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG G G GGG G Sbjct: 99 ANNDGGYDDDGDGNDD--DGGGNADRGG 124 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G GGG G G G G G G GG GGG Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDG 103 Query: 802 GGXGXGXG 779 G G G Sbjct: 104 GYDDDGDG 111 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXX---GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG--XX 804 G GGG GG GG GGG GG GGG GG Sbjct: 49 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDDD 108 Query: 803 XXGGXXGGGGXGXGGG 756 G GGG GG Sbjct: 109 GDGNDDDGGGNADRGG 124 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG GG GG G GG G GGG G Sbjct: 50 GGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGYDDDG 109 Query: 805 XGGXGXGXG 779 G G G Sbjct: 110 DGNDDDGGG 118 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 GGGGG G G G G G GGGG GG G G G G Sbjct: 48 GGGGGGNDDDG--GNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANNDGGY 105 Query: 811 XGXGGXGXGXGG 776 G GG Sbjct: 106 DDDGDGNDDDGG 117 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GGGG G GGG G GG G G GG Sbjct: 44 GDDGG--GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGG 93 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG 843 GG GG GGG G G G G GG GG Sbjct: 79 GGNDDDGGNDDDDGGGKDDGANNDGGYDDDGDGNDDDGGGNADRGG 124 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P PPPPP P P PPP P PPP P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P P P PPP P PPP P PP P P PPP P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTN---KPPPPRPATTQAPPPTAAP 252 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXX---PPPXP--XPPPPXXPPXXXXPPP 819 P P PP PPPP PPP P PPP P PPP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P PPP PP P PPPP P P P P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P PP PPP PP P PPP PPP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P PP PP P P PP P P PP P P PPP P Sbjct: 206 PRSGPLPPTAAPPPP--PTTGAPP----PTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PPP PP PPP PPP P P P P Sbjct: 206 PRSGPLPPTAAPPP--PPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 PP P P P P P P PP P P PP P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 PP P P P PPP P PPPP PP P Sbjct: 212 PPTAAPPPP-PTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P PP PP P P P P P PPP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P PP P P PP P P P PPP P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP PP P PP P PPP P P P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P PP PP P P P PP P P PPP Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPP-----PPRPATTQAPPP 248 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P PP P P PPP P PPP P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKP-PPPRPATTQAPPPTAAP 252 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP---XXPPP 963 P P PP P P PPP P P PPP P PPP Sbjct: 206 PRSGPLPPTAAP--P-PPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 169 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPPXPXPPPXXXXXPXXPXPPXX 933 P P P P PP P PP P P PPP P P P Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAA-- 78 Query: 934 PPPXPXXPPPXPXXP 978 PPP PPP P P Sbjct: 79 PPPVNEVPPPRPVKP 93 Score = 35.5 bits (78), Expect = 0.067 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P PP P P P P P PP Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAAPP 80 Query: 960 PXPXPPPP 983 P PPP Sbjct: 81 PVNEVPPP 88 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP---PXPP 870 P P P P PP P PP P PPP P P PP Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAAPP 80 Query: 871 PXPXPPPXXXXXP 909 P PP P Sbjct: 81 PVNEVPPPRPVKP 93 Score = 31.5 bits (68), Expect = 1.1 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX---PPPPXXPPXXXXPPPXXXX 831 P P P P PP P P PP P P PP P P P Sbjct: 21 PTPRPK---PRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEA 77 Query: 832 PPXPPPXPPPXPPPXPXPP 888 P PP PPP P P Sbjct: 78 AP-PPVNEV--PPPRPVKP 93 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/73 (24%), Positives = 18/73 (24%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P P P P P P P P PP Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAAPP 80 Query: 820 XXXXPPXPPPXPP 858 P P P P Sbjct: 81 PVNEVPPPRPVKP 93 Score = 29.1 bits (62), Expect = 5.8 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 6/75 (8%) Frame = +1 Query: 628 PPXXPXPXXPXPP---PXPXXXXPPPPPXPXPXPX---PPXPXPPPPXXPPPXPXPPPPX 789 P P P P P P PP P P PP P P P P Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAAP- 79 Query: 790 XPPXXXXPPPXXXXP 834 PP PPP P Sbjct: 80 -PPVNEVPPPRPVKP 93 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 42.3 bits (95), Expect = 6e-04 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 13/129 (10%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPPXX 804 P P PP P PPP P PP PPP PP P PP Sbjct: 265 PYHGGPFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPF 324 Query: 805 XXPPP---XXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPP----PXPX 951 PPP PPP PP P P P P P Sbjct: 325 VRPPPQQFDYQHGRANMDIPPPIDYNHGRPPHDDFGHEAYGPDDYGPDSYGPEEFGPPPV 384 Query: 952 XPPPXPXXP 978 PPP P P Sbjct: 385 PPPPRPIIP 393 Score = 41.5 bits (93), Expect = 0.001 Identities = 34/119 (28%), Positives = 34/119 (28%), Gaps = 9/119 (7%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPX---PXPPXPXPPPPXXPPPXPXPPPPXXP- 795 PP P P P P PPP P P P P P PPP PPP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPPQQFDY 334 Query: 796 ----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXP 957 PPP PP P P PP PPP P P Sbjct: 335 QHGRANMDIPPPIDYNHGRPPHDDFGHEAYGPDDYGPDSYGPEEFGPPPVPPPPRPIIP 393 Score = 31.9 bits (69), Expect = 0.82 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +1 Query: 817 PXXXXPPXPPPX--PPPXPPPX--PXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPXXPP 981 P PP PP PPP PP PPP P P P PPP PP Sbjct: 270 PFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPP 329 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXG 654 G G GGG G G G G G G G G G G G G GGG G Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G G GGG G G G G G G G G G GG G GG G Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GGG G G G G G G G G G G GG GGG G Sbjct: 241 GGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G G GGG G G G G G G G GG GGGG G Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGG 831 G GGG G G G G G G G G G GG GGG GG Sbjct: 239 GDGGGDGDGDGD-GDGDGDGDGDGDGDGDGDGGVGGGGGG 277 Score = 35.5 bits (78), Expect = 0.067 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGG 851 G G GGG G G G G G G G G G G GG GGG Sbjct: 237 GDGDGGGD-GDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGG 277 Score = 35.5 bits (78), Expect = 0.067 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 GGG G G G G G G G G G G GGGG G G Sbjct: 241 GGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG 843 G GGG G G G G G G G G G GG GGG GG Sbjct: 239 GDGGGD-GDGDGDGDGDGD-GDGDGDGDGDGDGGVGGGGGGG 278 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGG 840 G G G G G G G G G G GG GGG GGG Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG 852 G GG G G G G G G G GGG GGG Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GGGG G GGG GGGG G G G G GGG G G G Sbjct: 419 GGGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQACGRGGGGGECGEKEEG 470 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G G GG G GGG G G GGG G G G G GGG G Sbjct: 406 GLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQACGRGGGGGECG 465 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXG 724 G G G G GG GGG GGGG G G Sbjct: 406 GLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQG 439 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GGG GGGG G GG G G G G G G G GG G Sbjct: 409 GEEGSPSVFLGGGGRGGGG-GDGG-GGGEGVQGTPYTPEEEEGRALQACGRGGGGGECG 465 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GGG G G GG G G G G GGG G G GG Sbjct: 420 GGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQACGRG-GGGGECGEKEEGEEEEIKGG 478 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG 836 GGGG G GGG G GG G G G G GGG G G Sbjct: 419 GGGGRG-GGGGDGGGGGEGV-QGTPYTPEEEEGRALQACGRGGGGGECG 465 >SB_15136| Best HMM Match : Peptidase_S13 (HMM E-Value=0.27) Length = 638 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G GGG G G G G G G GG G G G G G G G G Sbjct: 534 GDGDGGGEGNG-DGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDGDDDGYEAV 592 Query: 692 GGXXXXGXGGGXG 654 G GGG G Sbjct: 593 GDGDDSVDGGGGG 605 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG--GXXXXGGGXXXXGGXXGGGGXG 768 G G GG G G G G G GGG G G G G G G G G Sbjct: 534 GDGDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDGDDDGYEAVG 593 Query: 767 XGGGXXGGGGXG 732 G GGG G Sbjct: 594 DGDDSVDGGGGG 605 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 6/72 (8%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG--GXGXGGGXXGGGGXGXGGXGXG 711 G G GGG G G G G G G G G G G G G G G G G Sbjct: 534 GDGDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDGDDDGYEAVG 593 Query: 710 XG----XGGGGG 687 G GGGGG Sbjct: 594 DGDDSVDGGGGG 605 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GGG G G G G G G G G G G G G G G G G G Sbjct: 534 GDGDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDS-DGDGDDDG 588 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G GG G G G G G G G Sbjct: 534 GDGDGGGEGNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDGDDDGYEAVG 593 Query: 805 XGGXGXGXGG 776 G GG Sbjct: 594 DGDDSVDGGG 603 Score = 31.5 bits (68), Expect = 1.1 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXGG 792 G GGG G G G G G G G G G G G G G G G Sbjct: 536 GDGGGE-----GNGDGYEDVGDGDDDGAGDGGGDGDGDGYEGVGDGNGDSDGDGDDDGYE 590 Query: 791 XXGGGGXGXGGGXXGGG 741 G G GG GGG Sbjct: 591 AVGDGDDSVDGG--GGG 605 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 41.9 bits (94), Expect = 8e-04 Identities = 26/91 (28%), Positives = 26/91 (28%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG GG G G GGGG G GG G G G GG Sbjct: 159 GGLTTATGGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGGSTGAAGGGGGGTSTS 218 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G GGG G G Sbjct: 219 TGSSGSTGTSMVTSGGGISTSGSSSGSSQSG 249 Score = 38.3 bits (85), Expect = 0.009 Identities = 33/112 (29%), Positives = 33/112 (29%), Gaps = 5/112 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXXG---GGXGXGGGXGGGXGGGXGGXXXXGG 813 GG GG G GG G G G G GG GG GG Sbjct: 144 GGPKTVGGTSSGTSTGGLTTATGGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGG 203 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG-XGGGGGXXXXGXGGG 660 GG GGGG G G G G G G G G GG Sbjct: 204 STGAAGG--GGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSSQSGASGG 253 Score = 36.7 bits (81), Expect = 0.029 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 4/92 (4%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG---GGXGXGGGXXGGGGXGXGGX 720 GG GG G GG G G G G GGGG G G Sbjct: 144 GGPKTVGGTSSGTSTGGLTTATGGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGG 203 Query: 719 GXG-XGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GGGG G G G GG Sbjct: 204 STGAAGGGGGGTSTSTGSSGSTGTSMVTSGGG 235 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP 888 PPP PP PPP PPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PP PPP PPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPP PPP P PPPP PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 PP PPPP PPP P PPP P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PPP P P PP P PPPP PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPP--PPGAKKPDDP 101 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP 765 PPP P P P PP P PPPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PPP PPPP PP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +1 Query: 841 PPPX---PPPXPPPXPXPPPXXXXXPXXP 918 PPP PPP PPP P PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P PP P PPPP PPP P P P Sbjct: 73 PPPLCAPPPP-PPPPPPPPPPPGAKKPDDP 101 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPP 744 P P PPPPP P P P PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P PPPP P P P PP P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP PPP PP PPP P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 PPP P PPP P P PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.1 bits (72), Expect = 0.36 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 PP PPPPP P P P P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PPPPP P PP P PPP P P Sbjct: 74 PPLCAPPPPPPP-----PPPPPPPPGAKKPDDP 101 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP 699 PP P P P P PPP P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 PP PPPP PP P P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 922 PPXXPPPXPXXPPPXPXXPP 981 PP PP P PPP P PP Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P P PPP P PPPPP P P P Sbjct: 73 PPPLCAPPPPPP---PPPPPPPPPGAKKPDDP 101 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 897 PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P P P PP P PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP 888 PPP PP PPP PPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PP PPP PPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPP PPP P PPPP PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 PP PPPP PPP P PPP P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PPP P P PP P PPPP PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPP--PPGAKKPDDP 302 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP 765 PPP P P P PP P PPPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 36.7 bits (81), Expect = 0.029 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PPP PPPP PP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +1 Query: 841 PPPX---PPPXPPPXPXPPPXXXXXPXXP 918 PPP PPP PPP P PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P PP P PPPP PPP P P P Sbjct: 274 PPPLCAPPPP-PPPPPPPPPPPGAKKPDDP 302 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPP 744 P P PPPPP P P P PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXP 759 P PPPP P P P PP P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP PPP PP PPP P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 PPP P PPP P P PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.1 bits (72), Expect = 0.36 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 PP PPPPP P P P P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PPPPP P PP P PPP P P Sbjct: 275 PPLCAPPPPPPP-----PPPPPPPPGAKKPDDP 302 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP 699 PP P P P P PPP P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 PP PPPP PP P P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 922 PPXXPPPXPXXPPPXPXXPP 981 PP PP P PPP P PP Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P P PPP P PPPPP P P P Sbjct: 274 PPPLCAPPPPPP---PPPPPPPPPGAKKPDDP 302 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 897 PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P P P PP P PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 41.9 bits (94), Expect = 8e-04 Identities = 31/117 (26%), Positives = 31/117 (26%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P PPP P P P PP P P P P Sbjct: 1454 PPPDPAERR-VPPPFPAERRTPAPDPAERRVPPPFPAERRTPAPDPGERQISSPFPAERR 1512 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PP P P P P P P PPP P P P Sbjct: 1513 IPPLDPAKRRVSPPFPAERRTPTP-DPGERRVSPLFPDECQMPPPDPAERRVSPPFP 1568 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P PPP PP P P P PP P P P Sbjct: 1445 PPFPAEHRIPPPDPAERRVPPPFPAERRTPAPDPAERRVPPPFPAERRTPAPDPGERQIS 1504 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P Sbjct: 1505 SPFPAERRIP-PLDPAKRRVSPPFPAERRTPTPDPGERRVSPLFP 1548 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 3/97 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 PP P PP P P P P P P PPP P P Sbjct: 1514 PPLDPAKRRVSPPFPAERRTPTPDPGERRVSPLFPDECQMPPPDPAERRVSPPFPAERRT 1573 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPP 942 P P P PP PPP P P PPP Sbjct: 1574 PTPVPAERRVSPPSRLPPPSLHIRPSDRPGMTATPPP 1610 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/119 (25%), Positives = 30/119 (25%), Gaps = 1/119 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 PP P PP P P P P P PP P PP Sbjct: 1514 PPLDPAKRRVSPPFPAERRTPTPDPGERRVSPLFPDECQMPPPDPAERRVSPPFPAERRT 1573 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PPP P P P P P P P PP Sbjct: 1574 PTPVPAERRVSPPSRLPPPSLHIRPSDRPGMTATPPPPLPTRRPSSCSRPAPQLSYRPP 1632 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/105 (26%), Positives = 28/105 (26%), Gaps = 6/105 (5%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P PP PP P P P P P PPP P Sbjct: 1506 PFPAERRIPPLDPAKRRVSPPFPAERRTPTPDPGERRVSPLFPDECQMPPPDPAERRVSP 1565 Query: 847 PXPPPXPPPXPXP------PPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP P P P PPP Sbjct: 1566 PFPAERRTPTPVPAERRVSPPSRLPPPSLHIRPSDRPGMTATPPP 1610 Score = 37.1 bits (82), Expect = 0.022 Identities = 31/123 (25%), Positives = 31/123 (25%), Gaps = 5/123 (4%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXX-PPXXPXXXXXXXXXXXXXXXXPPXPXPX-- 797 P P P P PP P PP P PP P Sbjct: 1434 PESNPTERRVSPPFPAEHRIPPPDPAERRVPPPFPAERRTPAPDPAERRVPPPFPAERRT 1493 Query: 798 -PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP-PXXPXXPPPXPX 971 P P P P PP P PP P P P P P P Sbjct: 1494 PAPDPGERQISSPFPAERRIPPLDPAKRRVSPPFPAERRTPTPDPGERRVSPLFPDECQM 1553 Query: 972 PPP 980 PPP Sbjct: 1554 PPP 1556 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P PPP P P P P PP Sbjct: 1454 PPPDPAERRVPPPFPAERRTPAPDPAERRVPPP 1486 Score = 30.7 bits (66), Expect = 1.9 Identities = 24/101 (23%), Positives = 24/101 (23%), Gaps = 3/101 (2%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX---PPXPXXPXXXXPPPXXPXPPP 860 P P P P PP P PP P P P PP Sbjct: 1426 PIPAKRQMPESNPTERRVSPPFPAEHRIPPPDPAERRVPPPFPAERRTPAPDPAERRVPP 1485 Query: 861 XPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P PP Sbjct: 1486 PFPAERRTPAPDPGERQISSPFPAERRIPPLDPAKRRVSPP 1526 >SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) Length = 702 Score = 41.9 bits (94), Expect = 8e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G GG GG GG GGG G G G G G G G GG G Sbjct: 94 GWGDDYGADGGGAGPGGYGGYGAWGGGHEVGGWAHHEGFGGFGPGWNQG---GCGGCGCD 150 Query: 710 XGXGGGG 690 G GGG Sbjct: 151 EGCCGGG 157 Score = 37.1 bits (82), Expect = 0.022 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 2/89 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX--GXGGGXXGGGGXGXGGXGX 714 GG G G G G G G GGG G GG GGG GG Sbjct: 69 GGFGPAFPFAGYSPGDFPEYGPDGYGWGDDYGADGGGAGPGGYGGYGAWGGGHEVGGWAH 128 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G GG G G GG Sbjct: 129 HEGFGGFGPGWNQGGCGGCG-CDEGCCGG 156 Score = 35.9 bits (79), Expect = 0.050 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 1/81 (1%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXX 678 G GG G G G G G G GGG G GG G GGG Sbjct: 66 GLYGGFGPAFPFAGYSPGDFPEYGPDGYGWGDDYGADGGGAGPGGYGGYGAWGGGHEVGG 125 Query: 677 XGXGGGXGXXGXGXXGGXXGG 615 G G G G G GG Sbjct: 126 WAHHEGFGGFGPGWNQGGCGG 146 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 41.9 bits (94), Expect = 8e-04 Identities = 39/126 (30%), Positives = 39/126 (30%), Gaps = 19/126 (15%) Frame = -3 Query: 980 GGXXGXGGGXX-----GXGGGXXGGXGXXGXXXXXGGGXGXG-------GGXGGGXGGGX 837 GG G G G G G GG G G GG G GGG G Sbjct: 1117 GGKNGSGPGAGHTHDDGSSGAGHGGRGGRGKQQSLTGGFYGSLARPQMFGSTGGGGGNQG 1176 Query: 836 GGXXXXGGGXXXXGGXX---GGGGXGXGGGXXGGG----GXGXGGXGXGXGXGGGGGXXX 678 GG G GGGG G GG GG G G GG GG Sbjct: 1177 GGVIHINASLITLDGIITASGGGGSGTAGGGSGGSVLIDTWVIEGAGEVHADGGSGGSQG 1236 Query: 677 XGXGGG 660 G G G Sbjct: 1237 GGGGSG 1242 Score = 37.5 bits (83), Expect = 0.017 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GG G G GG G GGG GG G G GG G Sbjct: 2934 GLGNPGGTGPGAGGTLGSRGT-GGGYGGKGGHADDISGSWYGSTFNPNVTGSGGGNCASG 2992 Query: 704 XGGGGG 687 GG GG Sbjct: 2993 NGGAGG 2998 Score = 37.5 bits (83), Expect = 0.017 Identities = 35/118 (29%), Positives = 35/118 (29%), Gaps = 5/118 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXG---GGXGGGXGGXXXXGGGXX 804 G GGG GG GG G G GG G G G G Sbjct: 3284 GSGGGYASEGGSGVGGLKGGDPYGTIFTPEYPGSPGGDGDMISTKGKGGGAVKILTDVLY 3343 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GG G G GGG G G G G GGG G G G G Sbjct: 3344 NDGYISANGGSGMAGSHAGGGSGGSVYITVRQSLDGSGVISANG-GGGDGNGGCGGGG 3400 Score = 36.3 bits (80), Expect = 0.038 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 7/94 (7%) Frame = -3 Query: 890 GGGXGXGGGXG-----GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GG G G G G G G G GG G GG G G GGGG G Sbjct: 1117 GGKNGSGPGAGHTHDDGSSGAGHGGRGGRGKQQSLTGGFYGSLARPQMFGSTGGGGGNQG 1176 Query: 725 GXGXGXGXG--GGGGXXXXGXGGGXGXXGXGXXG 630 G G GGG G G G G Sbjct: 1177 GGVIHINASLITLDGIITASGGGGSGTAGGGSGG 1210 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 5/65 (7%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGX-----GGGGGXXXXGX 669 G GG GG G G G G G GG G G G GGG G Sbjct: 2934 GLGNPGGTGPGAGGTLGSRGTGGGYGGKGGHADDISGSWYGSTFNPNVTGSGGGNCASGN 2993 Query: 668 GGGXG 654 GG G Sbjct: 2994 GGAGG 2998 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G G G G G G GGG G GG G G GG Sbjct: 2936 GNPGGTGPGAGGTLGSRG----TGGGYGGKGGHADDISGSWYGSTFNPNVTGSGGGNCAS 2991 Query: 779 GGXGXGGG 756 G G GGG Sbjct: 2992 GNGGAGGG 2999 Score = 32.7 bits (71), Expect = 0.47 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG---XGXGXGGGGGXXXXGXGGGXGXXGX 642 G GG G G G GGG G GG G G G GGG G Sbjct: 2934 GLGNPGGTGPGAGGTLGSRGTGGGYGGKGGHADDISGSWYGSTFNPNVTGSGGGNCASGN 2993 Query: 641 GXXGG 627 G GG Sbjct: 2994 GGAGG 2998 Score = 31.9 bits (69), Expect = 0.82 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G G GG G G G G G GG G G G Sbjct: 2927 GGVIDLSGLGNPGGTGPGAGGTLGSRGTGGGYGGKGGHADDISG-SWYGSTFNPNVTGSG 2985 Query: 782 GGGXGXGGGXXGGG 741 GG G G GGG Sbjct: 2986 GGNCASGNGGAGGG 2999 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 6/100 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-----GXGGGXGGXXXXGGGXX 804 G G G G GGG G G G G GG G G Sbjct: 2192 GSGAGHGGHGGGTSSGSAYGSVFNPTHFGSGTGARGGGIIYMSVKNLALNGALISHGAQS 2251 Query: 803 XXGGXXGGGGXGXGGGXXGGGG-XGXGGXGXGXGXGGGGG 687 GG GG G G GG G GG GG Sbjct: 2252 ETGGGSGGSIMIKAETMSGHGTITADGGAGLSSSGGGSGG 2291 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GG GG G G G G G G G GG G GGG Sbjct: 2562 GRGHALEGGSYGGCGGGQGIGECTLYGTLYRAMEYGSGGGGSSSSYSSGSGGG 2614 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXG---XXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 GGGG GGG G G G G GG G GG GG Sbjct: 1197 GGGGSGTAGGGSGGSVLIDTWVIEGAGEVHADGGSGGSQGGGGGSGG 1243 Score = 28.7 bits (61), Expect = 7.6 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G GG G G GG G GG G GG G G G G GGG Sbjct: 2934 GLGNPGGTGPGAGGTL----GSRGTGG--GYGGKGGHADDISGSWYGSTFNPNVTGSGGG 2987 Query: 692 GGXXXXGXGGG 660 G GG Sbjct: 2988 NCASGNGGAGG 2998 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG--XGXGXGXXXXGGXGGGGXGXXGGXGGG 851 G GGG G GG G G G GG GG GGG Sbjct: 2953 GTGGGYGGKGGHADDISGSWYGSTFNPNVTGSGGGNCASGNGGAGGG 2999 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G GG GGG G GG G G GG GGG GG Sbjct: 3675 GAGGYGFIDVSGG---VGGGSDAG-GGAAGRVSIDCSSYLYKGNYQTLGGLSLGGGAHGG 3730 Query: 743 GG 738 G Sbjct: 3731 PG 3732 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPX---PPPXPPXXPXPPPPXPP 902 P P P P PPP P PPP PP PPPP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +3 Query: 816 PXXXXPPPXXPX---PPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P PPP P PPP PP PPPP PP P P P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGV-LPPPPAPPGALIP-PPPAPP 215 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 673 PXXXXPPPPPXP--XPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PPP P P P PP PPPP PP PPPP P Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPP-APPGALIPPPPAPP 215 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PPP P PPP P PP P PP PPP P PP Sbjct: 174 PGILAPPPAPPGVLAPPP--APPGVLPPPPAPPGALIPPP-PAPP 215 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP PPP PP PPPP P PPP Sbjct: 179 PPPAPPGVLAPPP--APPGVLPPPPAPPGALIPPPP 212 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PPP PP PPP PP P P P P PPP P Sbjct: 174 PGILAPPPAPPGV-LAPPPAPPGVLPPPPAPPGALIP--PPPAP 214 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPP 888 PP PP PPP PPP PP PP P PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PPP PPP PP PP P PP P P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP--GALIPPPPAPP 215 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP 744 PP P P PPP P PPPP P PP P PP Sbjct: 179 PPPAP-PGVLAPPPAPPGVLPPPPAPPGAL-IPPPPAPP 215 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPP----XXPPXPP 982 PPP P PPP P PP P PP PP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 36.7 bits (81), Expect = 0.029 Identities = 26/103 (25%), Positives = 26/103 (25%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P Sbjct: 112 PFPRMPLISPPLPMYIPVPVPQPVPQPVPQPASKGKSVLDKILQLQMTLKLMALLGQKNS 171 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPP PP P P PP P P PPP P Sbjct: 172 VSPGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 36.7 bits (81), Expect = 0.029 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP PP PPP PP PPP PPP PP Sbjct: 179 PPPAPPGVLAPPPA--PPGVLPPPPAPPGALIPPPPAPP 215 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPP 762 P P P P PP PP P P PP PPP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 PPP P PP P PP PP P PP PP P Sbjct: 179 PPPAPPGVLAPP---PAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXP-PPPXXPPPXXXPPXP 787 PPP P P P P PPP PP PP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P P PP PPP P P P PP PP PP Sbjct: 174 PGILAPPPAPPGVLAPPPAP----PGVLPPPPAPPGALIPPPPAPP 215 Score = 29.9 bits (64), Expect(2) = 0.047 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX--PPXPPPXPPPX 864 P P P P P P P P P P PP P P P Sbjct: 72 PMPKNTYHVPRPSRPMSNDPSHVPSKPMREDAKRKFLVLAPFPRMPLISPPLPMYIPVPV 131 Query: 865 PPPXPXPPP 891 P P P P P Sbjct: 132 PQPVPQPVP 140 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 698 PPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 P P P P PPP PP PP P P PP Sbjct: 174 PGILAPPPAPPGVLAPPP-APPGVLPPPPAPPGALIPPPPAPP 215 Score = 25.0 bits (52), Expect(2) = 0.047 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +1 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PPP P P P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP 204 >SB_33262| Best HMM Match : DOMON (HMM E-Value=2.7e-28) Length = 595 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/103 (29%), Positives = 30/103 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 487 GGRVARGGRVARGGRVASGGRVASGGRVASGGRVARGGRVASGGRVAMGGRVASGGRVAS 546 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG GG GG GG G GG G Sbjct: 547 GGRVASGGRVASGGRVARGGRVARGGRVAMGGRVASGGRVASG 589 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/98 (29%), Positives = 29/98 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G GG GG G GG GG Sbjct: 493 GGRVARGGRVASGGRVASGGRVASGGRVARGGRVASGGRVAMGGRVASGGRVASGGRVAS 552 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG GG GG GG G GG Sbjct: 553 GGRVASGGRVARGGRVARGGRVAMGGRVASGGRVASGG 590 Score = 35.9 bits (79), Expect = 0.050 Identities = 35/119 (29%), Positives = 35/119 (29%), Gaps = 2/119 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXX-GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G GG GG G GG GG G GG GG Sbjct: 475 GVGGGGWQRVARGGRVARGGRVARGGRVASGGRVASGGRVASGGRVARGGRVA-SGGRVA 533 Query: 800 XGGXXGGGGXGXGGGXXGGGG-XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG GG GG GG G GG GG G GG Sbjct: 534 MGGRVASGGRVASGGRVASGGRVASGGRVARGGRVARGG--RVAMGGRVASGGRVASGG 590 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PP PPP PPP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPP 783 P PP PPPP PPP P PPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXP 771 P P P PP P PPPP PPP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PPP P PPP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPP 902 P P PP PP P PPPP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP 80 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPP 798 P PP PPP P PPPP PP Sbjct: 62 PIPPTLPPPPPPPPPPLPPP 81 Score = 36.7 bits (81), Expect = 0.029 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPP 750 P PP P P P PP P PPPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPP 82 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPP 890 P PP P PPP PP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P PP P PPPPP P P P PP Sbjct: 59 PTVPIPPTLP----PPPPPPPPPLPPPP 82 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPP 747 P PP P P P P PP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPP 765 P P P P PP P PPPP PPP Sbjct: 59 PTVPIPPTLPPPPPP-PPPPLPPPP 82 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PP PPP P PP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 858 PXPPXXPXPPPPXPPXXXXPXP 923 P PP P PPPP PP P P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP PPP P PPP P P PP Sbjct: 62 PIPPTLPPPPPPPPP-----PLPPPPP 83 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPP 873 P P PP PPP PP PPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPP 82 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPP 816 P PP P PPPP PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P PPP PP PPP PPP P Sbjct: 59 PTVPIPPTLPPPP---PPPPPPLPPPPP 83 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXP 735 P P PPPP P P P PP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPPP PP PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPP 902 P P PP PP P P PP PP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 631 PXXPXPXX-PXPPPXPXXXXPPPPP 702 P P P P PPP P PPPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP PP PPP PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXP 675 PP PP P P P PPP P Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 890 PXPXXXPXPPPXPXXPXPPXP 952 P P P PPP P P PP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPP 82 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP PPP P PPP P Sbjct: 59 PTVPIPPTLPPPP--PPPPPPLPPPPP 83 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 900 PXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP P PPP P PPP Sbjct: 59 PTVPIPPTLPPPP--PPPPPPLPPPPP 83 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P PP P P P PP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP--PPP 83 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP 762 P P P P PP P PP P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPP 938 P P PP PP P P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G G G G G G GG G G G G GGG G Sbjct: 949 GKGWLGGDGEGAGSGSAGASGAGYGGRGGQGAATPITGSPYGDYRSPQVFGSGGGGTGGK 1008 Query: 728 GGXGXG 711 GG G G Sbjct: 1009 GGAGGG 1014 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G GGG G G GG G G GG G G G G Sbjct: 559 GASGRVSVTGGGCASGEGPGAGTLSPSGGSGASYGGRGGRGRGTRALKLPFGDIFTVGTW 618 Query: 788 XGGGGXGXGGGXXGGGG 738 GGG G G GG Sbjct: 619 GSGGGSGSVASTGGRGG 635 Score = 35.5 bits (78), Expect = 0.067 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 11/108 (10%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G GGG G GG GGG G Sbjct: 973 GGRGGQGAATPITGSPYGDYRSPQVFGSGGGGTGGKGGAGGGLLRLDIETALVVEGTISV 1032 Query: 797 GGXXG---GGGXGXGG-------GXXGGGGXG-XGGXGXGXGXGGGGG 687 G G G G G GG G G GG G G G GGGGG Sbjct: 1033 SGQTGATSGSGGGSGGSIIIHTRALEGSGTIATNGGNGNGDGGGGGGG 1080 Score = 33.5 bits (73), Expect = 0.27 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---GGGXXXX 798 G G GGG G G GG G G GGG G G Sbjct: 656 GMPGKSSNAGGGSGGSLWAVAHTFTGTGTIQAVGGDGQGEGGGGAGGRITVTYTRGGYHS 715 Query: 797 GGXXGGGGXGXGGGXXGGGG 738 G GG G G GG G Sbjct: 716 SGTVANGGVGRSGSENGGPG 735 Score = 31.5 bits (68), Expect = 1.1 Identities = 26/75 (34%), Positives = 26/75 (34%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GG G G G G G G G G GG G G G G Sbjct: 949 GKGWLGGDGEGAGSGSAGASGAGYG--------GRGGQG-AATPITGSPYGDYRSPQVFG 999 Query: 704 XGGGGGXXXXGXGGG 660 GGGG G GGG Sbjct: 1000 SGGGGTGGKGGAGGG 1014 Score = 30.7 bits (66), Expect = 1.9 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGG----GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G G G G G GG G G G G GGG G G Sbjct: 949 GKGWLGGDGEGAGSGSAGASGAGYGGRGGQGAATPITGSPYGDYRSPQVFGSGGG-GTGG 1007 Query: 644 XGXXGG 627 G GG Sbjct: 1008 KGGAGG 1013 Score = 29.1 bits (62), Expect = 5.8 Identities = 36/117 (30%), Positives = 36/117 (30%), Gaps = 25/117 (21%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXG-----GGXGXGGGXG-----GGXGGG-----XGGX 828 GG GG G G G G G GGG G GG GGG Sbjct: 586 GGSGASYGGRGGRGRGTRALKLPFGDIFTVGTWGSGGGSGSVASTGGRGGGRIQMTVKNV 645 Query: 827 XXXGGGXXXXG--GXXGGGGXGXGGGXXG------GGG--XGXGGXGXGXGXGGGGG 687 G G G G G GG G G GG G G G GG GG Sbjct: 646 LEVNGEIETNGMPGKSSNAGGGSGGSLWAVAHTFTGTGTIQAVGGDGQGEGGGGAGG 702 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G G G G G G GG G G G G G GG G G Sbjct: 954 GGDGEGAGS-GSAGASGAGYGGRGGQGAATPITGSPYGDYRSPQVFGSGGGGTGGKGGAG 1012 Query: 776 G 774 G Sbjct: 1013 G 1013 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PP PPP PPP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPP 783 P PP PPPP PPP P PPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXP 771 P P P PP P PPPP PPP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PPP P PPP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPP 902 P P PP PP P PPPP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP 304 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPP 798 P PP PPP P PPPP PP Sbjct: 286 PIPPTLPPPPPPPPPPLPPP 305 Score = 36.7 bits (81), Expect = 0.029 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPP 750 P PP P P P PP P PPPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPP 306 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPP 890 P PP P PPP PP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P PP P PPPPP P P P PP Sbjct: 283 PTVPIPPTLP----PPPPPPPPPLPPPP 306 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPP 747 P PP P P P P PP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPP 765 P P P P PP P PPPP PPP Sbjct: 283 PTVPIPPTLPPPPPP-PPPPLPPPP 306 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 P P PP PPP P PP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 858 PXPPXXPXPPPPXPPXXXXPXP 923 P PP P PPPP PP P P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP PPP P PPP P P PP Sbjct: 286 PIPPTLPPPPPPPPP-----PLPPPPP 307 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPP 873 P P PP PPP PP PPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPP 306 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPP 816 P PP P PPPP PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P PPP PP PPP PPP P Sbjct: 283 PTVPIPPTLPPPP---PPPPPPLPPPPP 307 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXP 735 P P PPPP P P P PP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPPP PP PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPP 902 P P PP PP P P PP PP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 631 PXXPXPXX-PXPPPXPXXXXPPPPP 702 P P P P PPP P PPPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP PP PPP PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXP 675 PP PP P P P PPP P Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 890 PXPXXXPXPPPXPXXPXPPXP 952 P P P PPP P P PP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPP 306 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP PPP P PPP P Sbjct: 283 PTVPIPPTLPPPP--PPPPPPLPPPPP 307 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 900 PXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP P PPP P PPP Sbjct: 283 PTVPIPPTLPPPP--PPPPPPLPPPPP 307 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P PP P P P PP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP--PPP 307 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP 762 P P P P PP P PP P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPP 938 P P PP PP P P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G GGGG G GG G G G GG G G Sbjct: 212 GGSTGAPSSGAMVGATTWSASSAGASAG-GGGGVGTTGGSTGAAGGGGGGTSTSTGSSGS 270 Query: 692 GGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G Sbjct: 271 TGTSMVTSGGGISTSGSSSGSSQSG 295 Score = 36.7 bits (81), Expect = 0.029 Identities = 22/87 (25%), Positives = 22/87 (25%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G GGG G G GGG G G Sbjct: 212 GGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGST 271 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G G G Sbjct: 272 GTSMVTSGGGISTSGSSSGSSQSGASG 298 Score = 36.7 bits (81), Expect = 0.029 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GG GG GG GG GGGG G G G G G Sbjct: 225 GATTWSASSAGASAGGGGGVGTTGGSTGAAGG--GGGGTSTSTGSSGSTGTSMVTSGGGI 282 Query: 707 G-XGGGGGXXXXGXGGG 660 G G G GG Sbjct: 283 STSGSSSGSSQSGASGG 299 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G GGG G G G GGG G G G GGG G G Sbjct: 235 GASAGGGGGVGTTG--GSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSS 292 Query: 776 GXGXGGG 756 G GG Sbjct: 293 QSGASGG 299 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G GG GGG GGG G GG G GGGG G GG GG G Sbjct: 49 GVGQGVGGQGGGGQGGGQG----VGGQEV---GGQGGGGQGVGGQEVGGQG 92 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G GG GGG G GG G GGG G GG Sbjct: 51 GQGVGGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGG 90 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGX-GXXGGGXXXXGXXGXGGXG 791 GG GGGG G G GG G GGG G GG G Sbjct: 55 GGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGGQG 92 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 3/82 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG---GGXXXXGGXXGGG 777 G GGG GG G G G G G G Sbjct: 455 GGGGGGGGGSGGSSPSHRSSGSSSSSSSRRSSPSGSPAIPTPSGSSSGSSIVRRPRRRRG 514 Query: 776 GXGXGGGXXGGGGXGXGGXGXG 711 G G GGG GGGG G GG G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 37.5 bits (83), Expect = 0.017 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 2/102 (1%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G G GGG GGG GG G G Sbjct: 435 GTTSGVYSISGSDDSASDSDGGGGGGGGGSGGSSPSHRSSGSSSSSSSRRSSPSGSPAIP 494 Query: 758 GXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G GGGGG G GGG G G G Sbjct: 495 TPSGSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGGRGRG 536 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXG 920 GGGGG G GGG G GG G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GGG GG G G G GG Sbjct: 456 GGGGGGGGSGGSSPSHRSSGSSSSSSSRRSSPSGSPAIPTPSGSSSGSSIVRRPRRRRGG 515 Query: 692 GGXXXXGXGGGXGXXGXGXXG 630 GG G GGG G G G Sbjct: 516 GGGGGGGGGGGGGGRGGRGRG 536 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXG 914 GGGG G GGG G G G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXG 906 G GGG G GGG GG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/73 (27%), Positives = 20/73 (27%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXG---XXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGGG G G G G G G G G Sbjct: 455 GGGGGGGGGSGGSSPSHRSSGSSSSSSSRRSSPSGSPAIPTPSGSSSGSSIVRRPRRRRG 514 Query: 814 XXGXGGXGXGXGG 776 G GG G G GG Sbjct: 515 GGGGGGGGGGGGG 527 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXX-GGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GG G GG GG GGG GG GG G GG GGG G Sbjct: 1192 GAECDGGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 980 GGXXGXG-GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG 843 GG G GG G GG GG G G G G GG GGG GG Sbjct: 1197 GGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GG G GG G GGG G GG GG G G GGG Sbjct: 1192 GAECDGGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGIDGGG 1240 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GG G GG GGG GG G GG GG GGG G Sbjct: 1205 GGDGGYGGSDGGGDGG--YGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 G GG G G G G GGG G GG GG G G G G GG Sbjct: 1192 GAECDGGYDGSDDGGDGGY---GGSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G GG GG G G GG G G GG GG GGG G Sbjct: 1192 GAECDGGYDGSDDGGDGG--YGGSDGGGDGGYG-GIDSGGDGGCDGGIDGGGDG 1242 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G G GG G GGG G GG G G GG GG Sbjct: 1192 GAECDGGYDGSDDGGDGGYGGSD--GGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G G G G G GGG G G GG G GG G G Sbjct: 1192 GAECDGGYDGSDDGGDGGYG----GSDGGGDGGYGGIDSGGDGGCDGGIDGGGDGG 1243 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -3 Query: 794 GXXGGGGXGXGG-GXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGG 663 G G GG G GG G G GG G GG G G G G GG G GG Sbjct: 32 GQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGG 77 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGG 810 G G G GG GG G G GG G G G G GG G G G G Sbjct: 30 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXG 726 G G G G G GG G GG G G GG G GG G G GG G G Sbjct: 30 GDGQAGQGGNGQGG--DGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGGGG 690 G GG G G GG G GG G G GG G GG G G GG G Sbjct: 32 GQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPA-GQGGDG 79 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGXXGGXXGG 615 G G GG G G G G G G GG G GG G G G GG G Sbjct: 30 GDGQAGQGGNGQGGDGQA-GQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 887 GGXGXGG-GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 GG G GG G G G G GG G G GG G G G G Sbjct: 37 GGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G G GG G G GG GG G GG G G GG G G Sbjct: 30 GDGQAGQGGNGQGGDGQAG-QGGNGQGG-DGQAGQGGNGQGGDGPAGQGGDGPG 81 >SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) Length = 1085 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/97 (28%), Positives = 28/97 (28%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPP P P PP P PPPP P P P P Sbjct: 945 PRHYTPPPQTPPNQQDIGPRHYAPP--RAPQSYAPPPPAHFMGARYPAPYHRAPGHPFDQ 1002 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PPP PP P P PP Sbjct: 1003 GPFLMEPGRFPPPVSYPSGHRVPPPPRPFPMGAGQPP 1039 Score = 37.9 bits (84), Expect = 0.012 Identities = 31/109 (28%), Positives = 33/109 (30%), Gaps = 9/109 (8%) Frame = +1 Query: 571 HVDRXDXAXXXXXXXPPXXPPXXPX--PXXPXPPPXPXXXXPPPPPX------PXPXPXP 726 H+ + PP PP P PP P PPPP P P Sbjct: 936 HMKKHQDVGPRHYTPPPQTPPNQQDIGPRHYAPPRAPQSYAPPPPAHFMGARYPAPYHRA 995 Query: 727 PX-PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P PPP P PPP P P P PP Sbjct: 996 PGHPFDQGPFLMEPGRFPPPVSYPSGHRVPPP-----PRPFPMGAGQPP 1039 Score = 31.9 bits (69), Expect = 0.82 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 4/88 (4%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPP----PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPX 894 P PPP PP P P P PPP P P P P Sbjct: 945 PRHYTPPPQTPPNQQDIGPRHYAPPRAPQSYAPPPPAHFMGARYPAPYHRAPGHPFDQGP 1004 Query: 895 XXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP P PPP P Sbjct: 1005 FLMEPGRFPPPVSYPSGHRVPPPPRPFP 1032 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXP---PPPXXPPXXXXPPPXXXXP-PXPPPXPPPX 864 P P P PP PP P P P P PP P P P P P PP Sbjct: 130 PQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPRL 189 Query: 865 PPPXPXPPP 891 PP PP Sbjct: 190 PPANKLLPP 198 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PP P P P P P P P P P Sbjct: 125 PHSTTPQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSE 184 Query: 811 PPPXXXXPPXPPPXPP 858 PP PP PP Sbjct: 185 APP--RLPPANKLLPP 198 Score = 35.1 bits (77), Expect = 0.088 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P PP PP P P PP P P P P P P Sbjct: 133 PTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAP---PRL 189 Query: 955 PPPXPXXPP 981 PP PP Sbjct: 190 PPANKLLPP 198 Score = 33.5 bits (73), Expect = 0.27 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P P P PP PP P P P P PP P P P Sbjct: 125 PHSTTPQHPTPQHSPPIRKQTPPSKP----HPSPT---PAQAPPHSRPVAAKRPMPSTPD 177 Query: 898 XXXPXXPXPPXXPPPXPXXPP 960 PP PP PP Sbjct: 178 QNPCPSEAPPRLPPANKLLPP 198 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P P P P PP P P P Sbjct: 139 PPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPRLP-PANKLLP 197 Query: 796 P 798 P Sbjct: 198 P 198 Score = 30.7 bits (66), Expect = 1.9 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P PP P P P P P P PP P P P PP Sbjct: 130 PQHPTPQHSPPIRKQTP-PSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPR 188 Query: 841 PPPXPPPXPP 870 PP PP Sbjct: 189 LPPANKLLPP 198 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P PP PP P P P P P P P P P Sbjct: 130 PQHPTPQHSPPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNP 180 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXX 678 GG GG GGG GGGG GGG GG G G GGGG Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEG---GVAGGGGSYN 384 Query: 677 XG 672 G Sbjct: 385 NG 386 Score = 36.7 bits (81), Expect = 0.029 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 928 GXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G GG GGGG GGG G GGG G G GG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGG 379 Score = 35.9 bits (79), Expect = 0.050 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 2/75 (2%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXX--GGGGXGXGGGXXGG 744 G G GG G GG GG GG GGG GG GG GGG Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYS--GGGLASSGGSTLSSEGGVAGGGGSYNN 385 Query: 743 GGXGXGGXGXGXGXG 699 G G G G Sbjct: 386 GADQKNIAGTNEGDG 400 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GG G GG GGGGG G G GG GG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGST-LSSEGGVAGG 379 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX-GGXXGGGGXGXGG 759 G GG G GGG GGG G GG GG GG GGGG G Sbjct: 328 GGSGGSGT-SEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGG------XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G GGGG G GG G G GG GG G G Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGG 381 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GG G G G GG GG GG G G Sbjct: 338 GGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 Score = 32.3 bits (70), Expect = 0.62 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GGGG GGGG GG GG G GG G G Sbjct: 331 GGSGTSEGGFGGGGATVASRPGGGGGYSGGGLA---SSGGSTLSSEGGVAGGGGSYNNG 386 Score = 31.9 bits (69), Expect = 0.82 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 3/72 (4%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG---XGGGXGGGXGGXXXXGGGXXXXGG 792 G G G G GG G GGG GGG GG GG GG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNGAD 388 Query: 791 XXGGGGXGXGGG 756 G G G Sbjct: 389 QKNIAGTNEGDG 400 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGG 830 GG GG G G G GG GG GGG GG G GGG Sbjct: 328 GGSGGSGTSEGGFG-GGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGG 380 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PPPPP P P P PP P PP P P P P PP Sbjct: 424 PPPPPPPAPLP-PPPPPPPQPTTALPDPLQGPEVALHVEVSSPP 466 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 4/86 (4%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXX----PPXPXPXPPXPXXPXXXXPPPXXPXPP 857 PPPPP PP P P P PPP PP Sbjct: 373 PPPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPP----PP 428 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P P PPPP P P P P Sbjct: 429 PPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPPP P P P PPPP P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P PPP P PPPPP P P P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 35.9 bits (79), Expect = 0.050 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PPP P PPPP P P P P PP P Sbjct: 373 PPPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPPPAP 432 Query: 937 PPXPXXPPPXP 969 P P PPP P Sbjct: 433 LPPPPPPPPQP 443 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPPPXXXXXPXXPXPPXX 933 P P P PPP P PPP PPP P P P P PP Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQ 468 Query: 934 P 936 P Sbjct: 469 P 469 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP PP P P P PPP P P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP PP P PPPP PP P P P PP Sbjct: 424 PPPPPPPAPLPPPP-PPPPQPTTALPDPLQGPEVALHVEVSSPP 466 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P PPP P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQP 443 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXP-XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 P P P PP PPP P PPPP P P P PP Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQ 468 Query: 877 P 879 P Sbjct: 469 P 469 Score = 31.9 bits (69), Expect = 0.82 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 15/77 (19%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPP---------------PXXPPXXXXPPPXXXXPPXPPPXPP 858 PP P PPPP P P PP PPP P Sbjct: 374 PPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPPPAPL 433 Query: 859 PXPPPXPXPPPXXXXXP 909 P PPP P P P Sbjct: 434 PPPPPPPPQPTTALPDP 450 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 PP P P PPP PPP P P P P PP P Sbjct: 424 PPPPPPPAPLPPPP----PPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXP 808 P P P P PPPP P P PP P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALP 448 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 PPP P P P P P P P P P P P PP Sbjct: 424 PPPPPP---PAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPP 466 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 41.1 bits (92), Expect = 0.001 Identities = 37/133 (27%), Positives = 37/133 (27%), Gaps = 11/133 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXP--XPPPXPXXXXPPPPPXP-XPXPXPPXPXPP-PPXXPPPXPXPP- 780 PP P P P PP P PP P P P P P P P P Sbjct: 163 PPTPHPTYKHPSYPTYNIPPTPHTSIPPTPHTSIPPTPRPTYKHPSYPSYKHPSYPSSHI 222 Query: 781 ----PPXXPPXXXXPPPXXXXPPXPPPXP--PPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P PP P P PP P P PP P P Sbjct: 223 QASLLPHIQASLLPLIPNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTS 282 Query: 943 XPXXPPPXPXXPP 981 P P P PP Sbjct: 283 IPPTPTPHTSIPP 295 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/117 (23%), Positives = 28/117 (23%), Gaps = 1/117 (0%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX-PX 812 PP P P P P P P P P P Sbjct: 181 PPTPHTSIPPTPHTSIPPTPRPTYKHPSYPSYKHPSYPSSHIQASLLPHIQASLLPLIPN 240 Query: 813 XPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P PP P P P P P P P PP P Sbjct: 241 TSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTP 297 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/116 (24%), Positives = 28/116 (24%), Gaps = 3/116 (2%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX---PXPPX 806 PP P P P P P P P P P P Sbjct: 189 PPTPHTSIPPTPRPTYKHPSYPSYKHPSYPSSHIQASLLPHIQASLLPLIPNTSIPPTPT 248 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP P PP P P P P P P P P Sbjct: 249 PHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHPTYKHP 304 Score = 37.9 bits (84), Expect = 0.012 Identities = 30/110 (27%), Positives = 30/110 (27%), Gaps = 4/110 (3%) Frame = +1 Query: 631 PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P PP P P PP P P P P P P P PP P Sbjct: 244 PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHPTYKH 303 Query: 808 XPPPXXXXPPXPPP---XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P P P P P P P P Sbjct: 304 ---PSYSYPTYKHPSYSYPSYKHPSYPSSHIQASLLPLIPHTSIPPTPHP 350 Score = 36.7 bits (81), Expect = 0.029 Identities = 34/129 (26%), Positives = 34/129 (26%), Gaps = 12/129 (9%) Frame = +1 Query: 631 PXXPXPXXPXP----PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP---PPXPXPPPPX 789 P P P P P P PP P P P P PP P P P P Sbjct: 158 PHTSIPPTPHPTYKHPSYPTYNIPPTPHTSIP-PTPHTSIPPTPRPTYKHPSYPSYKHPS 216 Query: 790 XPPXXXXPP-----PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P PP P P PP P P P Sbjct: 217 YPSSHIQASLLPHIQASLLPLIPNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPT 276 Query: 955 PPPXPXXPP 981 P P PP Sbjct: 277 PTPHTSIPP 285 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P PP P P P P P P P PP P P P P Sbjct: 236 PLIPNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPP 295 Query: 844 PPXPPPXPPPXPXP 885 P P P P Sbjct: 296 TPHPTYKHPSYSYP 309 Score = 34.7 bits (76), Expect = 0.12 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = +1 Query: 646 PXXPXPP-PXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P P P P P P P P P P P P P P P Sbjct: 127 PTYKHPPFPHPTYKHPSYPSPHIQASLLPLIPHTSIP--PTPHPTYKHPSYPTYNIPPTP 184 Query: 820 XXXXPPXPPPXPPPXPPP 873 PP P PP P P Sbjct: 185 HTSIPPTPHTSIPPTPRP 202 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 5/92 (5%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P PP P P P P P P PP P P PP Sbjct: 124 PSYPTYKHPPFPHPTYKHPSYPSPHIQASLLPLIPHTSIPPTPHPTYKHPSYPTYNIPPT 183 Query: 841 PPPXPPPXP----PPXPXPPPXXXXXPXXPXP 924 P PP P PP P P P P Sbjct: 184 PHTSIPPTPHTSIPPTPRPTYKHPSYPSYKHP 215 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 PP P P P P PP PP P PP P P P P P Sbjct: 163 PPTPHPTYKHPSYPTYNIPPTPHTSIPP-TPHTSIPPTPRPTYKHPSYPSYKHPSYP 218 Score = 31.9 bits (69), Expect = 0.82 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 1/81 (1%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP-PPXPPPXPPPXPXPPPXXX 900 P PP P P P P P PP P P P P PP Sbjct: 127 PTYKHPPFPHPTYKHPSYPSPHIQASLLPLIPHTSIPPTPHPTYKHPSYPTYNIPPTPHT 186 Query: 901 XXPXXPXPPXXPPPXPXXPPP 963 P P P P P P Sbjct: 187 SIPPTPHTSIPPTPRPTYKHP 207 Score = 31.5 bits (68), Expect = 1.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 2/75 (2%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP--PPXPPPXPXPPPXXXXXPXXPXPPXX 933 PP P P P P P PP P P PP P P PP P P Sbjct: 244 PPTPTPHTSIPPT----PTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHP 299 Query: 934 PPPXPXXPPPXPXXP 978 P P P Sbjct: 300 TYKHPSYSYPTYKHP 314 Score = 31.5 bits (68), Expect = 1.1 Identities = 26/100 (26%), Positives = 26/100 (26%), Gaps = 2/100 (2%) Frame = +1 Query: 631 PXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P PP P P PP P P P P P P P P Sbjct: 264 PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHPTYKHPSYSYPTYKHPSYSYPSYKH 323 Query: 808 XP-PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P PP P P P P Sbjct: 324 PSYPSSHIQASLLPLIPHTSIPPTPHPTYKHSSYPSYKHP 363 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P PPPP P P P P PP P P PP Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRLLPTPPPP--TPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P P P P PP P P P P P PP P P PP Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 6/78 (7%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PP P P P P P P P P P PP P Sbjct: 90 PLNLSSPPNSTPSTAQAVANNDPTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPK 149 Query: 853 P------PPXPPPXPXPP 888 P PP PP P PP Sbjct: 150 PRRVLPTPPPKPPTPRPP 167 Score = 35.5 bits (78), Expect = 0.067 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXX----PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP P P P P PPPP PP P P P P PP P PP Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPP-QSTPKPRRVLP-TPPPKPPTPRPP 167 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PP P P P P PPP PP P P P PP PP Sbjct: 115 PTPPFSTPR---PRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_10888| Best HMM Match : Collagen (HMM E-Value=7.5) Length = 208 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GG G G G G G G G G G G G G Sbjct: 27 GRGRMADSGGMAGSGHMAGSGRMAGSGRMAGSGRMAGTGRMAGSGHMAGSGRMAGSGRMA 86 Query: 782 GGGXGXGGGXXGGGG--XGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G G G G G G G G G G Sbjct: 87 GSGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAGSGRMAGSGRMAG 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G G Sbjct: 57 GSGRMAGTGRMAGSGHMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMADSGRMA 116 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXG--XGGGXGXXGXGXXGG 627 G G G G G G G G G G G G G G G G G Sbjct: 117 GSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGGMAGSGHMAG 171 Score = 39.1 bits (87), Expect = 0.005 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G Sbjct: 75 GSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAGSGRMA 134 Query: 782 GGGXGXGGGXXGGGG--XGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G G G G G G G G G G G Sbjct: 135 GSGRMAGSGRMAGSGRMAGSGRMAGSGGMAGSGHMAGSGCMAGSGRMAGSGHMAG 189 Score = 38.7 bits (86), Expect = 0.007 Identities = 38/128 (29%), Positives = 38/128 (29%), Gaps = 7/128 (5%) Frame = -3 Query: 980 GGXXGXG---GGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 GG G G G G G G G G G G G G G G G G Sbjct: 35 GGMAGSGHMAGSGRMAGSGRMAGSGRMAGTGRMAGSGHMAGSGRMAGSGRMAGSGRMAGS 94 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXG-XGGGGGXXXXGXGGGXG-XXGX 642 G G G G G G G G G G G G G G G G G Sbjct: 95 GRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGS 154 Query: 641 GXXGGXXG 618 G G G Sbjct: 155 GRMAGSGG 162 Score = 37.5 bits (83), Expect = 0.017 Identities = 32/116 (27%), Positives = 32/116 (27%), Gaps = 1/116 (0%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G G Sbjct: 51 GSGRMAGSGRMAGTGRMAGSGHMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMA 110 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G G G G G G G G G GG G Sbjct: 111 DSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSG-RMAGSGRMAGSGRMAGSGGMAG 165 Score = 37.5 bits (83), Expect = 0.017 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G Sbjct: 87 GSGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMA 146 Query: 782 GGGXGXGGGXXGG-GGXGXGGXGXGXG-XGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G GG G G G G G G G G G G G Sbjct: 147 GSGRMAGSGRMAGSGGMAGSGHMAGSGCMAGSGRMAGSGHMAGSGRMVGSGHMAG 201 Score = 36.7 bits (81), Expect = 0.029 Identities = 34/120 (28%), Positives = 34/120 (28%), Gaps = 3/120 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GG G G G G G G G G G G G G G Sbjct: 29 GRMADSGGMAG-SGHMAGSGRMAGSGRMAGSGRMAGTGRMAGSGHMAGSGRMAGSGRMAG 87 Query: 797 GGXXGGGGXGXGGGXXGGGG-XGXGGXGXGXG-XGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G G G G G G G G G G G G Sbjct: 88 SGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAG 147 Score = 35.5 bits (78), Expect = 0.067 Identities = 29/116 (25%), Positives = 29/116 (25%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G Sbjct: 9 GSGRMADSGRMAGSGRMAGRGRMADSGGMAGSGHMAGSGRMAGSGRMAGSGRMAGTGRMA 68 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G G G G G G G Sbjct: 69 GSGHMAGSGRMAGSGR-MAGSGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAG 123 Score = 35.5 bits (78), Expect = 0.067 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G G G G G G G G G Sbjct: 117 GSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGGMAGSGHMAGSGCMA 176 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXG 705 G G G G G G G G G G Sbjct: 177 GSGRMAGSGHMAGSGRMVGSGHMAGSG 203 Score = 34.3 bits (75), Expect = 0.15 Identities = 32/109 (29%), Positives = 32/109 (29%), Gaps = 4/109 (3%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX 765 G G G G G G G G G G G G G G G G Sbjct: 21 GSGRMAGRGRMADSGGMAGSGHMAGSGRMAGSGRMAGSGRMAGTGRMAGSGHMAGSGRMA 80 Query: 764 GGGXXGGGGXGXG-GXGXGXGX-GGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G G G G G G G G G G Sbjct: 81 GSGRMAGSGRMAGSGRMAGSGRMAGSGRMADSGRMAGSGRMAGSGRMAG 129 Score = 33.5 bits (73), Expect = 0.27 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = -3 Query: 941 GGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXG 768 G G G G G G G G G G G G G GG G G G Sbjct: 117 GSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGRMAGSGGMAGSGHMAGSGCMA 176 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G G G G Sbjct: 177 GSGRMAGSGHMAGSGRMVGSGHMAGSG 203 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P P P P P PP P P P P P P P P P Sbjct: 20 PRPHRPIAPSPLGPTTPS--PPSHHGPISLRPHRPTIPSPHDPITPRPHRPTAPRPHDPI 77 Query: 898 XXXPXXPXPPXXP-PPXPXXP-PPXPXXPP 981 P P P P P P P P P PP Sbjct: 78 APRPRSPHGPVAPRPHRPISPRPHRPTTPP 107 Score = 39.1 bits (87), Expect = 0.005 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 4/91 (4%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXP-PPXPXPPPPXXPPXX 804 P P P P P P PP P P P P P P P P P P Sbjct: 17 PTAPRPHRPIAPSPLGPTTPSPPSHHGPISLRPHRPTIPSPHDPITPRPHRPTAPRPHDP 76 Query: 805 XXPPPXXXXPPXPP-PXPPPXP-PPXPXPPP 891 P P P P P P P P P PP Sbjct: 77 IAPRPRSPHGPVAPRPHRPISPRPHRPTTPP 107 Score = 37.1 bits (82), Expect = 0.022 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 7/88 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXP----PPXPXPP 780 P P P P P P P P P P P P P P P P P P Sbjct: 20 PRPHRPIAPSPLGPTTPSPPSHHGPISLRPHRPTIPSPHDPITPRPHRPTAPRPHDPIAP 79 Query: 781 PPXXPPXXXXPPPXXXXPPXP--PPXPP 858 P P P P P P P PP Sbjct: 80 RPRSPHGPVAPRPHRPISPRPHRPTTPP 107 Score = 34.7 bits (76), Expect = 0.12 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXP----PPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P PP P P P P P P P P P Sbjct: 17 PTAPRPHRPIAPSPL-GPTTPSPPSHHGPISLRPHRPTIPSPHDP---ITPRPHRPTAPR 72 Query: 841 P--PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P PP Sbjct: 73 PHDPIAPRPRSPHGPVAPRPHRPISPRPHRPTTPP 107 Score = 29.5 bits (63), Expect = 4.4 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 5/87 (5%) Frame = +1 Query: 733 PXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P P P P P P P PP P P P P P P P P P Sbjct: 17 PTAPRPHRPIAPSPLGPTTPSPPSHHGP---ISLRPHRPTIPSPHDPITPRP-----HRP 68 Query: 910 XXPXP--PXXP-PPXPXXP-PPXPXXP 978 P P P P P P P P P P Sbjct: 69 TAPRPHDPIAPRPRSPHGPVAPRPHRP 95 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXX 933 PPP P PPP P P P PP PP P PPP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQY 197 Query: 934 PPPXPXXP 957 PPP P Sbjct: 198 PPPDVAPP 205 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +1 Query: 739 PPPPXXPPPXPXP--PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 PP P PPP PPP P P PP PP PPP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPP--PPAPPPAYPPVTQGYNMSQ 196 Query: 913 XPXPPXXPP 939 P P PP Sbjct: 197 YPPPDVAPP 205 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP--PPPXXPPXXXXP 813 P P PPP PPP P PP PPP P P PP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQY 197 Query: 814 PPXXXXPP 837 PP PP Sbjct: 198 PPPDVAPP 205 Score = 37.5 bits (83), Expect = 0.017 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP----PP 861 PPP P P PPP P P PP PPP P PP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAP-PPAYPPVTQGYNMSQ 196 Query: 862 XPPPXPXPP 888 PPP PP Sbjct: 197 YPPPDVAPP 205 Score = 36.7 bits (81), Expect = 0.029 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P PPP P P P P P PPP PP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQYP 198 Query: 796 PXXXXPP 816 P PP Sbjct: 199 PPDVAPP 205 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP PPP P PP PPP P PPP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPP-PAPPPAYPPVTQGYNMSQY 197 Query: 826 XXPPXPPP 849 P PP Sbjct: 198 PPPDVAPP 205 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 PPP P PP P P P P PP PPPP PP P Sbjct: 138 PPPGPQAP-PPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPA-PPPAYPPVTQGYNMS 195 Query: 838 XPPPXPPPXPP 870 PP P PP Sbjct: 196 QYPP-PDVAPP 205 Score = 32.3 bits (70), Expect = 0.62 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP---PPPXPPXXXXPXPXPXPPXXPX 950 P P P P P PP P P P PPP P P P Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYP-PVTQGYNMSQ 196 Query: 951 XPPPXPXPP 977 PPP PP Sbjct: 197 YPPPDVAPP 205 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPPXPXXPP 981 P P P PP PPP P PP P P P P PP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXP---XPPXXPPPXPXXPPPXP 969 PP P PPP PP P PP PP P PP P Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYP 186 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXP 924 P PPP P PPP PP P PP PP PP P P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPGGAPSPMGGGP 488 Query: 925 PXXPPPXP 948 P P P Sbjct: 489 PGGPSGSP 496 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP--XXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P PP PPP P P P PP P PP P P P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPGGAPSPMGGGP 488 Query: 871 P 873 P Sbjct: 489 P 489 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP 744 PP P P P P P PPP P P P P PP Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 9/75 (12%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP---------PXXXXP 813 PP PPP P P P PP P P P P P PP P P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTP-PRPPTTMTTILTTIATSGPPGGAP 481 Query: 814 PPXXXXPPXPPPXPP 858 P PP P P Sbjct: 482 SPMGGGPPGGPSGSP 496 Score = 35.9 bits (79), Expect = 0.050 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 PP P PP P PP PP P P P P PP P P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPP----TTPLPQTVPTPPRPPTTMTTILTTIATSGP-P 477 Query: 925 PXXPPPXPXXPPPXPXXPP 981 P P PP P P Sbjct: 478 GGAPSPMGGGPPGGPSGSP 496 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 40.3 bits (90), Expect = 0.002 Identities = 36/113 (31%), Positives = 36/113 (31%), Gaps = 5/113 (4%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXXGGGGXGX 765 GGG G G G G G G G GG GG G G G Sbjct: 199 GGGTGGHGGRIYDIYEKSYDIPLPVGAGAGLKTNGASGVNATGGSAYVNGGEGGLGTTGS 258 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGG----GXXXXGXGGGXGXXGXGXXGGXXG 618 GG GGGG G G G GGG GGG G G G G Sbjct: 259 EGGF-GGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAGSGQEGEVRG 310 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G G GG G G GG GGG GGG GG Sbjct: 224 GAGAGLKTNGASGVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGV 283 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G G G G G G Sbjct: 284 TRATRYSKSGG-GGSYNAGSGQEGEVRGQKGEG 315 Score = 37.5 bits (83), Expect = 0.017 Identities = 33/111 (29%), Positives = 33/111 (29%), Gaps = 7/111 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGGGXXX 801 G GG G GG G G G G G GG GG Sbjct: 193 GDGSLEGGGTGGHGGRIYDIYEKSYDIPLPVGAGAGLKTNGASGVNATGGSAYVNGGEGG 252 Query: 800 XGGXXGGGGXGXGGGXX----GGGGXGXGG--XGXGXGXGGGGGXXXXGXG 666 G GG G GG GGGG GG GGGG G G Sbjct: 253 LGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAGSG 303 Score = 35.1 bits (77), Expect = 0.088 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG GG G GG GGGG GGG G GGG Sbjct: 233 GASGVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYA-GGGGGYSGGGVTRATRYSK 291 Query: 802 GGXG 791 G G Sbjct: 292 SGGG 295 Score = 32.7 bits (71), Expect = 0.47 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = -3 Query: 890 GGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG GG GG G G GG GGG GGGG GGG G G Sbjct: 241 GGSAYVNGGEGGLGTTGSEGGFG--GGGAAFL--YAGGGGGYSGGGVTRATRYSKSGGGG 296 Query: 713 GXGXGGGGGXXXXGXGG 663 G G G G Sbjct: 297 SYNAGSGQEGEVRGQKG 313 Score = 31.5 bits (68), Expect = 1.1 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG G G G G GG G G G GGG G GGG G G Sbjct: 248 GGEG-GLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAGSGQEG 306 Query: 796 XGXGXGG 776 G G Sbjct: 307 EVRGQKG 313 Score = 31.1 bits (67), Expect = 1.4 Identities = 32/114 (28%), Positives = 32/114 (28%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G G G G G GGG GG GG G G Sbjct: 171 GIPGDGVAPWQGWHDGNAGQLSGDGSLEGGGTGG-HGGRIYDIYEKSYDIPLPVGAGAGL 229 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G G G G G G GGG G GG GG Sbjct: 230 KTNGASGVNATGGSAYVNGGEG-GLGTTGSEGGFG-GGGAAFLYAGGGGGYSGG 281 Score = 31.1 bits (67), Expect = 1.4 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 6/90 (6%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX------GGGXXGGGGXGX 729 G G G G GG GG G G GG G GGG GGG Sbjct: 226 GAGLKTNGASGVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTR 285 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GG G G G G Sbjct: 286 ATRYSKSGGGGSYNAGSGQEGEVRGQKGEG 315 Score = 30.7 bits (66), Expect = 1.9 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 1/88 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG-XGGGXGGXXXXGGGXXX 801 G G GG G G G G GGG GG GG G Sbjct: 228 GLKTNGASGVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRAT 287 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGGG G G G G G Sbjct: 288 RYSKSGGGGSYNAGSGQEGEVRGQKGEG 315 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPP 798 P PPPP PPP P PPPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 PPPPP P P PP P PPPP P P Sbjct: 54 PPPPPPPPP---PPPPPPPPPSSSPSRP 78 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXP 909 P PPP PPP PPP P PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXP 918 PP PPP PPP P PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPP 786 P P PP P PPPP PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 38.7 bits (86), Expect = 0.007 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXP 885 PP PPP PPP PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 PP PPP PPP PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXP 795 PP P PPPP PPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXP 923 PPP PP P PPPP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXP 735 PPP P PPPPP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPP 729 P PPP P PPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPP 888 PP PP PPP PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXPP 982 P PPP P P PP P PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXP 813 PPP PPP P PPPP PP P Sbjct: 54 PPP--PPPPPPPPPPPPPPPSSSP 75 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPP 873 PPP PP PPP PPP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 PPP PP PPP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXP 899 PPP P PPP PP P P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 725 PXXPXPPPPXXPPPXXXPPXPXXXPXXP 808 P P PPPP PPP PP P P P Sbjct: 54 PPPPPPPPPPPPPP---PPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P PPPP PP PPP P P Sbjct: 54 PPPPPPPPPPPPP---PPPPPSSSPSRP 78 Score = 33.1 bits (72), Expect = 0.36 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPP PPP P PPP P PP P P Sbjct: 54 PPPPPPPPPPPPP-------PPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXP 956 PPPP PP P P P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 PPP P PPP PP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PPPP PP PPP PP PPP P P Sbjct: 54 PPPPPPPP----PPP---PPPPPPPSSSPSRP 78 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPP 819 PPP P PPPP PP PPP Sbjct: 55 PPPPPPPPPPPPPP----PPP 71 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPP 816 PP PPP P PPPP PP P Sbjct: 54 PP--PPPPPPPPPPPPPPPPSSSP 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXP 714 P P P PPP P PPPPP P Sbjct: 54 PPPPPPPPPPPP---PPPPPPSSSP 75 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 887 PPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 PP P P PPP P P PP P P Sbjct: 54 PPPP---PPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP 690 PP PP P P P PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXP 958 PPP P P PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP 699 PP P P P PPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPP 702 PP P P P PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXP 878 P PP P P PPP P PP P P Sbjct: 54 PPPPPPPPP----PPPPPPPPPSSSPSRP 78 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXGXXGGXXGG 615 G GG GGG G G G G GGGG GGG G G G G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGGG G G GGG G G G G GGGG GGG Sbjct: 78 GGCEGGGGSG--GCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGG 121 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GG G G GG G G G G G GGGG G GG G GG Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 37.5 bits (83), Expect = 0.017 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG GGG G GGG G GGG G G GGG G G G G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCV---GCEGGG--GCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GG GGG GG GGG GGG G G G GGG G G Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEG 127 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G GGG GG GG G GGG G GGGG G GGGG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCV--GCEGGGGC---VGCEGGGG 121 Score = 35.5 bits (78), Expect = 0.067 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -3 Query: 818 GGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G GG GG GG G G GGG G G G G GGGG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGG 121 Score = 35.5 bits (78), Expect = 0.067 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GG GGG G GG G G GGGG G GG G GGG Sbjct: 76 GCGGCEGGGGSGGCEGGGGC------VGCEGGGGCVGCEGGGGCVGCEGGG 120 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G GGGG G G GG G GGG G G G GG Sbjct: 79 GCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGG 120 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG G G G GGG G G G G GG G GG G G Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVG 124 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -1 Query: 955 GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G GG G G G GGGG G GG G GGG G G GG GG Sbjct: 76 GCGGCEGGGGSG------GCEGGGGCVGCEGGGGCVGCEGGG-GCVGCEGGGGCVGCEGG 128 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGG--GXXXXGGXXGGGGXGXGGGXXGG 744 GG G GG G GGG G GG G GG G G G G GG Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G G G G GGG G GG GG GG G GGG G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGG-GGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 GG G GGG G G G GGG G GGG G GG G Sbjct: 78 GGCEG-GGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVG 124 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 884 GXGXGGGXGGGXGG--GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G G GGG GG G GG GG G GGG G G GGG G G Sbjct: 76 GCGGCEG-GGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEG---GGGCVGCEG 127 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P P PP P P P PP Sbjct: 315 PPNQQQPLYPGQQQQPGQQKPIMPLMQAPQVGPPGNMSMPNHRPQGLPPGMPPMALSLPG 374 Query: 808 XPPPXXXXPPXPPPXPP 858 PPP PP PP P Sbjct: 375 MPPPGLLPPPGMPPRLP 391 Score = 35.9 bits (79), Expect = 0.050 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P PP P PPP PPP P Sbjct: 330 PGQQKPIMPLMQAPQVGPPGNMSMPNHRPQGLPPGMPPMAL-SLPGMPPPGLLPPPGMPP 388 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P PP Sbjct: 389 ---RLPIPGLGLPGMPLPGMPGMPP 410 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P PP P P PP PP Sbjct: 310 PGQQQPPNQQQPLYPGQQQQPGQQKPIMPLMQAPQVGPPGNMSMPNHRPQGLPPGMPPMA 369 Query: 880 XPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P PP PP P P P Sbjct: 370 LSLPGMPPPGLLP-PPGMPPRLPIPGLGLPGMP 401 Score = 30.7 bits (66), Expect = 1.9 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 4/98 (4%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P P P P PP PP P Sbjct: 315 PPNQQQPLYPGQQQQPGQQKPIMPLMQAPQVGPPGNMSMPNHR-PQGLPPGMPPMALSLP 373 Query: 880 XPPPXXXXXPXXPXPPXXPPP---XPXXP-PPXPXXPP 981 PP P PP P P P P P P PP Sbjct: 374 GMPPPGLLPPPG-MPPRLPIPGLGLPGMPLPGMPGMPP 410 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 698 PPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 PP P PPP PPP P P P P P Sbjct: 362 PPGMPPMALSLPGMPPPGLLPPPGMPPRLPIPGLGLPGMPLP 403 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GGG G GGG GG G G G G G G G GG G G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGPGHGHGHGAGLVHGDGGPGPGHG 179 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 890 GGGXGXGGGXGGGXG--GGXGGXXXXGGGXXXXGG-XXGGGGXGXGGG 756 GGG G GG GGG G GG G G G G G GG G G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGPGHGHGHGAGLVHGDGGPGPGHG 179 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG-XXGGGGXGXG 726 G G G GG GG GG G G G G G G G GG G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGP--GHGHGHGAGLVHGDGGPGPG 177 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 889 GGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GGG G G GGG G GG G G G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGPGHGHGHGAG 166 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P PP P P PP P PP PP P PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PP P P PP PP P PP P PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDP--PVPPTNPPVPPTNPPAPPTNPP 257 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PP P PP PP PP PP P PP Sbjct: 215 PTQAPRPPTTQTPP--TKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP PP P PP PP P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP PP P PP PP PP PP PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PP PP P PP PP PP P PP P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PP P P P PP P PP P PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PP P P PP P P PP PP PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNP-PVPPTNPPAPPTNPP 257 Score = 36.3 bits (80), Expect = 0.038 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PP PP P PP PP P PP P PP PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPP-----TNPPAPPTNPP 257 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PP PP P P P PP P PP P PP Sbjct: 215 PTQAPRPPTTQTPPTKAP--TDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P P P PP PP PP P P P P PP P P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVP-PTNPPAPPTNPPKP 259 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P PP PP P P PP PP PP PP PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPP--TNPPVPPTNPPAPPTNPP 257 Score = 35.5 bits (78), Expect = 0.067 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P PP PP PP P PP PP PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 655 PXPPPX--PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PP P P PP P P P PP P PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P P P P P PP P PP P Sbjct: 209 PGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXP 808 PP P P P PP P P PP P P P Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 P P P PP P P P PP PP P Sbjct: 228 PTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P PP P PP P PP P PP P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P PP PP P P PP PP P P P PP P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVP------PTNPPAPPTNPPKP 259 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 3/87 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P PPP P P P P P P P P P P Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTY 513 Query: 814 PPXXXXPPXPPPXPP-PXPPPXPXPPP 891 P P P P PPP P PPP Sbjct: 514 SPSCCGSYPAPQPPSPPAPPPKPAPPP 540 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP P PPP P P P P P P P Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTY 513 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PPP P PP Sbjct: 514 SPSCCGSYPAPQ---PPSPPAPPPKPAPPP 540 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXP 795 P P PP P PPP P PPP P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPP 544 Score = 35.5 bits (78), Expect = 0.067 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P P PP P PPP P PPP Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPP-APPPKPAPPP 540 Score = 34.7 bits (76), Expect = 0.12 Identities = 26/107 (24%), Positives = 26/107 (24%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P P P P P P Sbjct: 454 PQGPPPPPPPP-----PQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPS 508 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P P PP PP P PPP PP P P Sbjct: 509 CAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 33.5 bits (73), Expect = 0.27 Identities = 27/105 (25%), Positives = 27/105 (25%) Frame = +2 Query: 668 PXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXX 847 P PPPPP P P P P P P P Sbjct: 454 PQGPPPPPPPPPQMYQQPL-MMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQP---CAPSC 509 Query: 848 XXXXXXXXXXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 P P P P PPP P PP PP P P Sbjct: 510 APTYSPSCCGSYPAPQPPSPPAPPP---KPAPPPRSPPAAAPCNP 551 Score = 33.1 bits (72), Expect = 0.36 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 5/102 (4%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPX-PPPXP 866 PPPPP PP P P P P P P Sbjct: 457 PPPPPP--PPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTYS 514 Query: 867 PXX----PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PP P P P P P P P P Sbjct: 515 PSCCGSYPAPQPPSPPAPP-PKPAPPPRSPPAAAPCNPAMAP 555 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 PPP P P P P PP PP PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPP 888 PP PPP PPP PPP PP Sbjct: 431 PPTPPPTPPPTPPPTTLPP 449 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P PP P PPP PP PP P Sbjct: 430 PPPTPPPTPP-PTPPPTTLPPTTQPPPQP 457 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 PPP P P PPP P P PP PPP Sbjct: 430 PPPTPP---PTPPPTPPPTTLPPTTQPPP 455 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXP-PPXPXPPP 891 PPP PP PPP PPP PP PPP Sbjct: 430 PPPTP--PPTPPPTPPPTTLPPTTQPPP 455 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPP 798 PP P P PP PPP PP PP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPP 816 PPP P P P PPP PP PP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 PPP PPP PPP P P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PPP PPP P P P P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 745 PPXXPPPXPXP-PPPXXPPXXXXPPP 819 PP PPP P P PPP P PPP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PPP P P PP PP PP PP P Sbjct: 430 PPPTPPPTPPPTPPPTTL-PPTTQPPPQP 457 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 PPP PP P PPP PP P P P Sbjct: 430 PPPTPP--PTPPPTPPPTTLPPTTQPPP 455 Score = 33.1 bits (72), Expect = 0.36 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PP P PPP PP P PPP P P P P Sbjct: 430 PP--PTPPPTPP--PTPPPTTLPPTTQPPPQP 457 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 PP P PPP PP PP PP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPP 454 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 885 PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP PP P P P PP P PP PPP Sbjct: 430 PPPTPP----PTPPPTPP--PTTLPPTTQPPP 455 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP PP PP PP P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPP P P P P P PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPP 702 PP PP P P P P P PPP P Sbjct: 430 PPPTPPPTP-PPTPPPTTLPPTTQPPPQP 457 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +3 Query: 864 PPXXPXP-PPPXPPXXXXPXPXPXPPXXP 947 PP P P PPP PP P P PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLP-PTTQPPPQP 457 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 P PPP P P PPP P P P P Sbjct: 432 PTPPPTPP---PTPPPTTLPPTTQPPPQP 457 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 PPP PP P P P P P P P P Sbjct: 430 PPPTPPP---TPPPTPPPTTLPPTTQPPPQP 457 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP P P PPP PPP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP---XPPXXPXXPPPXPXPPPP 983 P PPP PPP PP P P P P P P PP PPPP Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXPPXPXPPP-PXXPPPXPXPPPP 786 P P P PPP PP P P P P P P P PP PPPP Sbjct: 21 PGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PP PPP PP P P P P P P PP PP P Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P PP P PPP P P P P P P P PP P P Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPP 76 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P PP P P P P P P PP PPP Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPP 76 Score = 31.9 bits (69), Expect = 0.82 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP-----XPXPPPPXXPPXXXX 810 P PPP P PPP PP P P P P P P PP Sbjct: 19 PRPGAPPPMP----QQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGP 74 Query: 811 PPP 819 PPP Sbjct: 75 PPP 77 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 2/59 (3%) Frame = +1 Query: 673 PXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXP 843 P PPP P P P P P P P P P P P P PP P Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P P PP P P P P PP PP P Sbjct: 19 PRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 >SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) Length = 708 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/98 (29%), Positives = 29/98 (29%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G G GG GG GG G G G GG Sbjct: 589 GDGTAHGAAAGAEGLRREADPGTGRKGGHGGSQAEA-GGMWGGARGYPGTGRKGGHGGSQ 647 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G G G GG GG G Sbjct: 648 AKAGGMWGGARGYPGTGRESGHGGAQAESGGMLGGVCG 685 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/83 (28%), Positives = 24/83 (28%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G G GG G GG G G G G GG Sbjct: 589 GDGTAHGAAAGAEGLRREADPGTGRKGGHGGSQAEAGGMWGGARGYPGTGRKGGHGGSQA 648 Query: 686 XXXXGXGGGXGXXGXGXXGGXXG 618 GG G G G G G Sbjct: 649 KAGGMWGGARGYPGTGRESGHGG 671 Score = 34.3 bits (75), Expect = 0.15 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 2/100 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGGGX 807 G G G G G G G GG GG GG G G G GG Sbjct: 591 GTAHGAAAGAEGLRREADPGTGRKGGH---GGSQAEAGGMWGGARGYPGTGRKGGHGGSQ 647 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GG G G G G G G G G Sbjct: 648 AKAGGMWGGARGYPGTGRESGHGGAQAESGGMLGGVCGFG 687 Score = 29.9 bits (64), Expect = 3.3 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G G GG G GG GG G GG G G G G Sbjct: 615 GGHGGSQAEAG--GMWGGARGYPGTGRKGGHGGSQAKAGGMWGGARGYPGTGR----ESG 668 Query: 805 XGGXGXGXGG 776 GG GG Sbjct: 669 HGGAQAESGG 678 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPP 786 P P P PPPP PPP P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPP 765 PP P P P PP P PPPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPP 888 P PP PPP PPP PPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPP 902 PP P PPP PP P PPPP PP Sbjct: 1307 PPESPPPPP-PPPPPPPPPPLPP 1328 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXP 795 PP PPPP PPP P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXP 885 PP PP PPP PPP PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPP 798 P PPPP PPP P PPPP PP Sbjct: 1307 PPESPPPP--PPPPPPPPPPPLPP 1328 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPP 750 PPPP P P P PP P PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXP 735 PP PPPPP P P P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPP 744 P PPPPP P P P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXP 813 PP PPP P PPPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPP 816 PP PPP P PPPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXP 923 PP PP P PPPP PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXP 759 PP P P P P PP P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXP 771 P P P PP P PPPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.5 bits (78), Expect = 0.067 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXP-PPXP 879 PP PP PPP PPP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPP 938 PP P PPPP PP P P P PP Sbjct: 1307 PPESPPPPPPPPP---PPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPP 858 PP PPP PP PPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXP 909 PP PP PPP P PPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 896 PXXXPXPPPXPXXPXPPXPXPP 961 P P PPP P P PP P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPXPXXPXPPXPXPPXXPPXPP 982 PP P PP P PP PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 915 PXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P PPP P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP 699 PP P P P PPP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXP 924 PP PPP P PPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 33.1 bits (72), Expect = 0.36 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P P P P PP P PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXP 899 P P PPP PP P P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP 867 P PPP PP PPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXP 720 P PPP P PPPPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLP-PTP 1330 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 856 PPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP PP P PPP P P PP P P Sbjct: 1307 PPESPPPPPPPP-----PPPPPPPLPPTP 1330 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXP 952 PPP P P PPP P P PP P Sbjct: 1311 PPPPP---PPPPPPPPPPLPPTP 1330 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPP 961 PP P P PPP P P PP P P Sbjct: 1307 PPESPP--PPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPP 846 PP PP PPP PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PP P PP PPP P PPP PP Sbjct: 1307 PPESPPPPP---------PPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXP 708 P P PPP P PP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 1/99 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXX 792 PP P P P P P PP P P P P P P P P Sbjct: 11 PPLATALCPTPCY-GPVPHPLLRPCAPPLATALSPPPATALCPTPCYGPVPHPLLRPCVP 69 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PP P P PPP P P P P P Sbjct: 70 PPATALVPHPLPRPCAPPPATALCPTPCYGPVPHPCYGP 108 Score = 36.7 bits (81), Expect = 0.029 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 2/107 (1%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P PP P P P P P P P PP P P Sbjct: 2 PHPLLRPGAPPLATALCPTPCYGPVPHPLLRPCAPPLATALSPPPATALCPTPCYGPVPH 61 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXPPPXPXXPP 981 P P PPP P P P P P P P P P P Sbjct: 62 PLLRPCVPPPATALVPHPLPRPCAPPPATALCPTPCYGPVPHPCYGP 108 Score = 33.1 bits (72), Expect = 0.36 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 9/81 (11%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPX-----PPXPX---PPPPXXPPPXP-XPPPPXXPPXXX 807 P PP P P P P P PP PPP P P P P Sbjct: 8 PGAPPLATALCPTPCYGPVPHPLLRPCAPPLATALSPPPATALCPTPCYGPVPHPLLRPC 67 Query: 808 XPPPXXXXPPXPPPXPPPXPP 870 PPP P P P P PP Sbjct: 68 VPPPATALVPHPLPRPCAPPP 88 >SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) Length = 332 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GGG G G GGG GG G GG G G G GGG Sbjct: 114 GHGGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGG 168 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 884 GXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G GGG G GG GGG GG G G G GG GG Sbjct: 114 GHGGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGG 168 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = -3 Query: 947 GXGGGXXG--GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G GGG G G GGG GGG G GGG G G GG G Sbjct: 116 GGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGG-GNDSVGASGGYCGGGIVANG 173 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG--GGXXXXGXXGXG 800 G G GGG G G GG GG G GGG G GG G G Sbjct: 114 GHGGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGGIVANG 173 Score = 32.7 bits (71), Expect = 0.47 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 4/95 (4%) Frame = -3 Query: 890 GGGXGXGG--GXGGGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGGGXXGGGGXGXGGX 720 GGG G G GG G GG G G G G GG GGG G Sbjct: 116 GGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGGIVANGDA 175 Query: 719 GXGXGXGGGGGXXXXGXG-GGXGXXGXGXXGGXXG 618 G G GG G G G Sbjct: 176 SVVIGSDESGDYITADDDIGGEDEGSRGAIGNTDG 210 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 G G GG G G GGG G G GG G G GG Sbjct: 114 GHGGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGG 168 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = -1 Query: 985 GGGGGX-GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GG G GG G G G G GGGG G G G GGG G Sbjct: 119 GGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASG---GYCGGGIVANG 173 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 GGG GGG GG G GG GGG G G G G Sbjct: 137 GGGDDSGGGDDSGDGGGG-NDSVGASGGYCGGGIVANGDASVVIGSDESGDYITADDDIG 195 Query: 799 GXGXGXGG 776 G G G Sbjct: 196 GEDEGSRG 203 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG--GGGXGXGG 759 GG G GG GG GG GGG G G GGG G Sbjct: 116 GGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGGIVANG 173 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGX-GGXGXGXGXGGGGGXXXXGXGGG 660 G GGGG G GG G GG G G GGGG GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 901 GGXGGGG--XGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G GGGG G GG G G GGG G G GG G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNG 141 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 G GGG G GG G GG G GGGG G GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSN--GGG 143 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G GG G GG G GGGG G GGGG G G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSN--GGGGDDDGSNGGG 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 G G GG G GG G G G G GG G GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGX-GGXGXGXGXGGGG 690 GG G GGGG G GG G GG G G GGG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG--XGXXGGXGGGXGXXGGG 830 G G GG G GG G G GGGG G GG G G GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDG-----SNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGGG G G G G G GGGG G GGG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGG-DDDGSNGGG 143 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G GGGG GGG G GG G Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDG 138 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G GG G G G GG G G GG G G GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGS---NGGG 143 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G G G GG G GGG GGG G GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 31.9 bits (69), Expect = 0.82 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -3 Query: 758 GXXGGGGX--G-XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GGGG G GG G G GGGG GGG G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGX-GXGGGXXGGGGXGXGGXG 717 G GGG GGG G GGG G GG GG G G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG--GGDDDGSNGGG 143 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G G G G GGG GGG GG G GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GGG G GG G G G G GG G GG Sbjct: 102 GGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 934 GXGXGXGXXXXGGXGGG-GXGXXGGXGGGXGXXGGGXXXXGXXGXG 800 G G G GGG G GG G G GGG G G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G GG G GG G G G GG G G GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGGGGG 688 G G G G GG G GG G G G G G GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG-GDDDGSNGG 142 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 39.5 bits (88), Expect = 0.004 Identities = 35/128 (27%), Positives = 35/128 (27%), Gaps = 12/128 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP---PP---PXXPPPXPXP 777 PP P P P PP P PP P PP P PP P Sbjct: 382 PPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTP 441 Query: 778 --PPPXXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP- 942 PP P P P P P PP P PP P PP Sbjct: 442 SHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVFTPSHTPPV 501 Query: 943 -XPXXPPP 963 P PP Sbjct: 502 FTPSHTPP 509 Score = 39.5 bits (88), Expect = 0.004 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 8/123 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPP--PP 786 P P P P P P P P P PP P PP P PP Sbjct: 396 PSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPP 455 Query: 787 XXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP--XPXX 954 P P P P P PP P PP P PP P Sbjct: 456 VSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVFTPSHTPPVFTPSHTPPVSTPSN 515 Query: 955 PPP 963 PP Sbjct: 516 SPP 518 Score = 39.1 bits (87), Expect = 0.005 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 8/123 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPP-PXPXPPPP 786 P P P P P P P P P PP P PP P PP Sbjct: 423 PSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPP 482 Query: 787 XXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP--XPXX 954 P P P P P PP P PP P PP P Sbjct: 483 VSTPSNTPPVFTPSHTPPVFTPSHTPPVSTPSNSPPVSTPSNTLPVFTPSHTPPVSTPSH 542 Query: 955 PPP 963 PP Sbjct: 543 TPP 545 Score = 37.9 bits (84), Expect = 0.012 Identities = 36/128 (28%), Positives = 36/128 (28%), Gaps = 12/128 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP---PP---PXXPPPXPXP 777 P P P P P P PP P PP P PP P PP P Sbjct: 374 PVSTPSNTPPVSTPSHTP-PVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTP 432 Query: 778 --PPPXXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP- 942 PP P P P P P PP P PP P PP Sbjct: 433 SNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPV 492 Query: 943 -XPXXPPP 963 P PP Sbjct: 493 FTPSHTPP 500 Score = 37.5 bits (83), Expect = 0.017 Identities = 32/127 (25%), Positives = 32/127 (25%), Gaps = 6/127 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPP--PP 786 P P P P P P P P P PP P PP P PP Sbjct: 405 PSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPP 464 Query: 787 XXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P PP P PP P PP Sbjct: 465 VSTPSHTPPVSTPSHTPPVSTPSNTPPVFTPSHTPPVFTPSHTPPVSTPSNSPPVSTPSN 524 Query: 961 PXPXXPP 981 P P Sbjct: 525 TLPVFTP 531 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 39.5 bits (88), Expect = 0.004 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXP--P 816 P P P P P P P P P P P P P P P Sbjct: 1254 PIKPSPSTTPIKPSPSTTSTTPIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPSPSTT 1313 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPP 960 P P P P P P P P P P P P P P Sbjct: 1314 PIKPSPSTTPIKPSPSTTPIKPSPSTTSTTPIKPSPSTTPIKPSPSTTP 1362 Score = 35.9 bits (79), Expect = 0.050 Identities = 23/96 (23%), Positives = 23/96 (23%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P P P P P P P P Sbjct: 1254 PIKPSPSTTPIKPSPSTTSTTPIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPSPSTT 1313 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P Sbjct: 1314 PIKPSPSTTPIKPSPSTTPIKPSPSTTSTTPIKPSP 1349 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXG 705 G GG G G G G G GG G GG G G G G G G G G G G G Sbjct: 18 GGGGDRGRGRGHCLGHGSG---RGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGG G G G G G G GG GG G G G G G G G G Sbjct: 18 GGGGDRGRGRGHC-----LGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 36.7 bits (81), Expect = 0.029 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG G G G G G G GG G G G G G G G G G G G G Sbjct: 18 GGGGDRGRGR--GHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRG---RGRGSGQG 67 Score = 35.5 bits (78), Expect = 0.067 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 GG G G G G G G GG GG G G G G G G G G G G Sbjct: 20 GGDRGRGRGHCLGHGSGRGGRGGRGG-----SGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GGG G G G G G GG G G G G G G G G G G Sbjct: 19 GGGDRGRGRGHCLGHG--SGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQG 67 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGG G G G G G G G G GG G G G G G G G G Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRG-GRGGSGRGRGRGRGSGRG-RGRGSGQG 67 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -2 Query: 825 GGXGXXGXX-GXXXGXGGXXXGGGXXGGGGXGXX-GXGXGXXXGGGGG 688 GG G G G G G G G GG G G G G G G G G Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSG 65 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGG 810 GGG G G G G G G GG GG G G G G G G Sbjct: 18 GGGGDRGRGR-GHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRG 61 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 937 GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GG G G G G G G G G G G G G G G G Sbjct: 19 GGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGGXXGG 615 GG G G G G G G G G GG G G G G G Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRG 61 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 10/71 (14%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXX--PPPXPXPPPPXX---PPXXXXPPPXXXXPPXPPPXPPPX-- 864 P PP PPP PPP PPP PP PPP PP PP Sbjct: 280 PGDIQQPPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDI 339 Query: 865 -PPP--XPXPP 888 PPP PP Sbjct: 340 QPPPVDIQQPP 350 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPP---XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP PPP PP PPP PP PP P P PP PPP Sbjct: 286 PPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQP--PPVDIQQPPVDIQPPP 343 Query: 964 XPXXPP 981 P Sbjct: 344 VDIQQP 349 Score = 36.3 bits (80), Expect = 0.038 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX---PPXXXXPP 816 P PPP PPP P PP PPP PPP PP PP Sbjct: 287 PVDIQPPPVDIQ----PPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPP 342 Query: 817 PXXXXPP 837 P P Sbjct: 343 PVDIQQP 349 Score = 35.9 bits (79), Expect = 0.050 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP---XXPPXXXXPPPXXXXPPXP 843 P PPP P P P PP PP PPP PP PP PP Sbjct: 286 PPVDIQPPPVDIQPPPVDIQP-PPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPV 344 Query: 844 PPXPPP 861 PP Sbjct: 345 DIQQPP 350 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPP---XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P PP PP PPP PPP P P P PPP PP Sbjct: 280 PGDIQQPPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQP--PPVDIQPPPVDIQQPPV 337 Query: 967 PXXPP 981 PP Sbjct: 338 DIQPP 342 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 8/59 (13%) Frame = +1 Query: 667 PXPXXXXPPP---PPXPXPXPXPPXPXPPPPXX--PPPXPXPPPPXX---PPXXXXPPP 819 P P PPP P P PP PPP PPP PP PP PP Sbjct: 292 PPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQQPP 350 Score = 33.1 bits (72), Expect = 0.36 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 4/73 (5%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXX-XXPPPXXXXPPXPPPXPPP---XPPPXPXPPPXXXXXPXXPXP 924 P PP PP PPP PP PP PPP PP P Sbjct: 280 PGDIQQPPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDI--QQPPV 337 Query: 925 PXXPPPXPXXPPP 963 PPP PP Sbjct: 338 DIQPPPVDIQQPP 350 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP-PXXPXXPPPXPXPPPP 983 P PPP PPP P PP P P P PPP PP Sbjct: 294 PVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQQPP 350 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P PPP P PPP P P PP PPP PP Sbjct: 299 PPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPV-DIQQPPVDIQPPPVDIQQPP 350 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G G GGG G GG G GG G G GGG G GG Sbjct: 224 GAGHGRTAGVGAGSDSGVGSGGGYGGVGG--GSGGIAYGSVFKPVDLGSGGGGSWGGAGG 281 Query: 662 G 660 G Sbjct: 282 G 282 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G G G GGG GG GG G G GG G GG GG Sbjct: 228 GRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGG 282 Score = 37.5 bits (83), Expect = 0.017 Identities = 34/105 (32%), Positives = 34/105 (32%), Gaps = 11/105 (10%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG----------GXGGXXXX 819 G GGG G GGG GG G G GG GG GG G Sbjct: 242 GSGGGYGGVGGGS-GGIAYGSVFKPVDLGSGGGGSWGGAGGGCLRWIISKIIHHDGLISA 300 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGG 687 G GG GG G G GG G G GG GG Sbjct: 301 KGQDSLTGGGSGGSILIETMNMTGHGEVNVNGGSVTGSGGGGAGG 345 Score = 36.7 bits (81), Expect = 0.029 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G G G G G G GGG GG GG G G G Sbjct: 218 GLVKLDGAGHGRTAGVGAGSDSGVGS----GGGY---GGVGGGSGGIAYGSVFKPVDLGS 270 Query: 728 GGXGXGXGXGGG 693 GG G G GGG Sbjct: 271 GGGGSWGGAGGG 282 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG---XGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G GGG G G G G G GG GG Sbjct: 224 GAGHGRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGG 282 Score = 32.3 bits (70), Expect = 0.62 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G G G GGG G GG G G G GGG G G Sbjct: 228 GRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAG 280 Score = 30.7 bits (66), Expect = 1.9 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G G G G G GG G GGG GG G G G GG GG G Sbjct: 224 GAGHGRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSG---GGGSWGGAG 280 Query: 773 XG 768 G Sbjct: 281 GG 282 Score = 30.7 bits (66), Expect = 1.9 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 16/121 (13%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXG------------XGGGXGGGXGGGXGG--XXX 822 G G G G G G G GGG G G G GG GG GG Sbjct: 228 GRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGGCLRWI 287 Query: 821 XGGGXXXXGGXXGGGGXGXGGGXXGGG--GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXX 648 G G GG GG G G GG G GG G Sbjct: 288 ISKIIHHDGLISAKGQDSLTGGGSGGSILIETMNMTGHGEVNVNGGSVTGSGGGGAGGRI 347 Query: 647 G 645 G Sbjct: 348 G 348 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGG G GGG GG G G GG G GG GGG Sbjct: 244 GGGYGGVGGG----SGGIAYG-SVFKPVDLGSGGGGSWGGAGGG 282 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 G GGG G G G G G G GG G G GG Sbjct: 678 GSGGGYGAGGAWLKIKTGSHVIVDGIIRCNGVGSGGSSGSSYGGGSGG 725 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG--XXGGGGXGXGGGXXGG 744 G G GG G GGG GG G GG GGG GG Sbjct: 708 GVGSGGSSGSSYGGGSGGAVVIETLYLKGYGLIEASGGPSNTGGGGSGG 756 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 981 GGXGGXXGGXGXGGXGXXGXGGGXGXXXGXGGG 883 G G G G G G GGG G G GG Sbjct: 224 GAGHGRTAGVGAGSDSGVGSGGGYGGVGGGSGG 256 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGX-GXGXXXX----GGXGGGGXGXXGG 863 G G G GGG G GG G G G GGG G GG Sbjct: 236 GSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGG 281 >SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) Length = 311 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PP P P P P PP P P P P P P P P P P P Sbjct: 153 PGPPGARGEPGQQAPMMIQVSRPGPNKGPPGPGPGPGPGPAPGPGPIVQPVVPVQPVIPG 212 Query: 940 P 942 P Sbjct: 213 P 213 Score = 33.1 bits (72), Expect = 0.36 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 3/96 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX--PPP 819 P P P P P P PP PP P P P P Sbjct: 120 PGSPGPQGFNGARGPNGPKGDSGRPGQDGRQGPP--GPPGARGEPGQQAPMMIQVSRPGP 177 Query: 820 XXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P P P P P P P P P P Sbjct: 178 NKGPPGPGPGPGPGPAPGPGPIVQPVVPVQPVIPGP 213 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 5/62 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP----PPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPP 780 PP P P P P PP P P P P P P P P P P P Sbjct: 152 PPGPPGARGEPGQQAPMMIQVSRPGPNKGPPGPGPGPGPGPAPGPGPIVQPVVPVQPVIP 211 Query: 781 PP 786 P Sbjct: 212 GP 213 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 39.1 bits (87), Expect = 0.005 Identities = 33/116 (28%), Positives = 33/116 (28%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG G G GGG G G G G Sbjct: 414 GVTGSGGGATAMRGDVTGSE--RNVRKIEGGGTGIEDVTGSEEDIAESGGSVIGNKHDVT 471 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GG G G G G G G G G GG GG G G G G Sbjct: 472 GSGDLGGVGGATGSIGNKEGIGDIATGNGVGVTGSGGVATESGGGAIG-NGDGATG 526 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXX-GGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG GGG GG G G G G G G GG G G GG Sbjct: 350 GGATTSGGGVTESRGGAKENGDSATGNGDGVTGNGDGVTGSGGGATRNGDGFTGREGGAT 409 Query: 806 XXXGGXXGGGG 774 G G GG Sbjct: 410 RNADGVTGSGG 420 Score = 33.9 bits (74), Expect = 0.20 Identities = 39/138 (28%), Positives = 39/138 (28%), Gaps = 18/138 (13%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXX-----GXXXXXGGGXGXGGGXGGGX-------GGGXG 834 G G GGG G G G G G GG G G GGG G Sbjct: 386 GVTGSGGGATRNGDGFTGREGGATRNADGVTGSGGGATAMRGDVTGSERNVRKIEGGGTG 445 Query: 833 GXXXXGGGXXXX---GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG---GGGXXXXG 672 G G G G G GG G G G G G G G G Sbjct: 446 IEDVTGSEEDIAESGGSVIGNKHDVTGSGDLGGVGGATGSIGNKEGIGDIATGNGVGVTG 505 Query: 671 XGGGXGXXGXGXXGGXXG 618 GG G G G G Sbjct: 506 SGGVATESGGGAIGNGDG 523 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GGG GG G G G G G G GGG G G Sbjct: 347 GSEGGATTSGGGVTESRGGAKENGDSATGNGDGVTGNGDGVTG---SGGGATRNGDGFTG 403 Query: 707 GXGGG--GGXXXXGXGGG 660 GG G GGG Sbjct: 404 REGGATRNADGVTGSGGG 421 Score = 30.7 bits (66), Expect = 1.9 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 2/102 (1%) Frame = -3 Query: 917 GXXGXXXXXGGGX--GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GGG GG G G G G G GGG G G G Sbjct: 347 GSEGGATTSGGGVTESRGGAKENGDSATGNGDGVTGNGDGVTGS--GGGATRNGDGFTGR 404 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G GGG G G GG G Sbjct: 405 EG-GATRNADGVTGSGGGATAMRGDVTGSERNVRKIEGGGTG 445 Score = 30.7 bits (66), Expect = 1.9 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 4/97 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXX--GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 G GG GGG G G G G G G G G G G G Sbjct: 347 GSEGGATTSGGGVTESRGGAKENGDSATGNGDGVTGNGDGVTGSGGGATRNGDGFTGREG 406 Query: 794 G--XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G G GGG G G GGG Sbjct: 407 GATRNADGVTGSGGGATAMRGDVTGSERNVRKIEGGG 443 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 2/72 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGG-XXXXGX 812 GGG GG G G G G G G G G G G GG G Sbjct: 356 GGGVTESRGGAKENGDSATGNGDGVTGNGDGVTGSGGGATRNGDGFTGREGGATRNADGV 415 Query: 811 XGXGGXGXGXGG 776 G GG G Sbjct: 416 TGSGGGATAMRG 427 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP-PPXPPPXPPPXPXPPPX 894 P P P P PP P P PP P PP P P PP P P P P Sbjct: 177 PSPEYPHPYPPLR-PEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYP-PRRP 234 Query: 895 XXXXPXXPXPP 927 P P PP Sbjct: 235 EYAHPFLPLPP 245 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 10/72 (13%) Frame = +1 Query: 631 PXXPXPXXPXP-PP-XPXXXXPPPPPXP-----XPXPXPPXPXPPPPXXPP-PXPXPP-- 780 P P P P P PP P P PP P P P P P PP P P PP Sbjct: 174 PGQPSPEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRR 233 Query: 781 PPXXPPXXXXPP 816 P P PP Sbjct: 234 PEYAHPFLPLPP 245 Score = 33.1 bits (72), Expect = 0.36 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P PP P PP P P P PP PP P P Sbjct: 182 PHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRPEYAHPFL 241 Query: 793 P 795 P Sbjct: 242 P 242 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P PP P PP P PP P P P P P P Sbjct: 174 PGQPSPEYPHPYPPLRPEYAHPYPPRR---PEYAHLYPPRRPEYPHPYPPRRPEYAHPYP 230 Query: 925 PXXPP-PXPXXPPP 963 P P P P P Sbjct: 231 PRRPEYAHPFLPLP 244 Score = 32.3 bits (70), Expect = 0.62 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P PP P PP P P P PP P Sbjct: 174 PGQPSPEYPHPYPPLR--PEYAHPYPPRRPEYAHLYPPRRPEY-----PHPYPPRRPEYA 226 Query: 957 PPXPXPPP 980 P P P Sbjct: 227 HPYPPRRP 234 Score = 32.3 bits (70), Expect = 0.62 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P PP P PP P P P PP P Sbjct: 179 PEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRPEYAH 238 Query: 868 PPXPXPPPXXXXXP 909 P P PP P Sbjct: 239 PFLPLPPEYAHLIP 252 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P PP P P P P PP P P P Sbjct: 174 PGQPSPEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHP 217 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP 744 PP P P PP P P PP P P P PP Sbjct: 208 PPRRPEYPHPYPPRRPEYAHPYPPRRP-EYAHPFLPLPP 245 >SB_22690| Best HMM Match : Collagen (HMM E-Value=0.042) Length = 593 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/111 (25%), Positives = 28/111 (25%), Gaps = 1/111 (0%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G G G G G GG G GG G Sbjct: 9 GGVDGSDGSNGNGGDDDVDDADDGVDGSDGSNGNGGDDDGDDGDGGNCDDDDSGDDGSDG 68 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G GG G G G G G Sbjct: 69 NAGNGSDGDDDDSGDDGSDGNAGNGSDNDGSDGNGGEDGSDGAGDNDGDDG 119 Score = 37.1 bits (82), Expect = 0.022 Identities = 28/120 (23%), Positives = 28/120 (23%), Gaps = 2/120 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G G GG G G G G G Sbjct: 10 GVDGSDGSNGNGGDDDVDDADDGVDGSDGSNGNGGDDDGDDGDGGNCDDDDSGDDGSDGN 69 Query: 788 XGGGGXG--XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G GG G G G G GG Sbjct: 70 AGNGSDGDDDDSGDDGSDGNAGNGSDNDGSDGNGGEDGSDGAGDNDGDDGSDGEADDGGG 129 Score = 35.9 bits (79), Expect = 0.050 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G G G G G G G G Sbjct: 48 GDDGDGGNCDDDDSGDDGSDGNAG-----NGSDGDDDDSGDDGSDGNAGNGSDNDGSDGN 102 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GG G G G G G G G G Sbjct: 103 GGEDGSDGAGDNDGDDGSDGEADDGGG 129 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P PPP P PPPP P P PPP P P Sbjct: 112 PSGMATPGTFIPPPPPGVFTPPPPYRTTAKPKGPTKKPPPMMSLTPTPKKKHYDTSALEE 171 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P PPP Sbjct: 172 LLGTPPTAKPTKAPNKKPV-PKKPAPPP 198 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P P P P P P PPP PP P PPP Sbjct: 94 PATPATPATPAHNMGVAGPSGMATPGTFIPPPPPGVFTPPPPYRTTAKPKGPTKKPPPMM 153 Query: 826 XXPPXP 843 P P Sbjct: 154 SLTPTP 159 Score = 30.7 bits (66), Expect = 1.9 Identities = 24/95 (25%), Positives = 24/95 (25%), Gaps = 5/95 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPP----XPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P PPPPP P P P P PP P P Sbjct: 100 PATPAHNMGVAGPSGMATPGTFIPPPPPGVFTPPPPYRTTAKPKGPTKKPPPMMSLTPTP 159 Query: 787 XXPPXXXXP-PPXXXXPPXPPPXPPPXPPPXPXPP 888 PP P P P P P Sbjct: 160 KKKHYDTSALEELLGTPPTAKPTKAPNKKPVPKKP 194 >SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GG GGG G G GG G G GGGG G G G Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGGGNDND 135 Query: 698 GG 693 GG Sbjct: 136 GG 137 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 967 GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGX 788 G GG G G G GGG G G G GGG G G G Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGGGNDND 135 Query: 787 G 785 G Sbjct: 136 G 136 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-----GGGXGXXGGXGGGXGXXGGGXXXX 818 G GG G GG G GG G G G GG GG G GGG Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGGGNDND 135 Query: 817 G 815 G Sbjct: 136 G 136 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GGG G G GGG G G G G G GG Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGG 130 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 947 GXGGGXXGGXGXXG-XXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G GG GG G GGG G G G GGG G GGG Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGG--GSDGDDGGGND 133 Query: 770 GXGG 759 GG Sbjct: 134 NDGG 137 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG-XGXXGXG 639 GG GGG G G G G G G G GGG G G G Sbjct: 78 GGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGGG 131 Score = 28.7 bits (61), Expect = 7.6 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 4/63 (6%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX----GGGXGGGXGGGXGGXXXXGGGXXX 801 G GG G G G GGG G G G GGG G GGG Sbjct: 76 GDGGCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDD-DGGGGGSDGDDGGGNDN 134 Query: 800 XGG 792 GG Sbjct: 135 DGG 137 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G G GGG G G GGGG GGG G Sbjct: 79 GCGGGGCGSSSDGDNDDSNDVDDGGGDGDDDNDGDGVDDDGGGGGSDGDDGGGNDNDG 136 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 39.1 bits (87), Expect = 0.005 Identities = 36/120 (30%), Positives = 36/120 (30%), Gaps = 9/120 (7%) Frame = +1 Query: 628 PPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPP----PPXXPPPXPXPPPPXX 792 PP P PP P PP P PP PP P PP PP Sbjct: 295 PPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHTPPFNGQPPYNT 354 Query: 793 PPXXXXP----PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP PP P P P PP P PP P PP Sbjct: 355 PPFNGQPLYHTPPFNGQPPYNTP-PFNGQPSYNTPP--FNGQPPYNTPPFNGQPLSHTPP 411 Score = 38.3 bits (85), Expect = 0.009 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 13/122 (10%) Frame = +1 Query: 631 PXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPXPPXPXPP----PPXXPPPXPXPPPPXX 792 P P PP P PP P PP PP PP PP P Sbjct: 284 PPYNNPLFTGQPPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHT 343 Query: 793 PPXXXXPP---PXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPX 951 PP PP P P P PP PP P P PP PP Sbjct: 344 PPFNGQPPYNTPPFNGQPLYHTPPFNGQPPYNTPPFNGQPSYNTPPFNGQPPYNTPPFNG 403 Query: 952 XP 957 P Sbjct: 404 QP 405 Score = 35.5 bits (78), Expect = 0.067 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 9/121 (7%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP-XXPPPXPXPPPPXXPPXXXXPPPX 822 P PP PP P P PP PP PP PP PP Sbjct: 278 PSFSGQPPYNNPLFTGQPPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPP--YYTPPF 335 Query: 823 XXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPXXP----PPXPXXP 978 P P P PP PP P P PP PP P PP P Sbjct: 336 NGQPLYHTP-PFNGQPPYNTPPFNGQPLYHTPPFNGQPPYNTPPFNGQPSYNTPPFNGQP 394 Query: 979 P 981 P Sbjct: 395 P 395 Score = 33.9 bits (74), Expect = 0.20 Identities = 32/113 (28%), Positives = 32/113 (28%), Gaps = 8/113 (7%) Frame = +1 Query: 628 PPXXPXPXXPXPP--PXPXXXXPP---PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP P PP P PP PP P P PP PP P Sbjct: 306 PPYNAPPFNGQPPYNTPPFNGQPPYYTPPFNGQPLYHTPPFNGQPPYNTPPFNGQPLYHT 365 Query: 793 PPXXXXPPPXXXXPP---XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP PP PP P PP P P P PP P Sbjct: 366 PPFNGQPP--YNTPPFNGQPSYNTPPFNGQPPYNTPPFNGQPLSHTPPFSGQP 416 Score = 33.1 bits (72), Expect = 0.36 Identities = 31/114 (27%), Positives = 31/114 (27%), Gaps = 3/114 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP PP PP P P PP PP PP P Sbjct: 284 PPYNNPLFTGQPPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPPY-YTPPFNGQPLYH 342 Query: 808 XPPPXXXXPPXPPP---XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP P PP PP P P PP PP Sbjct: 343 TPPFNGQPPYNTPPFNGQPLYHTPPFNGQPP-YNTPPFNGQPSYNTPPFNGQPP 395 Score = 30.7 bits (66), Expect = 1.9 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 4/96 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P PP PP P P P PP PP P Sbjct: 318 PYNTPPFNGQPPYYTPPFNGQPLYHTPPFNGQPPYNTPPFNGQPLYHTPPFNGQPPYNTP 377 Query: 796 PXXXXP----PPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PP PP P PP Sbjct: 378 PFNGQPSYNTPPFNGQPPY--NTPPFNGQPLSHTPP 411 >SB_59310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 2/110 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG-GXGX 765 GG G G GGG GG GG G G GG GGG G Sbjct: 297 GGCDDGDCVDDGDGCEIGGGDNGGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGTEDGD 356 Query: 764 GGGXXGGG-GXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G GG G G G G G G G G Sbjct: 357 CVGYDGNGCEIGGGGNEDGDCVDDDGNVCESGGGNDSGGNEDGDCVGYDG 406 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 G GG G G GG GGG GGG G G G G GG Sbjct: 293 GDNGGGCDDGDCVDDGDGCEIGGGDNGGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGT 352 Query: 680 XXGXGGGXGXXGXGXXGG 627 G G G GG Sbjct: 353 EDGDCVGYDGNGCEIGGG 370 Score = 36.3 bits (80), Expect = 0.038 Identities = 29/101 (28%), Positives = 29/101 (28%), Gaps = 2/101 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G G GG G G GG GG G G GG Sbjct: 314 GGGDNGGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGTEDGDCVGYDGNGCEIGGGGNE 373 Query: 782 GGG--XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 G G GGG GG G G G G G Sbjct: 374 DGDCVDDDGNVCESGGGNDSGGNEDGDCVGYDGNGCEIGGG 414 Score = 35.1 bits (77), Expect = 0.088 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G G GG GG G G G G GG GG G Sbjct: 296 GGGCDDGDCVDDGDGCEIGGGDNGGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGTEDG 355 Query: 710 XGXGGGGGXXXXGXGG 663 G G G GG Sbjct: 356 DCVGYDGNGCEIGGGG 371 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G G GGG GGG GG G G G G G Sbjct: 296 GGGCDDGDCVDDGDGCEIGGGDNGGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGTEDG 355 Query: 638 XXGGXXG 618 G G Sbjct: 356 DCVGYDG 362 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG--XGXXGGXGGGXGXXGGGXXXXG 815 GGG GGG G G GG GGG G G G GGG G Sbjct: 319 GGGCHDGGGNEDGDCVDDDGNGFEIDGGNNGGGTEDGDCVGYDGNGCEIGGGGNEDG 375 >SB_10235| Best HMM Match : Coiled (HMM E-Value=6) Length = 158 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG-GGXGXXGX 642 GG G GG G GGG GG G G G G G G G G GG G Sbjct: 93 GGSVDVDGDDDGGDNDGCGGG-DDDGGRGGGDDDDGDADGDGDGDDDDGDGDGGDDDDGD 151 Query: 641 GXXGG 627 G G Sbjct: 152 GDGDG 156 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 38.7 bits (86), Expect = 0.007 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 1/119 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXX 804 GG G G G G GG G G GG G G G Sbjct: 520 GGTTGSSTTSSGESGTTSTGGNTGSGTTSSGGNTGSGTTSSGGNTGSGTTTGGVNTGSGT 579 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G GG G G G G G GG G G G G G Sbjct: 580 TTGGLNTGSGT-TTGGVNSGSGTTTSGVNTGSGTTTGGVNTGSGTTTGEVNTGSGTTTG 637 Score = 37.9 bits (84), Expect = 0.012 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 1/119 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXX 804 GG G G G G GG G G GG G G G Sbjct: 509 GGATGNGTSSNGGTTGSSTTSSGESGTTSTGGNTGSGTTSSGGNTGSGTTSSGGNTGSGT 568 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G GG G G GG G G G G G G G G Sbjct: 569 TTGGVNTGSGT-TTGGLNTGSGTTTGGVNSGSGTTTSGVNTGSGTTTGGVNTGSGTTTG 626 Score = 36.7 bits (81), Expect = 0.029 Identities = 31/111 (27%), Positives = 31/111 (27%), Gaps = 4/111 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G G G GG G GG G GG Sbjct: 505 GSAEGGATGNGTSSNGGTTGSSTTSSGESGTTSTGGNTGSGTTSSGGNTGSGTTSSGGNT 564 Query: 770 GXG---GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GG G G GG G G GG G G G G Sbjct: 565 GSGTTTGGVNTGSGTTTGGLNTGSGTTTGGVNSGSGTTTSGVNTGSGTTTG 615 Score = 33.9 bits (74), Expect = 0.20 Identities = 30/121 (24%), Positives = 30/121 (24%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G GG G G GG G GG Sbjct: 531 GESGTTSTGGNTGSGTTSSGGNTGSGTTSSGG---NTGSGTTTGGVNTGSGTTTGGLNTG 587 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G G G G G G G G G G Sbjct: 588 SGTTTGGVNSGSGTTTSGVNTGSGTTTGGVNTGSGTTTGEVNTGSGTTTGGMNTGSGTTT 647 Query: 617 G 615 G Sbjct: 648 G 648 Score = 31.5 bits (68), Expect = 1.1 Identities = 35/119 (29%), Positives = 35/119 (29%), Gaps = 8/119 (6%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXG---GGXGGGXGGGXGGXXXXGGGXXXXGGX 789 GG G G GG G GG G G GG G G GG G G G Sbjct: 539 GGNTGSGTTSSGGNTGSGTTSS-GGNTGSGTTTGGVNTGSGTTTGGLNT-GSGTTTGGVN 596 Query: 788 XGGG----GXGXGGGXX-GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G GG G G G G G G G G Sbjct: 597 SGSGTTTSGVNTGSGTTTGGVNTGSGTTTGEVNTGSGTTTGGMNTGSGTTTGGVNTGSG 655 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GG G GG G GG G GG GG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAG 324 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 928 GXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G G GG GG G GG GG G GG G Sbjct: 293 GITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGGEVELG 330 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G GG GG G GG GG G GG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GG GG G GG G G GGG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGG 322 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GG GG GG G GG G G GG GG G Sbjct: 292 GGITAGGTAE--GGNAGGNGGNAGGNG-GMTGGGAGGEVELG 330 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG GG G GG G GG GG GG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG GG GG GG GG GG GG GG Sbjct: 292 GGITAGGTAEGGNAGGNGG--NAGGNGGMTGGGAGG 325 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G GG GG GG G GGG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GG G G G GG G G GG Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 28.7 bits (61), Expect = 7.6 Identities = 22/80 (27%), Positives = 22/80 (27%), Gaps = 1/80 (1%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXG 783 GG G GG G G G GG G G G GG Sbjct: 582 GGLNTGSGTTTGGVNSGSGTTTSGVNTGSGTTTGGVNTGSGTTTGEVNTGSGTTTGGMNT 641 Query: 782 GGGXGXGGGXXGGGGXGXGG 723 G G GG G G G Sbjct: 642 GSGTTTGGVNTGSGTTSESG 661 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P PP P PP P P PP P Sbjct: 1353 PIPSTPRPRPPTP-PRPPTPRPRPPTPRPGPPTPRP 1387 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP 762 P P P PP P P P PP P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P P P P P P P P PP P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 35.5 bits (78), Expect = 0.067 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP PPP PP P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETP 1601 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 867 PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP P P P PP P PP P P Sbjct: 1355 PSTPRPRPPTPPRP--PTPRPRPP-TPRPGPPTPRP 1387 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP 890 P P P P P PP P PP P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP 741 P P P P PP P P P P P P PP P P Sbjct: 1355 PSTPRPRPPTPPRPP----TPRPRPPTPRPGPPTPRP 1387 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P P P P P PPP PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PPP P P PPP PP P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P PP P PP P P P P P PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRP---RPPTPRPGPP 1383 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P P P P P P P P P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P PP PP PP P P PP P Sbjct: 1353 PIPSTPRPR-PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 P P P PP P P P P P P P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 887 PPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 P P P PP P P P P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P P P P P PP P PP PP P P Sbjct: 1353 PIPSTPRPRP-PTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 890 PXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 P P PP P P P P PP P PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPP 902 PPP P PP PP PP P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETP 1601 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P PP P P PP P P P P PP P PP P Sbjct: 1649 PVTPPTTDP-PRPPVTVTPKPSTDAPLPASTSRPQPPVPTKLPVVLTIPPRP 1699 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPP 765 PPPP P PP PP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P PP P P PP P P PP P P P Sbjct: 1575 PITPPPPT---PSPPQTPPPVNTPPRPETPEP 1603 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 640 PXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P P P P PP P PP P P P P P P P Sbjct: 1353 PIPSTPRPRPPTPPR---PPTPRPRPPTPRPGPPTPRP 1387 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P P P PP P PP PP P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPT---PRPGPPTPRP 1387 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PP P P PP P P P P Sbjct: 1362 PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 719 PXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P P P P PP P P P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P PP PP P P P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPR-PPTPRPGPPTPRP 1387 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P PP P Sbjct: 1353 PIPSTPRP---RPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P P PP P P P P PP Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP-PPXPXXXXPPPPP 702 P PP P P P P PP P P P P Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXP 958 PPP P PPP P P P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXP-PXXPPP 942 P P P PP P PP P P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXP-PXXPPPXP 948 P P P PP P PP P P P P P P P Sbjct: 1355 PSTPRPRPPTPPRPP---TPRPRPPTPRPGPPTPRP 1387 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P P P P P PP PP P P P Sbjct: 1575 PITPPPPTPSP-----PQTP-PPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXP 854 PP P P PP P P P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXP 885 PPP P PPP P P P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRPETPEP 1603 >SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5) Length = 634 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGX 702 G G G GG GG G G G G G G G G G G G G G G Sbjct: 571 GVGSGNDSCCNGGDGGCDGDGFGDDNGDGFGDGDGDGCDDGDGEGEGCDNGEGDGDGDGD 630 Query: 701 GGG 693 G G Sbjct: 631 GDG 633 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,759,051 Number of Sequences: 59808 Number of extensions: 1138975 Number of successful extensions: 63314 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17403 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2919714245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -