BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M20 (985 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81053-1|CAB02877.1| 385|Caenorhabditis elegans Hypothetical pr... 118 5e-27 AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical ... 115 5e-26 Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical pr... 115 6e-26 Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical pr... 115 6e-26 U58755-7|AAB00696.1| 136|Caenorhabditis elegans Hypothetical pr... 99 4e-21 AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical... 97 2e-20 U80023-1|AAG24037.1| 180|Caenorhabditis elegans Hypothetical pr... 94 1e-19 U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hed... 93 4e-19 Z54238-1|CAA90992.2| 281|Caenorhabditis elegans Hypothetical pr... 90 2e-18 Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical pr... 90 3e-18 Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 90 3e-18 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 90 3e-18 L25598-3|AAM15551.1| 759|Caenorhabditis elegans Calpain family ... 89 6e-18 AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(... 83 3e-16 AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(... 83 3e-16 AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q... 83 3e-16 AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical... 81 9e-16 U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 81 1e-15 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 81 1e-15 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 81 1e-15 L25598-4|AAV58888.1| 737|Caenorhabditis elegans Calpain family ... 81 2e-15 U62772-1|AAB04136.1| 763|Caenorhabditis elegans RNA helicase pr... 80 2e-15 L19948-1|AAC27384.1| 763|Caenorhabditis elegans RNA helicase pr... 79 4e-15 AF000197-1|AAB52901.2| 763|Caenorhabditis elegans Germ-line hel... 79 4e-15 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 78 8e-15 D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like prot... 78 8e-15 AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a... 78 8e-15 AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a... 78 8e-15 AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a... 76 3e-14 AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a... 76 3e-14 U60449-1|AAB03510.1| 974|Caenorhabditis elegans GLH-2 protein. 75 6e-14 U60194-1|AAB03337.1| 974|Caenorhabditis elegans RNA helicase GL... 75 6e-14 AC006625-11|AAK68269.1| 974|Caenorhabditis elegans Germ-line he... 75 6e-14 Z78413-7|CAB01657.1| 352|Caenorhabditis elegans Hypothetical pr... 75 1e-13 U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical pr... 74 2e-13 U14635-1|AAC46657.2| 448|Caenorhabditis elegans Hypothetical pr... 73 2e-13 Z68008-4|CAA92000.4| 1137|Caenorhabditis elegans Hypothetical pr... 73 3e-13 U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 72 7e-13 AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical... 72 7e-13 Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical pr... 71 1e-12 U61288-1|AAB17543.1| 790|Caenorhabditis elegans CE protein. 71 2e-12 Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical pr... 70 2e-12 AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen prot... 69 7e-12 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 68 1e-11 AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical... 68 1e-11 AF043700-5|AAB97575.2| 573|Caenorhabditis elegans Lipid deplete... 67 2e-11 Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 67 2e-11 Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical pr... 66 5e-11 AF045646-2|AAK29827.1| 371|Caenorhabditis elegans Collagen prot... 66 5e-11 AC024790-13|AAL32247.1| 311|Caenorhabditis elegans Hypothetical... 65 6e-11 Z68750-1|CAA92963.1| 284|Caenorhabditis elegans Hypothetical pr... 65 8e-11 U67967-1|AAC47829.1| 413|Caenorhabditis elegans PTL-1B protein ... 64 1e-10 U67966-1|AAB97090.1| 453|Caenorhabditis elegans PTL-1A protein ... 64 1e-10 U38983-1|AAA80687.1| 436|Caenorhabditis elegans TAU-1b protein. 64 1e-10 U38982-1|AAA80686.1| 431|Caenorhabditis elegans TAU-1a protein. 64 1e-10 U00051-4|AAK70645.1| 453|Caenorhabditis elegans Protein with ta... 64 1e-10 U00051-3|AAK70647.1| 413|Caenorhabditis elegans Protein with ta... 64 1e-10 U00051-2|AAK70646.1| 458|Caenorhabditis elegans Protein with ta... 64 1e-10 AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ... 64 2e-10 Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical pr... 63 3e-10 Z81525-8|CAB04257.1| 208|Caenorhabditis elegans Hypothetical pr... 62 8e-10 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 62 8e-10 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 61 1e-09 L25598-2|AAV58887.1| 780|Caenorhabditis elegans Calpain family ... 61 1e-09 Z81094-7|CAB03153.2| 960|Caenorhabditis elegans Hypothetical pr... 60 2e-09 U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 60 2e-09 AF039052-9|AAF98625.1| 302|Caenorhabditis elegans Hypothetical ... 60 2e-09 Z68106-4|CAA92128.1| 112|Caenorhabditis elegans Hypothetical pr... 60 3e-09 AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical ... 59 4e-09 AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical ... 59 4e-09 Z66500-14|CAA91313.2| 1169|Caenorhabditis elegans Hypothetical p... 59 5e-09 Z49968-13|CAA90265.2| 1169|Caenorhabditis elegans Hypothetical p... 59 5e-09 AF125462-1|AAD12858.2| 244|Caenorhabditis elegans Hypothetical ... 59 5e-09 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 59 5e-09 U53333-2|AAA96155.1| 299|Caenorhabditis elegans Collagen protei... 58 7e-09 AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical ... 58 7e-09 AF410845-1|AAL76233.1| 299|Caenorhabditis elegans cuticular col... 58 7e-09 U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific ... 58 1e-08 AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily a... 58 1e-08 AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily a... 58 1e-08 AL137227-1|CAB70238.2| 611|Caenorhabditis elegans Hypothetical ... 57 2e-08 U97196-12|AAB52456.2| 564|Caenorhabditis elegans Hypothetical p... 56 3e-08 Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical pr... 56 4e-08 U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical pr... 56 4e-08 U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cyt... 56 4e-08 U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cyt... 56 4e-08 Z95559-1|CAB08999.1| 289|Caenorhabditis elegans Hypothetical pr... 56 5e-08 Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical pr... 56 5e-08 Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical pr... 56 5e-08 Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical pr... 56 5e-08 Z70284-9|CAA94280.1| 290|Caenorhabditis elegans Hypothetical pr... 56 5e-08 Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical pr... 56 5e-08 U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific... 56 5e-08 Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical pr... 55 7e-08 V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caeno... 55 7e-08 U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequen... 55 7e-08 J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.ele... 55 7e-08 AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical... 55 7e-08 Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical pr... 55 9e-08 Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr... 55 9e-08 Z68314-1|CAA92658.1| 102|Caenorhabditis elegans Hypothetical pr... 54 1e-07 Z46343-8|CAA86461.1| 549|Caenorhabditis elegans Hypothetical pr... 54 1e-07 Z35598-9|CAA84658.1| 549|Caenorhabditis elegans Hypothetical pr... 54 1e-07 Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical p... 54 2e-07 M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen ... 54 2e-07 AL132898-19|CAN99707.1| 258|Caenorhabditis elegans Hypothetical... 54 2e-07 AF326941-1|AAG49391.1| 139|Caenorhabditis elegans 5H1 protein. 54 2e-07 AF125955-7|AAD14713.1| 139|Caenorhabditis elegans Hypothetical ... 54 2e-07 AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical ... 54 2e-07 AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical ... 54 2e-07 Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical pr... 53 3e-07 AC024859-14|AAY43989.1| 643|Caenorhabditis elegans Hypothetical... 53 3e-07 AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical ... 53 3e-07 Z72514-1|CAA96674.1| 428|Caenorhabditis elegans Hypothetical pr... 53 4e-07 AF047659-10|AAC04430.1| 798|Caenorhabditis elegans Hypothetical... 53 4e-07 Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 52 5e-07 Z77665-7|CAI46591.1| 360|Caenorhabditis elegans Hypothetical pr... 52 5e-07 Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical pr... 52 5e-07 Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical pr... 52 5e-07 Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical pr... 52 5e-07 Z66565-6|CAA91483.1| 165|Caenorhabditis elegans Hypothetical pr... 52 5e-07 U52003-5|AAG00057.1| 730|Caenorhabditis elegans P granule abnor... 52 5e-07 U52003-4|ABB51171.1| 771|Caenorhabditis elegans P granule abnor... 52 5e-07 AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical ... 52 5e-07 AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical... 52 5e-07 AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical ... 52 5e-07 AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical ... 52 5e-07 AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical ... 52 5e-07 AF077868-1|AAC36100.1| 730|Caenorhabditis elegans PGL-1 protein. 52 5e-07 Z99773-3|CAE11316.1| 305|Caenorhabditis elegans Hypothetical pr... 52 6e-07 Z68301-5|CAA92620.1| 301|Caenorhabditis elegans Hypothetical pr... 52 6e-07 V00148-1|CAA23464.1| 301|Caenorhabditis elegans protein ( Caeno... 52 6e-07 U64609-1|AAB04598.1| 405|Caenorhabditis elegans Sperm-specific ... 52 6e-07 J01048-1|AAA27990.1| 301|Caenorhabditis elegans protein ( C.ele... 52 6e-07 AY347575-1|AAP97869.1| 301|Caenorhabditis elegans COLlagen stru... 52 6e-07 AL110490-3|CAB54449.1| 892|Caenorhabditis elegans Hypothetical ... 52 8e-07 Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical pr... 51 1e-06 U53333-6|AAA96159.2| 304|Caenorhabditis elegans Collagen protei... 51 1e-06 L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. 51 1e-06 AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical... 51 1e-06 AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein p... 51 1e-06 U53155-5|AAC48270.1| 303|Caenorhabditis elegans Collagen protei... 50 2e-06 AL132898-7|CAC14410.1| 413|Caenorhabditis elegans Hypothetical ... 50 2e-06 AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical... 50 2e-06 AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like pro... 50 2e-06 AB072926-1|BAB69889.1| 303|Caenorhabditis elegans collagen prot... 50 2e-06 Z70208-2|CAA94136.1| 304|Caenorhabditis elegans Hypothetical pr... 50 3e-06 AL022716-5|CAB97232.1| 291|Caenorhabditis elegans Hypothetical ... 50 3e-06 Z69386-1|CAA93430.1| 241|Caenorhabditis elegans Hypothetical pr... 50 3e-06 U21320-5|AAA62536.2| 332|Caenorhabditis elegans Rnp (rrm rna bi... 50 3e-06 U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter... 49 4e-06 AL110484-17|CAB54408.1| 586|Caenorhabditis elegans Hypothetical... 49 4e-06 AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. 49 4e-06 AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical ... 49 4e-06 AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated... 49 4e-06 AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated... 49 4e-06 Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical pr... 49 6e-06 U29096-1|AAA68406.1| 105|Caenorhabditis elegans Neuropeptide-li... 49 6e-06 Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical pr... 47 6e-06 Z67990-1|CAA91932.1| 316|Caenorhabditis elegans Hypothetical pr... 48 8e-06 Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical pr... 47 2e-05 Z74033-3|CAA98477.1| 407|Caenorhabditis elegans Hypothetical pr... 47 2e-05 AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily a... 47 2e-05 Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical pr... 47 2e-05 Z68215-7|CAA92453.1| 289|Caenorhabditis elegans Hypothetical pr... 47 2e-05 AF039048-5|AAB94236.1| 76|Caenorhabditis elegans Hypothetical ... 47 2e-05 AF039048-4|AAK68333.1| 101|Caenorhabditis elegans Hypothetical ... 47 2e-05 Z82274-16|CAC70096.1| 1119|Caenorhabditis elegans Hypothetical p... 46 3e-05 Z82274-15|CAB05234.2| 1113|Caenorhabditis elegans Hypothetical p... 46 3e-05 Z74036-2|CAA98487.1| 266|Caenorhabditis elegans Hypothetical pr... 46 3e-05 Z74036-1|CAA98486.1| 299|Caenorhabditis elegans Hypothetical pr... 46 3e-05 Z68753-3|CAA92988.3| 984|Caenorhabditis elegans Hypothetical pr... 46 3e-05 AL132951-13|CAC70127.1| 1119|Caenorhabditis elegans Hypothetical... 46 3e-05 AL132951-12|CAC44311.1| 1113|Caenorhabditis elegans Hypothetical... 46 3e-05 AF283323-1|AAG18575.1| 1113|Caenorhabditis elegans synaptojanin ... 46 3e-05 AF283322-1|AAG18574.1| 1119|Caenorhabditis elegans synaptojanin ... 46 3e-05 AF040642-7|AAB94952.1| 329|Caenorhabditis elegans Collagen prot... 46 3e-05 AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical ... 46 4e-05 AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical ... 46 4e-05 Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical pr... 46 5e-05 Z82064-2|CAI79180.1| 167|Caenorhabditis elegans Hypothetical pr... 46 5e-05 Z81124-1|CAB03369.1| 312|Caenorhabditis elegans Hypothetical pr... 46 5e-05 U61948-2|AAB03143.2| 345|Caenorhabditis elegans Collagen protei... 46 5e-05 M25480-1|AAA27986.1| 326|Caenorhabditis elegans collagen protein. 46 5e-05 L23648-9|AAK95877.1| 466|Caenorhabditis elegans Prion-like-(q/n... 46 5e-05 AF068713-14|AAK73895.1| 172|Caenorhabditis elegans Ground-like ... 46 5e-05 AF067211-1|AAC16986.1| 455|Caenorhabditis elegans Hypothetical ... 46 5e-05 AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical ... 46 5e-05 Z68219-2|CAA92476.1| 300|Caenorhabditis elegans Hypothetical pr... 45 7e-05 AF036699-5|AAB88359.1| 290|Caenorhabditis elegans Collagen prot... 45 7e-05 U53153-1|AAC69039.4| 715|Caenorhabditis elegans Hypothetical pr... 45 1e-04 AC024775-6|AAK68452.2| 304|Caenorhabditis elegans Collagen prot... 45 1e-04 Z79596-2|CAC42251.1| 838|Caenorhabditis elegans Hypothetical pr... 44 1e-04 U97407-6|AAB52481.1| 751|Caenorhabditis elegans Tyrosinase prot... 44 1e-04 AF167982-1|AAD50438.1| 838|Caenorhabditis elegans dynamin protein. 44 1e-04 AF039048-2|AAB94238.1| 85|Caenorhabditis elegans Hypothetical ... 44 1e-04 AC024810-3|AAU20831.1| 660|Caenorhabditis elegans Vasa- and bel... 44 1e-04 AC024810-2|AAK68520.1| 644|Caenorhabditis elegans Vasa- and bel... 44 1e-04 AC024810-1|AAF60764.1| 641|Caenorhabditis elegans Vasa- and bel... 44 1e-04 Z34533-2|CAA84296.1| 166|Caenorhabditis elegans Hypothetical pr... 44 2e-04 U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical pr... 44 2e-04 Z95559-15|CAB63361.1| 917|Caenorhabditis elegans Hypothetical p... 44 2e-04 Z74042-8|CAA98525.1| 299|Caenorhabditis elegans Hypothetical pr... 44 2e-04 AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical ... 44 2e-04 Z68003-3|CAA91977.1| 849|Caenorhabditis elegans Hypothetical pr... 43 3e-04 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 43 3e-04 AL132898-20|CAC14415.2| 243|Caenorhabditis elegans Hypothetical... 43 3e-04 U55366-2|AAA97981.1| 156|Caenorhabditis elegans Hypothetical pr... 43 4e-04 L25598-5|AAM15550.1| 113|Caenorhabditis elegans Calpain family ... 43 4e-04 AF068708-5|AAK68200.1| 628|Caenorhabditis elegans P granule abn... 43 4e-04 AF068708-4|AAC17755.1| 693|Caenorhabditis elegans P granule abn... 43 4e-04 AF039048-6|AAB94235.1| 91|Caenorhabditis elegans Hypothetical ... 43 4e-04 AB120729-1|BAC87886.1| 693|Caenorhabditis elegans PGL-3 protein. 43 4e-04 Z99279-6|CAB16498.1| 640|Caenorhabditis elegans Hypothetical pr... 42 5e-04 Z82284-8|CAB05294.1| 640|Caenorhabditis elegans Hypothetical pr... 42 5e-04 AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical... 42 5e-04 AF026205-6|AAM69068.1| 908|Caenorhabditis elegans Hypothetical ... 42 5e-04 AF026205-5|AAB71258.1| 880|Caenorhabditis elegans Hypothetical ... 42 5e-04 AF026205-4|AAD47129.1| 885|Caenorhabditis elegans Hypothetical ... 42 5e-04 AF026205-3|AAB71257.1| 930|Caenorhabditis elegans Hypothetical ... 42 5e-04 Z81059-5|CAJ15164.1| 176|Caenorhabditis elegans Hypothetical pr... 42 7e-04 Z73105-4|CAA97443.2| 1406|Caenorhabditis elegans Hypothetical pr... 42 7e-04 Z69384-10|CAA93420.2| 1406|Caenorhabditis elegans Hypothetical p... 42 7e-04 U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical pr... 42 7e-04 U42991-1|AAA85197.1| 118|Caenorhabditis elegans RNA binding pro... 42 7e-04 U41746-9|AAA83334.3| 559|Caenorhabditis elegans Groundhog (hedg... 42 7e-04 U24124-1|AAA77029.1| 118|Caenorhabditis elegans RRM-type RNA bi... 42 7e-04 AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical ... 42 7e-04 AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical ... 42 7e-04 AF067209-1|AAC16982.2| 553|Caenorhabditis elegans Warthog (hedg... 42 7e-04 AF038614-8|AAB92055.1| 118|Caenorhabditis elegans Hypothetical ... 42 7e-04 AC006834-6|AAF40004.1| 233|Caenorhabditis elegans Hypothetical ... 42 7e-04 Z81059-3|CAB02927.1| 246|Caenorhabditis elegans Hypothetical pr... 42 9e-04 U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homolog... 42 9e-04 AC024811-5|AAF60775.1| 285|Caenorhabditis elegans Collagen prot... 42 9e-04 AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin pro... 42 9e-04 Z93377-1|CAB07573.1| 340|Caenorhabditis elegans Hypothetical pr... 41 0.001 Z81472-1|CAB03889.1| 173|Caenorhabditis elegans Hypothetical pr... 41 0.001 Z70756-4|CAA94788.1| 290|Caenorhabditis elegans Hypothetical pr... 41 0.001 Z49127-2|CAA88949.1| 245|Caenorhabditis elegans Hypothetical pr... 41 0.001 U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical pr... 41 0.001 U13644-9|AAB52680.3| 492|Caenorhabditis elegans Cell death abno... 41 0.001 AF098992-4|AAK73869.2| 250|Caenorhabditis elegans Hypothetical ... 41 0.001 AF061513-1|AAC24362.1| 492|Caenorhabditis elegans candidate ada... 41 0.001 Z74032-9|CAA98464.2| 80|Caenorhabditis elegans Hypothetical pr... 41 0.002 Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical pr... 41 0.002 U58748-9|AAB52969.3| 542|Caenorhabditis elegans Hypothetical pr... 41 0.002 U58748-8|AAM97986.1| 497|Caenorhabditis elegans Hypothetical pr... 41 0.002 U58748-7|AAM97987.1| 399|Caenorhabditis elegans Hypothetical pr... 41 0.002 U42841-13|AAC48170.1| 682|Caenorhabditis elegans Hypothetical p... 41 0.002 Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr... 40 0.002 Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p... 40 0.002 U40059-1|AAA81138.3| 867|Caenorhabditis elegans Hypothetical pr... 40 0.002 Z81129-3|CAB03404.1| 1262|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z77663-1|CAB01210.1| 94|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z75549-6|CAC42343.1| 74|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z70756-6|CAA94792.1| 290|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z69383-11|CAM06588.1| 110|Caenorhabditis elegans Hypothetical p... 40 0.003 Z54238-5|CAA90997.1| 299|Caenorhabditis elegans Hypothetical pr... 40 0.003 Z54238-3|CAA90995.1| 299|Caenorhabditis elegans Hypothetical pr... 40 0.003 U46753-7|AAA85763.2| 223|Caenorhabditis elegans Hypothetical pr... 40 0.003 U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical pr... 40 0.003 U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical pr... 40 0.003 AY347576-1|AAP97870.1| 299|Caenorhabditis elegans COLlagen stru... 40 0.003 AY347574-1|AAP97868.1| 299|Caenorhabditis elegans COLlagen stru... 40 0.003 AC025716-19|AAK39602.2| 549|Caenorhabditis elegans Hypothetical... 40 0.003 AC006666-4|AAK21415.1| 109|Caenorhabditis elegans Hypothetical ... 40 0.003 AC006651-1|AAF39870.4| 1138|Caenorhabditis elegans Hypothetical ... 40 0.003 Z98877-14|CAD56615.1| 338|Caenorhabditis elegans Hypothetical p... 40 0.004 Z49207-3|CAA89071.1| 927|Caenorhabditis elegans Hypothetical pr... 40 0.004 Z35719-1|CAA84800.1| 296|Caenorhabditis elegans Hypothetical pr... 40 0.004 U28731-8|AAA68300.2| 113|Caenorhabditis elegans Hypothetical pr... 40 0.004 AL023858-2|CAE18058.1| 158|Caenorhabditis elegans Hypothetical ... 40 0.004 Z81120-1|CAB03342.1| 207|Caenorhabditis elegans Hypothetical pr... 39 0.005 Z68335-1|CAA92729.1| 299|Caenorhabditis elegans Hypothetical pr... 39 0.005 U64834-2|AAB04823.2| 1145|Caenorhabditis elegans Hypothetical pr... 39 0.005 AL032627-19|CAD66222.1| 309|Caenorhabditis elegans Hypothetical... 39 0.005 Z95621-2|CAB09131.1| 330|Caenorhabditis elegans Hypothetical pr... 39 0.006 Z81059-1|CAB02925.1| 249|Caenorhabditis elegans Hypothetical pr... 39 0.006 Z78019-9|CAB01457.1| 330|Caenorhabditis elegans Hypothetical pr... 39 0.006 U23181-6|AAC48204.1| 801|Caenorhabditis elegans Hypothetical pr... 39 0.006 AC084197-24|AAM44390.1| 297|Caenorhabditis elegans Collagen pro... 39 0.006 AC024859-11|AAK29981.1| 933|Caenorhabditis elegans Hypothetical... 39 0.006 AC024859-10|ABA00158.1| 832|Caenorhabditis elegans Hypothetical... 39 0.006 Z73425-2|CAA97788.1| 1126|Caenorhabditis elegans Hypothetical pr... 38 0.008 AL110485-18|CAB60366.1| 108|Caenorhabditis elegans Hypothetical... 38 0.008 AF067609-10|AAC17537.1| 163|Caenorhabditis elegans Ground-like ... 38 0.008 Z79694-1|CAB01959.1| 303|Caenorhabditis elegans Hypothetical pr... 38 0.011 AL023838-8|CAL36503.1| 79|Caenorhabditis elegans Hypothetical ... 38 0.011 Z83114-7|CAJ76943.1| 525|Caenorhabditis elegans Hypothetical pr... 38 0.014 Z83114-6|CAB63235.1| 589|Caenorhabditis elegans Hypothetical pr... 38 0.014 Z77662-15|CAI79240.1| 255|Caenorhabditis elegans Hypothetical p... 38 0.014 Z68760-2|CAA92995.1| 597|Caenorhabditis elegans Hypothetical pr... 38 0.014 Z46791-5|CAA86755.2| 948|Caenorhabditis elegans Hypothetical pr... 38 0.014 U58758-4|AAK68614.1| 914|Caenorhabditis elegans Hypothetical pr... 38 0.014 U52002-6|AAB37732.1| 142|Caenorhabditis elegans Hypothetical pr... 38 0.014 U28944-7|AAN63457.1| 295|Caenorhabditis elegans Hypothetical pr... 38 0.014 U28944-6|AAN63456.1| 305|Caenorhabditis elegans Hypothetical pr... 38 0.014 U28944-5|AAK68191.1| 408|Caenorhabditis elegans Hypothetical pr... 38 0.014 U28944-4|AAK68192.1| 376|Caenorhabditis elegans Hypothetical pr... 38 0.014 U21308-2|AAB93313.3| 507|Caenorhabditis elegans Hypothetical pr... 38 0.014 AF308860-1|AAG45416.1| 1475|Caenorhabditis elegans SOP-3 protein. 38 0.014 AC024805-15|AAK39331.2| 344|Caenorhabditis elegans Hypothetical... 38 0.014 AC024201-13|AAF36027.2| 1475|Caenorhabditis elegans Suppressor o... 38 0.014 AC024136-3|AAF35959.2| 470|Caenorhabditis elegans Hypothetical ... 38 0.014 AC006708-23|AAF60414.1| 975|Caenorhabditis elegans Paz/piwi dom... 38 0.014 AC006672-4|AAK84542.1| 151|Caenorhabditis elegans Hypothetical ... 38 0.014 Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical pr... 37 0.019 Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical pr... 37 0.019 AF025467-4|AAN65300.1| 1130|Caenorhabditis elegans Hypothetical ... 37 0.019 Z82083-5|CAB04973.1| 298|Caenorhabditis elegans Hypothetical pr... 37 0.025 Z81568-3|CAB04592.1| 643|Caenorhabditis elegans Hypothetical pr... 37 0.025 Z81042-1|CAB02795.1| 1657|Caenorhabditis elegans Hypothetical pr... 37 0.025 Z22177-4|CAA80146.1| 1232|Caenorhabditis elegans Hypothetical pr... 37 0.025 U46675-7|AAB52641.1| 1274|Caenorhabditis elegans Hypothetical pr... 37 0.025 U41031-3|AAA82620.1| 164|Caenorhabditis elegans Hypothetical pr... 37 0.025 U40802-3|AAM81105.1| 369|Caenorhabditis elegans Dense body prot... 37 0.025 U40802-2|AAM81104.1| 1010|Caenorhabditis elegans Dense body prot... 37 0.025 U40802-1|AAM81106.1| 999|Caenorhabditis elegans Dense body prot... 37 0.025 U38378-1|AAA79751.1| 418|Caenorhabditis elegans Hypothetical pr... 37 0.025 J04804-1|AAA28002.1| 1010|Caenorhabditis elegans protein ( C.ele... 37 0.025 AF101312-1|AAC69221.3| 813|Caenorhabditis elegans Hypothetical ... 37 0.025 AF016428-7|AAB65361.1| 439|Caenorhabditis elegans Dnaj domain (... 37 0.025 Z95559-4|CAB09004.1| 110|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z82095-2|CAB05027.2| 602|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z81059-2|CAB02926.1| 240|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z68011-3|CAA92014.2| 821|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z50071-4|CAA90409.2| 1301|Caenorhabditis elegans Hypothetical pr... 36 0.033 Z49130-7|CAA88972.2| 316|Caenorhabditis elegans Hypothetical pr... 36 0.033 AL032637-2|CAA21608.1| 87|Caenorhabditis elegans Hypothetical ... 36 0.033 AF047656-13|AAC05105.1| 313|Caenorhabditis elegans Collagen pro... 36 0.033 AF000198-7|AAB53052.1| 418|Caenorhabditis elegans Collagen prot... 36 0.033 Z99278-4|CAB16492.1| 871|Caenorhabditis elegans Hypothetical pr... 36 0.044 Z99278-3|CAB16493.1| 867|Caenorhabditis elegans Hypothetical pr... 36 0.044 Z81592-1|CAB04725.1| 695|Caenorhabditis elegans Hypothetical pr... 36 0.044 Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical p... 36 0.044 Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical p... 36 0.044 Z70287-6|CAH04747.1| 443|Caenorhabditis elegans Hypothetical pr... 36 0.044 U88309-2|AAB42334.1| 211|Caenorhabditis elegans Hypothetical pr... 36 0.044 U42436-10|AAF99899.1| 272|Caenorhabditis elegans Ribosomal prot... 36 0.044 AF022985-9|AAB69960.1| 314|Caenorhabditis elegans Collagen prot... 36 0.044 AF000299-1|AAC47980.1| 210|Caenorhabditis elegans Hypothetical ... 36 0.044 Z83222-1|CAB05712.1| 410|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z81525-6|CAB82206.2| 346|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z81503-1|CAB04111.1| 305|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z81122-3|CAB54313.1| 1076|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z81122-2|CAB03354.1| 1074|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z49131-6|CAA88979.1| 297|Caenorhabditis elegans Hypothetical pr... 36 0.058 Z37983-4|CAA86057.1| 803|Caenorhabditis elegans Hypothetical pr... 36 0.058 X64435-1|CAA45773.1| 318|Caenorhabditis elegans collagen protein. 36 0.058 U93842-1|AAB52421.1| 1409|Caenorhabditis elegans regulator of pr... 36 0.058 U56966-4|AAA98719.2| 906|Caenorhabditis elegans Ace(angiotensin... 36 0.058 U56966-3|AAU05584.1| 332|Caenorhabditis elegans Ace(angiotensin... 36 0.058 U49945-3|AAM51509.1| 1408|Caenorhabditis elegans Aboc, expulsion... 36 0.058 U49945-2|AAC47926.1| 1409|Caenorhabditis elegans Aboc, expulsion... 36 0.058 U41624-3|AAF99944.1| 318|Caenorhabditis elegans Dumpy : shorter... 36 0.058 U40797-15|AAB37553.2| 1004|Caenorhabditis elegans Temporarily as... 36 0.058 U40028-9|AAA81120.1| 256|Caenorhabditis elegans Serpentine rece... 36 0.058 U28942-1|AAA68355.2| 441|Caenorhabditis elegans Hypothetical pr... 36 0.058 U23172-15|AAN63408.1| 374|Caenorhabditis elegans Hypothetical p... 36 0.058 U23172-14|AAL02495.1| 165|Caenorhabditis elegans Hypothetical p... 36 0.058 U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical p... 36 0.058 L15419-1|AAA17726.1| 308|Caenorhabditis elegans col-40 collagen... 36 0.058 AF098992-8|AAC67454.2| 239|Caenorhabditis elegans Hypothetical ... 36 0.058 AC024847-11|AAO21416.1| 453|Caenorhabditis elegans Ground-like ... 36 0.058 AC024847-10|AAF60859.1| 393|Caenorhabditis elegans Ground-like ... 36 0.058 AC006790-10|AAF60736.1| 371|Caenorhabditis elegans Collagen pro... 36 0.058 Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical pr... 35 0.077 Z81106-2|CAB03220.2| 468|Caenorhabditis elegans Hypothetical pr... 35 0.077 Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical pr... 35 0.077 Z66563-2|CAA91469.3| 2557|Caenorhabditis elegans Hypothetical pr... 35 0.077 Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical p... 35 0.077 Z50070-7|CAA90396.1| 87|Caenorhabditis elegans Hypothetical pr... 35 0.077 Z36238-1|CAA85275.2| 400|Caenorhabditis elegans Hypothetical pr... 35 0.077 U50191-2|AAK31556.2| 335|Caenorhabditis elegans Dumpy : shorter... 35 0.077 U50191-1|AAO38600.2| 372|Caenorhabditis elegans Dumpy : shorter... 35 0.077 U42437-5|AAA83499.1| 302|Caenorhabditis elegans Dumpy : shorter... 35 0.077 U28737-7|ABA61870.1| 501|Caenorhabditis elegans Hypothetical pr... 35 0.077 U21308-11|AAB93312.3| 265|Caenorhabditis elegans Roller: helica... 35 0.077 U21308-10|AAN65281.1| 329|Caenorhabditis elegans Roller: helica... 35 0.077 U20864-8|AAC46665.2| 330|Caenorhabditis elegans Peroxisome asse... 35 0.077 M25477-1|AAA27991.1| 329|Caenorhabditis elegans collagen protein. 35 0.077 M23559-1|AAA27994.1| 302|Caenorhabditis elegans protein ( C.ele... 35 0.077 L12692-1|AAA17395.2| 356|Caenorhabditis elegans collagen protein. 35 0.077 AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAue... 35 0.077 AL110485-8|CAB60356.1| 434|Caenorhabditis elegans Hypothetical ... 35 0.077 AF067612-1|AAD36954.1| 780|Caenorhabditis elegans Egg laying de... 35 0.077 AF003385-2|AAB54249.1| 773|Caenorhabditis elegans Hypothetical ... 35 0.077 AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator comp... 35 0.077 Z78064-2|CAB01508.2| 317|Caenorhabditis elegans Hypothetical pr... 35 0.10 Z69383-10|CAM06587.1| 222|Caenorhabditis elegans Hypothetical p... 35 0.10 U41014-1|AAK32947.3| 641|Caenorhabditis elegans Hypothetical pr... 35 0.10 U28731-7|AAA68294.2| 120|Caenorhabditis elegans Hypothetical pr... 35 0.10 AF067607-3|AAF98607.1| 590|Caenorhabditis elegans Hypothetical ... 35 0.10 AC084158-11|AAK68558.1| 555|Caenorhabditis elegans Hypothetical... 35 0.10 AC024838-7|AAF60820.1| 381|Caenorhabditis elegans Hypothetical ... 35 0.10 AC024838-3|AAF60821.1| 381|Caenorhabditis elegans Hypothetical ... 35 0.10 AC024809-7|AAF59540.1| 315|Caenorhabditis elegans Hypothetical ... 35 0.10 Z96047-4|CAB09414.1| 796|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z78064-1|CAB01509.1| 313|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z70686-12|CAB54289.1| 2584|Caenorhabditis elegans Hypothetical p... 34 0.14 Z70686-11|CAA94615.1| 2606|Caenorhabditis elegans Hypothetical p... 34 0.14 Z70686-8|CAM35837.1| 1427|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z70686-7|CAM35836.1| 1405|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z70310-9|CAB54294.1| 2584|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z70310-8|CAA94370.1| 2606|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z70205-10|CAA94122.2| 887|Caenorhabditis elegans Hypothetical p... 34 0.14 Z68752-7|CAA92982.2| 693|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z68003-5|CAA91979.2| 887|Caenorhabditis elegans Hypothetical pr... 34 0.14 Z46937-1|CAA87056.2| 1036|Caenorhabditis elegans Hypothetical pr... 34 0.14 U80451-9|AAB37843.1| 285|Caenorhabditis elegans Collagen protei... 34 0.14 U55366-4|AAA97982.1| 310|Caenorhabditis elegans Collagen protei... 34 0.14 AF067211-9|AAC16994.1| 120|Caenorhabditis elegans Hypothetical ... 34 0.14 AF026211-4|AAB71295.1| 416|Caenorhabditis elegans Collagen prot... 34 0.14 AC025716-14|AAK39603.1| 227|Caenorhabditis elegans Hypothetical... 34 0.14 Z92837-1|CAB07400.1| 1043|Caenorhabditis elegans Hypothetical pr... 34 0.18 Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical pr... 34 0.18 Z75543-7|CAA99868.2| 139|Caenorhabditis elegans Hypothetical pr... 34 0.18 U27312-9|AAA68252.1| 239|Caenorhabditis elegans Hypothetical pr... 34 0.18 AY372076-1|AAQ75758.1| 1043|Caenorhabditis elegans SYM-4 protein. 34 0.18 AL132949-22|CAB70112.2| 603|Caenorhabditis elegans Hypothetical... 34 0.18 AF003130-14|AAB54129.1| 892|Caenorhabditis elegans Hypothetical... 34 0.18 AF000193-1|AAB52891.1| 715|Caenorhabditis elegans Hypothetical ... 34 0.18 AC006743-4|AAF60502.1| 291|Caenorhabditis elegans Collagen prot... 34 0.18 Z99772-2|CAB16922.2| 2162|Caenorhabditis elegans Hypothetical pr... 33 0.24 Z83316-8|CAB54186.1| 409|Caenorhabditis elegans Hypothetical pr... 33 0.24 Z83230-6|CAB05746.1| 336|Caenorhabditis elegans Hypothetical pr... 33 0.24 Z75533-11|CAA99823.2| 2162|Caenorhabditis elegans Hypothetical p... 33 0.24 Z71180-3|CAA94892.2| 763|Caenorhabditis elegans Hypothetical pr... 33 0.24 Z70756-10|CAI46587.1| 228|Caenorhabditis elegans Hypothetical p... 33 0.24 Z68302-2|CAA92631.1| 630|Caenorhabditis elegans Hypothetical pr... 33 0.24 U55854-1|AAA98010.2| 418|Caenorhabditis elegans Hypothetical pr... 33 0.24 U10438-1|AAA19083.3| 524|Caenorhabditis elegans Hypothetical pr... 33 0.24 U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (gr... 33 0.24 DQ340624-1|ABC65812.1| 524|Caenorhabditis elegans chondroitin p... 33 0.24 AL110487-16|CAH10818.1| 304|Caenorhabditis elegans Hypothetical... 33 0.24 AL110487-15|CAH10817.1| 307|Caenorhabditis elegans Hypothetical... 33 0.24 AL110487-14|CAB54432.1| 395|Caenorhabditis elegans Hypothetical... 33 0.24 AL032625-4|CAB63350.2| 792|Caenorhabditis elegans Hypothetical ... 33 0.24 AL021474-7|CAA16311.2| 763|Caenorhabditis elegans Hypothetical ... 33 0.24 AF003135-11|AAK18987.2| 1406|Caenorhabditis elegans Hypothetical... 33 0.24 AC024824-3|AAK85501.1| 543|Caenorhabditis elegans Hypothetical ... 33 0.24 Z81034-4|CAB02729.1| 541|Caenorhabditis elegans Hypothetical pr... 33 0.31 Z70783-9|CAA94857.2| 455|Caenorhabditis elegans Hypothetical pr... 33 0.31 U61954-8|AAM98018.1| 1005|Caenorhabditis elegans Hypothetical pr... 33 0.31 U61954-7|AAK29803.1| 1140|Caenorhabditis elegans Hypothetical pr... 33 0.31 AF106592-4|AAK21366.1| 786|Caenorhabditis elegans Hypothetical ... 33 0.31 AF099925-3|AAC69507.1| 394|Caenorhabditis elegans Collagen prot... 33 0.31 AF022985-10|AAB69961.1| 325|Caenorhabditis elegans Collagen pro... 33 0.31 AF016430-2|AAB65371.1| 1106|Caenorhabditis elegans Gex interacti... 33 0.31 AC024876-4|AAU05555.1| 825|Caenorhabditis elegans Hypothetical ... 33 0.31 AC024777-5|AAF60564.1| 506|Caenorhabditis elegans Hypothetical ... 33 0.31 AC006733-9|AAF60491.2| 3901|Caenorhabditis elegans Hypothetical ... 33 0.31 Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical pr... 29 0.41 Z81125-3|CAB03384.1| 790|Caenorhabditis elegans Hypothetical pr... 33 0.41 Z77662-14|CAI79239.1| 245|Caenorhabditis elegans Hypothetical p... 33 0.41 Z29561-4|CAD91697.1| 498|Caenorhabditis elegans Hypothetical pr... 33 0.41 Z29561-3|CAD54153.1| 846|Caenorhabditis elegans Hypothetical pr... 33 0.41 U55366-3|AAY86188.1| 118|Caenorhabditis elegans Hypothetical pr... 33 0.41 U39745-4|AAA80446.1| 325|Caenorhabditis elegans Collagen protei... 33 0.41 U23515-13|AAK21453.1| 823|Caenorhabditis elegans Hypothetical p... 33 0.41 U23172-13|ABH03527.1| 282|Caenorhabditis elegans Hypothetical p... 33 0.41 AL032630-3|CAA21560.1| 214|Caenorhabditis elegans Hypothetical ... 33 0.41 AL032627-21|CAD66221.1| 289|Caenorhabditis elegans Hypothetical... 33 0.41 AF038608-17|AAC25822.2| 425|Caenorhabditis elegans Hypothetical... 33 0.41 AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical ... 33 0.41 AF016687-1|AAC48094.2| 315|Caenorhabditis elegans Dumpy : short... 33 0.41 AC024790-10|AAF60632.2| 129|Caenorhabditis elegans Hypothetical... 33 0.41 Z82069-7|CAB04907.2| 1792|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z73910-4|CAA98136.1| 662|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z30215-9|CAB54247.1| 1037|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z30215-8|CAA82941.1| 1040|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z29561-2|CAD54152.1| 882|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z29561-1|CAA82667.2| 861|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z29121-4|CAB54514.1| 1037|Caenorhabditis elegans Hypothetical pr... 32 0.54 Z29121-3|CAA82389.1| 1040|Caenorhabditis elegans Hypothetical pr... 32 0.54 U73679-1|AAC67305.1| 861|Caenorhabditis elegans YNK1-a protein. 32 0.54 U55364-11|AAA97976.1| 196|Caenorhabditis elegans Hypothetical p... 32 0.54 EF378622-1|ABN54457.1| 1492|Caenorhabditis elegans enhancer of g... 32 0.54 AL132902-15|CAC14425.1| 1792|Caenorhabditis elegans Hypothetical... 32 0.54 AL117201-3|CAL64007.1| 1512|Caenorhabditis elegans Hypothetical ... 32 0.54 AF106589-3|AAT81179.1| 511|Caenorhabditis elegans Hypothetical ... 32 0.54 AC024805-16|AAK39336.1| 448|Caenorhabditis elegans Hypothetical... 32 0.54 AC024788-3|AAF60614.2| 98|Caenorhabditis elegans Caenacin (cae... 32 0.54 AF003389-3|AAC71136.1| 1003|Caenorhabditis elegans Hypothetical ... 28 0.69 AF003389-4|AAN63407.1| 598|Caenorhabditis elegans Hypothetical ... 28 0.72 Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z82268-5|CAB05195.1| 304|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z79756-9|CAK12562.1| 830|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z79756-8|CAB02122.1| 891|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z79756-7|CAK12561.1| 855|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z72511-3|CAA96657.1| 610|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z70756-7|CAA94794.2| 199|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z70208-1|CAA94141.1| 339|Caenorhabditis elegans Hypothetical pr... 32 0.72 Z46791-4|CAA86758.1| 317|Caenorhabditis elegans Hypothetical pr... 32 0.72 U97016-3|AAN84885.1| 2695|Caenorhabditis elegans Lethal protein ... 32 0.72 U55364-10|AAA97975.1| 103|Caenorhabditis elegans Hypothetical p... 32 0.72 >Z81053-1|CAB02877.1| 385|Caenorhabditis elegans Hypothetical protein E02A10.2 protein. Length = 385 Score = 118 bits (285), Expect = 5e-27 Identities = 65/123 (52%), Positives = 65/123 (52%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXX 804 GG G GGG G GGG GG G G GGG G GGG GG G GGG GG Sbjct: 62 GGGCGGGGGGCGGGGGGCGGGGGCG-----GGGGGCGGGGGGCGGGGGCGGGCAPPPPPP 116 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GGGG G GGG GGGG G GG G G G GGGGG G GGG G G G GG Sbjct: 117 ACGGGCGGGGGGCGGGCGGGGGGGCGG-GGGGGCGGGGG-GCGGGGGGCGGGGGGCGGGG 174 Query: 623 XGG 615 GG Sbjct: 175 GGG 177 Score = 116 bits (278), Expect = 3e-26 Identities = 64/130 (49%), Positives = 64/130 (49%), Gaps = 9/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG--------GXX 825 GG G GGG G GGG GG G G GGG G G G GGG GGG G Sbjct: 63 GGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGG-GGGCGGGGGCGGGCAPPPPPPACGGG 121 Query: 824 XXGGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXX 648 GGG GG GGGG G GGG GG GG G G G G G GGGGG G GGG G Sbjct: 122 CGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGG 181 Query: 647 GXGXXGGXXG 618 G G GG G Sbjct: 182 GGGGCGGGCG 191 Score = 104 bits (249), Expect = 1e-22 Identities = 59/130 (45%), Positives = 59/130 (45%), Gaps = 8/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGGX 807 GG G GG G GGG GG G G GGG GGG G GG GG GGG Sbjct: 26 GGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGC 85 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXG------GXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG GGGG G GGG GGG G G G G GG GG G GGG G G Sbjct: 86 GGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGG 145 Query: 644 XGXXGGXXGG 615 G GG GG Sbjct: 146 GGGCGGGGGG 155 Score = 81.4 bits (192), Expect = 9e-16 Identities = 53/136 (38%), Positives = 53/136 (38%), Gaps = 12/136 (8%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXX------GGXGGGGXGXXGGXGGGXGXXGGGX 827 GGGGG G G GG G GG G G G GG GGG G GG GGG G GG Sbjct: 27 GGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGCG 86 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-----GGGGXXXXXXGXG 662 G G GG G G GG G GG G GGGG G G Sbjct: 87 GGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGG 146 Query: 661 XXXXXGXGGXXGGXXG 614 G GG GG G Sbjct: 147 GGCGGGGGGCGGGGGG 162 Score = 80.6 bits (190), Expect = 2e-15 Identities = 53/137 (38%), Positives = 53/137 (38%), Gaps = 13/137 (9%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXG------------XXXXGGXGGGGXGXXGGXGGGXG 845 GGGGG G GGG G G G G G G GG GGG G GG GGG G Sbjct: 25 GGGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGG 84 Query: 844 XXGGGXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGX 665 GGG G G G G G GG G G GG G GGG G Sbjct: 85 CGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGG 144 Query: 664 GXXXXXGXGGXXGGXXG 614 G G GG GG G Sbjct: 145 GGGGCGGGGGGCGGGGG 161 Score = 70.9 bits (166), Expect = 1e-12 Identities = 36/70 (51%), Positives = 36/70 (51%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG G G GG G GG G G G GG GGGG G GG GGG G GGG G G Sbjct: 119 GGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGG-GGCGGGGGGCGGGGGGCGGGGGGG 177 Query: 805 XGGXGXGXGG 776 GG G G G Sbjct: 178 CGGGGGGGCG 187 Score = 70.5 bits (165), Expect = 2e-12 Identities = 47/130 (36%), Positives = 47/130 (36%), Gaps = 9/130 (6%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG---------GXGXXGGXGGGXGXXGGGXX 824 GG G GGG G GG G G G GG GGG G GG GGG G GGG Sbjct: 23 GGGGGGGG--GCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCG 80 Query: 823 XXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 G G GG G G GG G GGG G G G Sbjct: 81 GGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGG 140 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 141 CGGGGGGGCG 150 Score = 69.3 bits (162), Expect = 4e-12 Identities = 35/69 (50%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG-XXGGGXXXXGXXG 806 GGGG G GGG G GG G G GG GGG G GG GGG G GGG G G Sbjct: 123 GGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGG 182 Query: 805 XGGXGXGXG 779 GG G G G Sbjct: 183 GGGCGGGCG 191 Score = 65.7 bits (153), Expect = 5e-11 Identities = 41/99 (41%), Positives = 41/99 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG G GGG G G GG GG G G GG GGG G GGG G G Sbjct: 98 GCGGGGGCGGGCAPPPPPPACGGG--CGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGG 155 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 GG G G GG G GG GGGGG Sbjct: 156 CGGGGGGCGG---------GGGGCGGGGGGGCGGGGGGG 185 >AF000193-3|AAB52890.1| 259|Caenorhabditis elegans Hypothetical protein T20B6.3 protein. Length = 259 Score = 115 bits (277), Expect = 5e-26 Identities = 60/122 (49%), Positives = 60/122 (49%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G GGG GG G G GG G G G GG GGG G GGG Sbjct: 112 GGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMG 171 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GGG G GGG GGGG G G G G G GGGG G GGG G G G GG Sbjct: 172 GGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGG-GDGGYGPSGGYG 230 Query: 620 GG 615 GG Sbjct: 231 GG 232 Score = 111 bits (268), Expect = 6e-25 Identities = 62/123 (50%), Positives = 62/123 (50%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G GGG G G GG GG G G GGG GGG GGG GG GG GGG Sbjct: 135 GGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMG 194 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GGG G GGG GGGG G GG G G G GG G G GGG G G G GG Sbjct: 195 GYGGGMGGG--GYGGGGMGGGGYGGGGDG-GYGPSGGYG-GGYGPGGGYGMGGGGGGGGC 250 Query: 623 XGG 615 G Sbjct: 251 PNG 253 Score = 107 bits (258), Expect = 9e-24 Identities = 61/126 (48%), Positives = 61/126 (48%), Gaps = 4/126 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXX 804 GG G G G GGG GG G G GG G GGG GG GGG GG G GG Sbjct: 97 GGYGGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGG 156 Query: 803 XXGGXXGG-GGXGXGGGXXGGGGXG--XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG GG GG G GGG GGGG G GG G G GG GG G GG G G G Sbjct: 157 GGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYG 216 Query: 632 GGXXGG 615 GG GG Sbjct: 217 GGGDGG 222 Score = 107 bits (258), Expect = 9e-24 Identities = 61/125 (48%), Positives = 61/125 (48%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG GG G G GGG G GG GG GGG GG GGG Sbjct: 127 GGYGGYGGGGYGGMGGGPGGYGMGGY----GGGGGGGGDFGGYGGGGMGGGGYGGGGDGG 182 Query: 800 XGGXX-GGGGXGXGGGXXGGGGXGXGGXGXG--XGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GG GGGG G GG G G G G GG G GGG G G G Sbjct: 183 YGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMG 242 Query: 629 GXXGG 615 G GG Sbjct: 243 GGGGG 247 Score = 104 bits (250), Expect = 8e-23 Identities = 58/124 (46%), Positives = 58/124 (46%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G GG GG G G GG G GGG GG GGG G G G Sbjct: 89 GFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYG 148 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG-GGGGXXXXGXGG-GXGXXGXGXXGG 627 GG GGGG G G GGGG G GG G G G GGGG G GG G G G G GG Sbjct: 149 MGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGG 208 Query: 626 XXGG 615 GG Sbjct: 209 GMGG 212 Score = 101 bits (241), Expect = 1e-21 Identities = 62/128 (48%), Positives = 62/128 (48%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXGGXXXXGG 813 GG G GGG G GG GG G G GG G GGG GGG GGG G GG Sbjct: 77 GGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGGGGDGGG-GYGGYGGG 135 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGG--XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GG GG G G GG GGGG G GG G G G GGGG G GGG G G G Sbjct: 136 GYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYG-GGGFGGGGMG 194 Query: 638 XXGGXXGG 615 GG GG Sbjct: 195 GYGGGMGG 202 Score = 101 bits (241), Expect = 1e-21 Identities = 61/124 (49%), Positives = 61/124 (49%), Gaps = 3/124 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GG GG G G GG G G GG GGG GG GG G G Sbjct: 95 GQGGYGGG--GDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGG-GPGGYGMGG 151 Query: 800 XGGXXGGGG--XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GGGG G GGG GGGG G GG G G G GG GG G GGG G G G G Sbjct: 152 YGGGGGGGGDFGGYGGGGMGGGGYGGGGDG-GYGGGGFGGGGMGGYGGGMGGGGYGGGGM 210 Query: 626 XXGG 615 GG Sbjct: 211 GGGG 214 Score = 98.7 bits (235), Expect = 6e-21 Identities = 59/125 (47%), Positives = 59/125 (47%), Gaps = 4/125 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGGG-X 807 G G GG G GG GG G G GGG GGG GGG GGG GG GGG Sbjct: 75 GRGGYGGSGGGAFGGFNGGYGQGGY----GGGGDFGGGMGGGGYGGGGYGGGGDGGGGYG 130 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG-GXXXXGXGGGXGXXGXGXXG 630 GG GG G G GG GG G G GG G G GGGG G G GG G G G G Sbjct: 131 GYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGG 190 Query: 629 GXXGG 615 G GG Sbjct: 191 GGMGG 195 Score = 87.8 bits (208), Expect = 1e-17 Identities = 52/124 (41%), Positives = 52/124 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G G GG GGGG G GG GGG G GGG G G Sbjct: 125 GGGGYGGYGGGGYGGMGGGPGGYGMGGYGG-GGGGGGDFGGYGGG-GMGGGGYGGGGDGG 182 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G G GG G G GG GGG G G G G G G Sbjct: 183 YGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMG 242 Query: 625 GXXG 614 G G Sbjct: 243 GGGG 246 Score = 83.8 bits (198), Expect = 2e-16 Identities = 52/116 (44%), Positives = 52/116 (44%), Gaps = 5/116 (4%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGGGXXXXGGXXGG-GG 774 G G G G G G G GG GG G GG GG GGG G GG GG Sbjct: 62 GQRGPFAAMTGSYGRGGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGG 121 Query: 773 XGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGG--XGXXGXGXXGGXXGG 615 G GGG GG GG G GG G G G G GG G GGG G G G GG GG Sbjct: 122 GGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGG 177 Score = 83.0 bits (196), Expect = 3e-16 Identities = 45/95 (47%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G GGG GG G G GG G G G GG GGG GG GGG Sbjct: 163 GGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGGGDGG 222 Query: 800 XGGXXG-GGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G G GGG G GGG GGG G GG G G Sbjct: 223 YGPSGGYGGGYGPGGGYGMGGGGGGGGCPNGECRG 257 Score = 82.6 bits (195), Expect = 4e-16 Identities = 49/124 (39%), Positives = 49/124 (39%), Gaps = 1/124 (0%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G GG G GG G GG G G G GG GGGG G GG GG G GGG G G Sbjct: 95 GQGGYGGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGG--GGYGGMGGGPGGYGMGGY 152 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGG-GGGXXXXXXGXGXXXXXGXGGXXG 626 GG G G G G GG GG GGG G G GG G Sbjct: 153 GGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGG 212 Query: 625 GXXG 614 G G Sbjct: 213 GGYG 216 Score = 79.4 bits (187), Expect = 4e-15 Identities = 48/121 (39%), Positives = 48/121 (39%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G G G G G G G G GG GGGG G G GGG G GGG G G Sbjct: 135 GGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGG--GFGGGG 192 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G G GG G G G GG GG G G G GG Sbjct: 193 MGGYGGGMGGGGYGGGGMGGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGGGGGGGGCPN 252 Query: 625 G 623 G Sbjct: 253 G 253 Score = 78.6 bits (185), Expect = 6e-15 Identities = 52/132 (39%), Positives = 52/132 (39%), Gaps = 8/132 (6%) Frame = -1 Query: 985 GGGG--GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXX 821 GGGG G G GGG G G G G G GG GGGG G GG GG G GGG Sbjct: 100 GGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGG 159 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXGXXXXXG 644 G GG G G GG G GG G GGGG G G G Sbjct: 160 GDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGMGGGGYGGGGMGGGGYGGGG 219 Query: 643 XG--GXXGGXXG 614 G G GG G Sbjct: 220 DGGYGPSGGYGG 231 Score = 77.8 bits (183), Expect = 1e-14 Identities = 47/122 (38%), Positives = 47/122 (38%), Gaps = 1/122 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXX-GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGG G GG G GG G G GG GGGG G G GGG G GGG G Sbjct: 83 GGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGGGGDGGGGYGGYGGG--GYGGM 140 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 G G G G GG G GG GGGG G G G GG Sbjct: 141 GGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGGMGGYGGGM 200 Query: 628 GG 623 GG Sbjct: 201 GG 202 Score = 77.0 bits (181), Expect = 2e-14 Identities = 51/130 (39%), Positives = 51/130 (39%), Gaps = 7/130 (5%) Frame = -1 Query: 982 GGGGXGXG-----GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 G GG G GG G G G G G GG GGGG G GG GG G GGG Sbjct: 75 GRGGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYG--GGGYGGGGDGGGGYGGY 132 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGG--GGXXXXXXGXGXXXXXG 644 G G GG G G GG G G GG GGG GG G G G Sbjct: 133 GGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGGYGGGGFGGGG 192 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 193 MGGYGGGMGG 202 Score = 63.3 bits (147), Expect = 3e-10 Identities = 43/116 (37%), Positives = 43/116 (37%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGX 782 G G GG G G GG G GG G G GGG G GGG G G GG G G Sbjct: 72 GSYGRGGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMG--GGGY---GGGGYGGGGDGG 126 Query: 781 GGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXGGXXG 614 GG G G G GGGGG G G G G GG G Sbjct: 127 GGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYGGGGDGG 182 Score = 56.8 bits (131), Expect = 2e-08 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 1/115 (0%) Frame = -1 Query: 955 GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G G GG GGG G G G G GGG G G G G G GG Sbjct: 62 GQRGPFAAMTGSYGRGGYGGSGGGAFGGFNGGYGQGGYGGGGDFGGGMGGGGYGGGGYGG 121 Query: 775 XXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXGXXXXXGXGGXXGGXXG 614 G G GG G G GG G G G GG GG G Sbjct: 122 GGDGGGGYGGYGGGGYGGMGGGPGGYGMGGYGGGGGGGGDFGGYGGGGMGGGGYG 176 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXX---GGXGGGGXGXXGGXGG 854 GGGG G G G G GG G G G GG GGGG G G Sbjct: 211 GGGGYGGGGDGGYGPSGGYGGGYGPGGGYGMGGGGGGGGCPNGECRG 257 >Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 115 bits (276), Expect = 6e-26 Identities = 60/120 (50%), Positives = 60/120 (50%), Gaps = 2/120 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG G G GGG G GG GGG GGG GG GGG Sbjct: 81 GGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 140 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG--GGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G GG GGGG G GG G G GG GGG GG G G G GG Sbjct: 141 -GGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGG 199 Score = 112 bits (270), Expect = 3e-25 Identities = 60/125 (48%), Positives = 60/125 (48%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG GG G GGG G GGG GG GG GGG Sbjct: 26 GGGGGGGGCGGGCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGG 85 Query: 800 XGGXXGGGGXGXGGG---XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GGGG G GG G G G GG GG GGG G G G G Sbjct: 86 GGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSG 145 Query: 629 GXXGG 615 G GG Sbjct: 146 GCGGG 150 Score = 112 bits (269), Expect = 4e-25 Identities = 59/118 (50%), Positives = 59/118 (50%), Gaps = 2/118 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG GG G GGG G GGG GG GGG GG GGG GG G Sbjct: 56 GGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGG----GGGCG 111 Query: 782 GGGX--GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG GGGG G GG G G GG G G GG G G G GG GG Sbjct: 112 GGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGG 169 Score = 111 bits (266), Expect = 1e-24 Identities = 57/121 (47%), Positives = 57/121 (47%), Gaps = 3/121 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG G G G G GGG GGG GG GG G G Sbjct: 100 GGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGG 159 Query: 800 XGGXXGGGGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GGGG GG G G G GGG GG G G G G Sbjct: 160 GGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSG 219 Query: 629 G 627 G Sbjct: 220 G 220 Score = 109 bits (261), Expect = 4e-24 Identities = 58/127 (45%), Positives = 58/127 (45%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG GG G G GGG G GG GGG GGG GG G Sbjct: 88 GGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGC 147 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG-----XGGGGGXXXXGXGGGXGXXGXGX 636 GG GG G G GGG GGGG G GG G G GGGG G GG G Sbjct: 148 GGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPS 207 Query: 635 XGGXXGG 615 GG GG Sbjct: 208 GGGGCGG 214 Score = 108 bits (260), Expect = 5e-24 Identities = 62/127 (48%), Positives = 62/127 (48%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 GG G GGG G GGG G G G GGG G GG GGG GGG GG G Sbjct: 56 GGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGG-GGGCGGGGGGCGGGG 114 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG GG GGGG G GGG GGGG G GG G G G GG G GG G G G Sbjct: 115 GGCGGGGGGCGGGGGGCGGG--GGGGCG-GGSSGGCGGGSSGGCGGGGGGGCGGGGGGGC 171 Query: 635 XGGXXGG 615 GG GG Sbjct: 172 GGGSSGG 178 Score = 108 bits (260), Expect = 5e-24 Identities = 56/116 (48%), Positives = 56/116 (48%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG GG G G GGG G GG GGG GGG GG GGG GG G Sbjct: 80 GGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGG--CGGGGGGCGGGGGG 137 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GG GG G GG G G GGGGG G GG G GG GG Sbjct: 138 GCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGG 193 Score = 101 bits (242), Expect = 8e-22 Identities = 54/121 (44%), Positives = 54/121 (44%), Gaps = 3/121 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG G G G G G GGG GG GGG GG GGG Sbjct: 112 GGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGC 171 Query: 800 XGGXXGGGGXG---XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG GGG GGGG GG G GGGG G GG G G Sbjct: 172 GGGSSGGGGYAVAPSGGGGCGGGG-SSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGG 230 Query: 629 G 627 G Sbjct: 231 G 231 Score = 101 bits (241), Expect = 1e-21 Identities = 60/131 (45%), Positives = 60/131 (45%), Gaps = 13/131 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG G GGG GG G G G G G GGG GGG GGG GG GGG Sbjct: 122 GGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGY 181 Query: 806 XXX---GGXXGGGGXGXGGGXX----GGGGXGXGGXGXGXG----XGGGGGXXXXGXGGG 660 GG GGGG GGG GGGG G GG G G GGGG G GG Sbjct: 182 AVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGGGGYATSGGGGS 241 Query: 659 XGXXGXGXXGG 627 G G GG Sbjct: 242 GGYATGGSSGG 252 Score = 87.0 bits (206), Expect = 2e-17 Identities = 53/131 (40%), Positives = 53/131 (40%), Gaps = 9/131 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GGG GG G G G G GG GGG GGG Sbjct: 154 GCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCG 213 Query: 800 XGGXXGGGG----XGXGGGXXGGGGXGXGGXGXGXGXGGG---GGXXXXG--XGGGXGXX 648 GG GGGG GGG GG G GG G GGG GG G GGG G Sbjct: 214 GGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYA 273 Query: 647 GXGXXGGXXGG 615 G G GG G Sbjct: 274 GGGGGGGGSSG 284 Score = 86.2 bits (204), Expect = 3e-17 Identities = 56/138 (40%), Positives = 56/138 (40%), Gaps = 16/138 (11%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX-------GGGXGGXXX 822 GG G GGG G GG G G GGG G GG GGG GGG GG Sbjct: 158 GGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGS 217 Query: 821 XGGGXXXXGGXXGGG-----GXGXGG----GXXGGGGXGXGGXGXGXGXGGGGGXXXXGX 669 GGG GGG G G GG G GGG G G G GGGGG G Sbjct: 218 SGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGG--YAGG 275 Query: 668 GGGXGXXGXGXXGGXXGG 615 GGG G G G GG Sbjct: 276 GGGGGGSSGGYAGSSGGG 293 Score = 82.2 bits (194), Expect = 5e-16 Identities = 49/121 (40%), Positives = 49/121 (40%), Gaps = 4/121 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXX----GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 GGGGG G GGG GG G G G GG G GG G GG GGG G GGG Sbjct: 61 GGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCG-GGGGGCGG 119 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXG 638 G G GG G G GG G GG GGGGG G G G Sbjct: 120 GGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGG 179 Query: 637 G 635 G Sbjct: 180 G 180 Score = 82.2 bits (194), Expect = 5e-16 Identities = 50/121 (41%), Positives = 50/121 (41%), Gaps = 1/121 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGGG G GGG G GG G G G GG G GGG G GG GGG G GGG G Sbjct: 85 GGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCG--GGGGGGCGGG 142 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 GG G G G G G GG GGGG G G G G Sbjct: 143 SSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGG--SSGGGGYAVAPSGGGGCGGGGSSGGG 200 Query: 628 G 626 G Sbjct: 201 G 201 Score = 80.6 bits (190), Expect = 2e-15 Identities = 50/127 (39%), Positives = 50/127 (39%), Gaps = 6/127 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG--XXXXGGXGGGGXGXXGGXGGGXGXXG----GGXX 824 GGGGG G GGG G GG G G G GG GGGG G GG GGG G GG Sbjct: 92 GGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGS 151 Query: 823 XXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 G G GG G G GG GG GGGG G G Sbjct: 152 SGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGS----SGGGGYAVAPS 207 Query: 643 XGGXXGG 623 GG GG Sbjct: 208 GGGGCGG 214 Score = 79.4 bits (187), Expect = 4e-15 Identities = 47/122 (38%), Positives = 47/122 (38%), Gaps = 10/122 (8%) Frame = -3 Query: 980 GGXXGXGG------GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX----GGGXGG 831 GG G GG G G GGG G G GGG G GG GGG G GG Sbjct: 173 GGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGGGG 232 Query: 830 XXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGX 651 GGG G G G G GGG GG G G GGGGG G G G Sbjct: 233 YATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAGSSGG 292 Query: 650 XG 645 G Sbjct: 293 GG 294 Score = 79.0 bits (186), Expect = 5e-15 Identities = 50/123 (40%), Positives = 50/123 (40%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGX-GXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GGGGG G GGG G G G G G GGGG G GG GGG G GGG G Sbjct: 60 GGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGG---GGG 116 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G GG G G GG G G GG GG GG G G G G Sbjct: 117 CGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSS 176 Query: 631 XGG 623 GG Sbjct: 177 GGG 179 Score = 74.9 bits (176), Expect = 8e-14 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 3/127 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGX-GXGXXXXGGXGGGGXGXXGGXGGGXGXXG--GGXXXXG 815 GGGGG G GGG G GG G GG GGG G GG GG GG G Sbjct: 27 GGGGGGGCGGGCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGGG 86 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G G GG G G GG GGGG G G GG Sbjct: 87 GGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGG 146 Query: 634 XXGGXXG 614 GG G Sbjct: 147 CGGGSSG 153 Score = 74.1 bits (174), Expect = 1e-13 Identities = 50/130 (38%), Positives = 50/130 (38%), Gaps = 6/130 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG-----XXGGXGGGXGXXGGGXXX 821 G GGG G GGG G G G G GGGG GG GGG G GGG Sbjct: 37 GCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGG--G 94 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG-XXXXXXGXGXXXXXG 644 G G GG G G GG G G GG GGGGG G G G Sbjct: 95 GGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGG 154 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 155 CGGGGGGGCG 164 Score = 68.5 bits (160), Expect = 7e-12 Identities = 46/131 (35%), Positives = 46/131 (35%), Gaps = 7/131 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-GGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G G GG GG G GG G GGG Sbjct: 148 GGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPS 207 Query: 808 GXGGXG----XGXGGXXXXXXXXXXXXXGXXGXXGGXXXGG--GGGXXXXXXGXGXXXXX 647 G GG G G GG G GG GG GGG G Sbjct: 208 GGGGCGGGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTG 267 Query: 646 GXGGXXGGXXG 614 G GG GG G Sbjct: 268 GGGGYAGGGGG 278 Score = 54.8 bits (126), Expect = 9e-08 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXGG------GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXX 824 GGGG G GG G G G G G GG GGG G GGG GGG Sbjct: 213 GGGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGY 272 Query: 823 XXGXXGXGGXGXGXGG 776 G G GG G G Sbjct: 273 AGGGGGGGGSSGGYAG 288 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXXXG 815 GG GG G GG G G G GG G GG G GGG G GGG G Sbjct: 210 GGCGGGGSSGG-GGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGG 268 Query: 814 XXGXGGXGXGXGG 776 G G G G GG Sbjct: 269 GGGYAGGGGGGGG 281 Score = 52.4 bits (120), Expect = 5e-07 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 4/125 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG---XGGGXGXXGGGXXXXG 815 GGGG GGG G G G GG GGG GG GGG G G G Sbjct: 229 GGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAG 288 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGG-XXXGGGGGXXXXXXGXGXXXXXGXG 638 G GG GG GGG G G G Sbjct: 289 SSGGGGYSAPAAAPPPPPPPPPPPAPAPVSSGGGYSEQSSGGGGGSSYSGGGEASSSSGG 348 Query: 637 GXXGG 623 G GG Sbjct: 349 GYSGG 353 Score = 47.6 bits (108), Expect = 1e-05 Identities = 44/161 (27%), Positives = 46/161 (28%), Gaps = 27/161 (16%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---------- 819 G GG GG GG G GGG G GG GG G GG Sbjct: 248 GSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAGSSGGGGYSAPAAAPPPPPP 307 Query: 818 ------------GGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGG----G 690 GGG GGG GGG G G G G GG G Sbjct: 308 PPPPPAPAPVSSGGGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSG 367 Query: 689 GXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWS 567 G GGG G G + S S+ S Sbjct: 368 GDSSSSSGGGYSSGGDSSSSSSSSGGYSGGSDSSSSSSSSS 408 Score = 46.8 bits (106), Expect = 2e-05 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 5/123 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXX-----GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G GGG GGG GG G GG GG GG Sbjct: 329 GGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSSGGDSSSSS 388 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G GG GG GG G GG G G G GG Sbjct: 389 SSSGGYSGGSDSSSSSSSSSGGYSSGG-GDAGASSGGESSSAGGYSGSSSSGGEASSGGY 447 Query: 623 XGG 615 GG Sbjct: 448 SGG 450 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/121 (24%), Positives = 30/121 (24%), Gaps = 3/121 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG---GXGGXXXXGGGXXXX 798 G G GGG G GG GGG GG GG G Sbjct: 320 GGGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYS 379 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG GG G GGG GG G G Sbjct: 380 SGGDSSSSSSSSGGYSGGSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSG 439 Query: 617 G 615 G Sbjct: 440 G 440 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/114 (23%), Positives = 27/114 (23%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG GG Sbjct: 339 GGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSS--GGDSSSSSSSSGGYSG 396 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GGG G G GG G G G G Sbjct: 397 GSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSGGEASSGGYSGG 450 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 841 PPPXPPPXPPPXPXP 885 PPP PPP PPP P P Sbjct: 302 PPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPP 783 P PPPP PPP P P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPP 873 P PP PPP PPP P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPP 891 P P PPP PPP P P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 29.9 bits (64), Expect = 2.9 Identities = 29/129 (22%), Positives = 29/129 (22%), Gaps = 5/129 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-----XGGGXGXXGGGXXX 821 GG GGG G G G GGG GG G GGG Sbjct: 321 GGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSS 380 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G G G GG GG G G Sbjct: 381 GGDSSSSSSSSGGYSGGSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSGG 440 Query: 640 GGXXGGXXG 614 GG G Sbjct: 441 EASSGGYSG 449 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXP 795 P PPP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAP 314 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPP 762 P P PP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPP 798 P PPP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 >Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 115 bits (276), Expect = 6e-26 Identities = 60/120 (50%), Positives = 60/120 (50%), Gaps = 2/120 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG G G GGG G GG GGG GGG GG GGG Sbjct: 81 GGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 140 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG--GGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G GG GGGG G GG G G GG GGG GG G G G GG Sbjct: 141 -GGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGG 199 Score = 112 bits (270), Expect = 3e-25 Identities = 60/125 (48%), Positives = 60/125 (48%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG GG G GGG G GGG GG GG GGG Sbjct: 26 GGGGGGGGCGGGCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGG 85 Query: 800 XGGXXGGGGXGXGGG---XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GGGG G GG G G G GG GG GGG G G G G Sbjct: 86 GGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSG 145 Query: 629 GXXGG 615 G GG Sbjct: 146 GCGGG 150 Score = 112 bits (269), Expect = 4e-25 Identities = 59/118 (50%), Positives = 59/118 (50%), Gaps = 2/118 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG GG G GGG G GGG GG GGG GG GGG GG G Sbjct: 56 GGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGG----GGGCG 111 Query: 782 GGGX--GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG GGGG G GG G G GG G G GG G G G GG GG Sbjct: 112 GGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGG 169 Score = 111 bits (266), Expect = 1e-24 Identities = 57/121 (47%), Positives = 57/121 (47%), Gaps = 3/121 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG G G G G GGG GGG GG GG G G Sbjct: 100 GGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGG 159 Query: 800 XGGXXGGGGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GGGG GG G G G GGG GG G G G G Sbjct: 160 GGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSG 219 Query: 629 G 627 G Sbjct: 220 G 220 Score = 109 bits (261), Expect = 4e-24 Identities = 58/127 (45%), Positives = 58/127 (45%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG GG G G GGG G GG GGG GGG GG G Sbjct: 88 GGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGC 147 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG-----XGGGGGXXXXGXGGGXGXXGXGX 636 GG GG G G GGG GGGG G GG G G GGGG G GG G Sbjct: 148 GGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPS 207 Query: 635 XGGXXGG 615 GG GG Sbjct: 208 GGGGCGG 214 Score = 108 bits (260), Expect = 5e-24 Identities = 62/127 (48%), Positives = 62/127 (48%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG 816 GG G GGG G GGG G G G GGG G GG GGG GGG GG G Sbjct: 56 GGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGG-GGGCGGGGGGCGGGG 114 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG GG GGGG G GGG GGGG G GG G G G GG G GG G G G Sbjct: 115 GGCGGGGGGCGGGGGGCGGG--GGGGCG-GGSSGGCGGGSSGGCGGGGGGGCGGGGGGGC 171 Query: 635 XGGXXGG 615 GG GG Sbjct: 172 GGGSSGG 178 Score = 108 bits (260), Expect = 5e-24 Identities = 56/116 (48%), Positives = 56/116 (48%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GGG GG G G GGG G GG GGG GGG GG GGG GG G Sbjct: 80 GGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGG--CGGGGGGCGGGGGG 137 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GG GG G GG G G GGGGG G GG G GG GG Sbjct: 138 GCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGG 193 Score = 101 bits (242), Expect = 8e-22 Identities = 54/121 (44%), Positives = 54/121 (44%), Gaps = 3/121 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG G G G G G GGG GG GGG GG GGG Sbjct: 112 GGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGC 171 Query: 800 XGGXXGGGGXG---XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG GGG GGGG GG G GGGG G GG G G Sbjct: 172 GGGSSGGGGYAVAPSGGGGCGGGG-SSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGG 230 Query: 629 G 627 G Sbjct: 231 G 231 Score = 101 bits (241), Expect = 1e-21 Identities = 60/131 (45%), Positives = 60/131 (45%), Gaps = 13/131 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG G GGG GG G G G G G GGG GGG GGG GG GGG Sbjct: 122 GGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGY 181 Query: 806 XXX---GGXXGGGGXGXGGGXX----GGGGXGXGGXGXGXG----XGGGGGXXXXGXGGG 660 GG GGGG GGG GGGG G GG G G GGGG G GG Sbjct: 182 AVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGGGGYATSGGGGS 241 Query: 659 XGXXGXGXXGG 627 G G GG Sbjct: 242 GGYATGGSSGG 252 Score = 87.0 bits (206), Expect = 2e-17 Identities = 53/131 (40%), Positives = 53/131 (40%), Gaps = 9/131 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GGG GG G G G G GG GGG GGG Sbjct: 154 GCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCG 213 Query: 800 XGGXXGGGG----XGXGGGXXGGGGXGXGGXGXGXGXGGG---GGXXXXG--XGGGXGXX 648 GG GGGG GGG GG G GG G GGG GG G GGG G Sbjct: 214 GGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYA 273 Query: 647 GXGXXGGXXGG 615 G G GG G Sbjct: 274 GGGGGGGGSSG 284 Score = 86.2 bits (204), Expect = 3e-17 Identities = 56/138 (40%), Positives = 56/138 (40%), Gaps = 16/138 (11%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX-------GGGXGGXXX 822 GG G GGG G GG G G GGG G GG GGG GGG GG Sbjct: 158 GGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGS 217 Query: 821 XGGGXXXXGGXXGGG-----GXGXGG----GXXGGGGXGXGGXGXGXGXGGGGGXXXXGX 669 GGG GGG G G GG G GGG G G G GGGGG G Sbjct: 218 SGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGG--YAGG 275 Query: 668 GGGXGXXGXGXXGGXXGG 615 GGG G G G GG Sbjct: 276 GGGGGGSSGGYAGSSGGG 293 Score = 82.2 bits (194), Expect = 5e-16 Identities = 49/121 (40%), Positives = 49/121 (40%), Gaps = 4/121 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXX----GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 GGGGG G GGG GG G G G GG G GG G GG GGG G GGG Sbjct: 61 GGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCG-GGGGGCGG 119 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXG 638 G G GG G G GG G GG GGGGG G G G Sbjct: 120 GGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGG 179 Query: 637 G 635 G Sbjct: 180 G 180 Score = 82.2 bits (194), Expect = 5e-16 Identities = 50/121 (41%), Positives = 50/121 (41%), Gaps = 1/121 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGGG G GGG G GG G G G GG G GGG G GG GGG G GGG G Sbjct: 85 GGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCG--GGGGGGCGGG 142 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 GG G G G G G GG GGGG G G G G Sbjct: 143 SSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGG--SSGGGGYAVAPSGGGGCGGGGSSGGG 200 Query: 628 G 626 G Sbjct: 201 G 201 Score = 80.6 bits (190), Expect = 2e-15 Identities = 50/127 (39%), Positives = 50/127 (39%), Gaps = 6/127 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG--XXXXGGXGGGGXGXXGGXGGGXGXXG----GGXX 824 GGGGG G GGG G GG G G G GG GGGG G GG GGG G GG Sbjct: 92 GGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGS 151 Query: 823 XXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 G G GG G G GG GG GGGG G G Sbjct: 152 SGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGS----SGGGGYAVAPS 207 Query: 643 XGGXXGG 623 GG GG Sbjct: 208 GGGGCGG 214 Score = 79.4 bits (187), Expect = 4e-15 Identities = 47/122 (38%), Positives = 47/122 (38%), Gaps = 10/122 (8%) Frame = -3 Query: 980 GGXXGXGG------GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX----GGGXGG 831 GG G GG G G GGG G G GGG G GG GGG G GG Sbjct: 173 GGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYASAPSGGGG 232 Query: 830 XXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGX 651 GGG G G G G GGG GG G G GGGGG G G G Sbjct: 233 YATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAGSSGG 292 Query: 650 XG 645 G Sbjct: 293 GG 294 Score = 79.0 bits (186), Expect = 5e-15 Identities = 50/123 (40%), Positives = 50/123 (40%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGX-GXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GGGGG G GGG G G G G G GGGG G GG GGG G GGG G Sbjct: 60 GGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGG---GGG 116 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G GG G G GG G G GG GG GG G G G G Sbjct: 117 CGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGGCGGGGGGGCGGGGGGGCGGGSS 176 Query: 631 XGG 623 GG Sbjct: 177 GGG 179 Score = 74.9 bits (176), Expect = 8e-14 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 3/127 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGX-GXGXXXXGGXGGGGXGXXGGXGGGXGXXG--GGXXXXG 815 GGGGG G GGG G GG G GG GGG G GG GG GG G Sbjct: 27 GGGGGGGCGGGCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGGG 86 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G G GG G G GG GGGG G G GG Sbjct: 87 GGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGG 146 Query: 634 XXGGXXG 614 GG G Sbjct: 147 CGGGSSG 153 Score = 74.1 bits (174), Expect = 1e-13 Identities = 50/130 (38%), Positives = 50/130 (38%), Gaps = 6/130 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG-----XXGGXGGGXGXXGGGXXX 821 G GGG G GGG G G G G GGGG GG GGG G GGG Sbjct: 37 GCGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGGGGCAPPPAPCGGGCGGGGGGCGGG--G 94 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG-XXXXXXGXGXXXXXG 644 G G GG G G GG G G GG GGGGG G G G Sbjct: 95 GGCGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGSSGGCGGGSSGG 154 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 155 CGGGGGGGCG 164 Score = 68.5 bits (160), Expect = 7e-12 Identities = 46/131 (35%), Positives = 46/131 (35%), Gaps = 7/131 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-GGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G G GG GG G GG G GGG Sbjct: 148 GGGSSGGCGGGGGGGCGGGGGGGCGGGSSGGGGYAVAPSGGGGCGGGGSSGGGGYAVAPS 207 Query: 808 GXGGXG----XGXGGXXXXXXXXXXXXXGXXGXXGGXXXGG--GGGXXXXXXGXGXXXXX 647 G GG G G GG G GG GG GGG G Sbjct: 208 GGGGCGGGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTG 267 Query: 646 GXGGXXGGXXG 614 G GG GG G Sbjct: 268 GGGGYAGGGGG 278 Score = 54.8 bits (126), Expect = 9e-08 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXGG------GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXX 824 GGGG G GG G G G G G GG GGG G GGG GGG Sbjct: 213 GGGGSSGGGGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGY 272 Query: 823 XXGXXGXGGXGXGXGG 776 G G GG G G Sbjct: 273 AGGGGGGGGSSGGYAG 288 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG---XGXXGGGXXXXG 815 GG GG G GG G G G GG G GG G GGG G GGG G Sbjct: 210 GGCGGGGSSGG-GGYASAPSGGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGG 268 Query: 814 XXGXGGXGXGXGG 776 G G G G GG Sbjct: 269 GGGYAGGGGGGGG 281 Score = 52.4 bits (120), Expect = 5e-07 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 4/125 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG---XGGGXGXXGGGXXXXG 815 GGGG GGG G G G GG GGG GG GGG G G G Sbjct: 229 GGGGYATSGGGGSGGYATGGSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAG 288 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGG-XXXGGGGGXXXXXXGXGXXXXXGXG 638 G GG GG GGG G G G Sbjct: 289 SSGGGGYSAPAAAPPPPPPPPPPPAPAPVSSGGGYSEQSSGGGGGSSYSGGGEASSSSGG 348 Query: 637 GXXGG 623 G GG Sbjct: 349 GYSGG 353 Score = 47.6 bits (108), Expect = 1e-05 Identities = 44/161 (27%), Positives = 46/161 (28%), Gaps = 27/161 (16%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---------- 819 G GG GG GG G GGG G GG GG G GG Sbjct: 248 GSSGGGYSSGGSSGGGYSTGGGGGYAGGGGGGGGSSGGYAGSSGGGGYSAPAAAPPPPPP 307 Query: 818 ------------GGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGG----G 690 GGG GGG GGG G G G G GG G Sbjct: 308 PPPPPAPAPVSSGGGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSG 367 Query: 689 GXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWS 567 G GGG G G + S S+ S Sbjct: 368 GDSSSSSGGGYSSGGDSSSSSSSSGGYSGGSDSSSSSSSSS 408 Score = 46.8 bits (106), Expect = 2e-05 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 5/123 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXX-----GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G GGG GGG GG G GG GG GG Sbjct: 329 GGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSSGGDSSSSS 388 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G GG GG GG G GG G G G GG Sbjct: 389 SSSGGYSGGSDSSSSSSSSSGGYSSGG-GDAGASSGGESSSAGGYSGSSSSGGEASSGGY 447 Query: 623 XGG 615 GG Sbjct: 448 SGG 450 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/121 (24%), Positives = 30/121 (24%), Gaps = 3/121 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG---GXGGXXXXGGGXXXX 798 G G GGG G GG GGG GG GG G Sbjct: 320 GGGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYS 379 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG GG G GGG GG G G Sbjct: 380 SGGDSSSSSSSSGGYSGGSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSG 439 Query: 617 G 615 G Sbjct: 440 G 440 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/114 (23%), Positives = 27/114 (23%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG GG GG Sbjct: 339 GGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSS--GGDSSSSSSSSGGYSG 396 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GGG G G GG G G G G Sbjct: 397 GSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSGGEASSGGYSGG 450 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 841 PPPXPPPXPPPXPXP 885 PPP PPP PPP P P Sbjct: 302 PPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPP 783 P PPPP PPP P P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPP 873 P PP PPP PPP P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPP 891 P P PPP PPP P P P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 29.9 bits (64), Expect = 2.9 Identities = 29/129 (22%), Positives = 29/129 (22%), Gaps = 5/129 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-----XGGGXGXXGGGXXX 821 GG GGG G G G GGG GG G GGG Sbjct: 321 GGYSEQSSGGGGGSSYSGGGEASSSSGGGYSGGGESSSSGGSSYSSGGDSSSSSGGGYSS 380 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G G G GG GG G G Sbjct: 381 GGDSSSSSSSSGGYSGGSDSSSSSSSSSGGYSSGGGDAGASSGGESSSAGGYSGSSSSGG 440 Query: 640 GGXXGGXXG 614 GG G Sbjct: 441 EASSGGYSG 449 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXP 795 P PPP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAP 314 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPP 762 P P PP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPP 798 P PPP P PPPP P Sbjct: 298 PAAAPPPPPPPPPPPAPAP 316 >U58755-7|AAB00696.1| 136|Caenorhabditis elegans Hypothetical protein C34D4.11 protein. Length = 136 Score = 99.1 bits (236), Expect = 4e-21 Identities = 53/103 (51%), Positives = 53/103 (51%), Gaps = 3/103 (2%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG--GXG 768 GG GG G G GGG G G GG G G GGG GG GG GG GGG G G Sbjct: 37 GGRSGGWGRPGWG---GGGPGWGRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGG 93 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GGGG G GG G G G GGGGG G G G G G G Sbjct: 94 RGGGGGGGGGRGGGGGGRGGGGGGGGGRGGGGGGRGGGGRGRG 136 Score = 93.9 bits (223), Expect = 2e-19 Identities = 44/85 (51%), Positives = 44/85 (51%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GGG GG G G GG G G G GG GGG GG GGG Sbjct: 52 GPGWGRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGGGGGGGGGRGGGGGGR 111 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG 726 GG GGGG G GGG GGGG G G Sbjct: 112 GGGGGGGGGRGGGGGGRGGGGRGRG 136 Score = 85.8 bits (203), Expect = 4e-17 Identities = 45/90 (50%), Positives = 45/90 (50%), Gaps = 2/90 (2%) Frame = -3 Query: 878 GXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXG 705 G GG G G GGG G GGG GG GG G GGG GG GG G GG G G G Sbjct: 38 GRSGGWGRPGWGGGGPGWGRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGGG 97 Query: 704 XGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGGG G G G G G G GG GG Sbjct: 98 GGGGGGRGGGGGGRGGGGGGGGGRGGGGGG 127 Score = 85.0 bits (201), Expect = 7e-17 Identities = 44/92 (47%), Positives = 44/92 (47%), Gaps = 1/92 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG-GXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G GGG G G GG GG G G GGGG G G G GG G GG G G Sbjct: 41 GGWGRPGWGGGGPGWGRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGGGGGG 100 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG G GGG G G G G GG Sbjct: 101 GGGRGGGGGGRGGGGGGGGGRGGGGGGRGGGG 132 Score = 72.5 bits (170), Expect = 4e-13 Identities = 36/71 (50%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGG-XGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGG G G GGG G GG G G G GG GG G G GG G G G GGG G Sbjct: 50 GGGPGWGRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGGGGGGGGGRGGGGG 109 Query: 808 GXGGXGXGXGG 776 G GG G G GG Sbjct: 110 GRGGGGGGGGG 120 Score = 72.1 bits (169), Expect = 6e-13 Identities = 35/69 (50%), Positives = 35/69 (50%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGGG G GGG G G G G GG G GG G GG GGG G GGG G G Sbjct: 58 GGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGR-GGGGGGGGGRGGGGGGRGGGGG 116 Query: 802 GGXGXGXGG 776 GG G G GG Sbjct: 117 GGGGRGGGG 125 Score = 71.3 bits (167), Expect = 1e-12 Identities = 34/70 (48%), Positives = 34/70 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG G G G G G G G GG GGG G GG GGG G GGG G G Sbjct: 63 GWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGGGGGGGGGRGGGGGGRGGGGGGGGGRG 122 Query: 805 XGGXGXGXGG 776 GG G G GG Sbjct: 123 GGGGGRGGGG 132 Score = 68.9 bits (161), Expect = 5e-12 Identities = 36/70 (51%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGX-GGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G G GG GGGG G GG GGG G GGG G Sbjct: 69 GGGWGNNGGGGNWGGNGGGGNGGGGRGGGGGGGGGRGGGGGGRGGGGG--GGGGRGGGGG 126 Query: 808 GXGGXGXGXG 779 G GG G G G Sbjct: 127 GRGGGGRGRG 136 Score = 65.7 bits (153), Expect = 5e-11 Identities = 43/108 (39%), Positives = 43/108 (39%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G GGG G G G G GG GGG G GG G G GGG G G Sbjct: 41 GGWGRPGWGGGGPGW----GRGGGGSGWGGGRGGGWGNNGGGGNWGGNGGGGNGGGGRGG 96 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXG 662 GG G G GG G G GG GGGGG G G Sbjct: 97 GGGGGGGRGG--------GGGGRGGGGGGGGGRGGGGGGRGGGGRGRG 136 >AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical protein Y43F8C.20 protein. Length = 193 Score = 97.1 bits (231), Expect = 2e-20 Identities = 56/128 (43%), Positives = 56/128 (43%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGG 813 GG GGG G GGG GG G G GG G G GG GG G GG GG Sbjct: 47 GGWGNNGGGGWGRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNGGGGRGGGGRGDWGG 106 Query: 812 GXXXXGGXXGGGGXGXG--GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GGGG G GG GGGG G GG G G G G G GG G G G Sbjct: 107 NNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGGGGRG 166 Query: 638 XXGGXXGG 615 GG GG Sbjct: 167 GGGGRGGG 174 Score = 96.3 bits (229), Expect = 3e-20 Identities = 54/124 (43%), Positives = 54/124 (43%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG GG G G GGG G G GGG GGG G GGG Sbjct: 23 GGWGGGPGRWGGWGGNRWGGGGGPGGWGNNGGG---GWGRGGGRGGGDWGGNNGGGGNWG 79 Query: 800 XGGXXGGGGXGXGGGXXGGGGXG--XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G GGG GGGG G G G G GGGG G GG G G G GG Sbjct: 80 GNGGGRGDWGGNGGGGRGGGGRGDWGGNNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGG 139 Query: 626 XXGG 615 GG Sbjct: 140 GRGG 143 Score = 95.5 bits (227), Expect = 5e-20 Identities = 54/123 (43%), Positives = 54/123 (43%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G G G G G GG G GGG GGG G GG GGG Sbjct: 58 GRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNG-GGGRGGGGRGDWGGNNNGGGGNWG 116 Query: 800 XGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GG G GG GG GG G GG G G GGG GGG G G G GG Sbjct: 117 GGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGGGGRG-GGGGRGGGG 175 Query: 623 XGG 615 GG Sbjct: 176 GGG 178 Score = 95.1 bits (226), Expect = 7e-20 Identities = 55/127 (43%), Positives = 55/127 (43%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGG 810 GG G GG G G GG GG G GG G GG GGG G GG GG GGG Sbjct: 41 GGGGGPGGWGNNGGGGWGRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNGGGGRGGGG 100 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGX--GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG GGG GGG GG G GG G G G GG GG G G G Sbjct: 101 RGDWGGNNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGN 160 Query: 635 XGGXXGG 615 GG GG Sbjct: 161 GGGGRGG 167 Score = 95.1 bits (226), Expect = 7e-20 Identities = 53/117 (45%), Positives = 53/117 (45%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GGG G G G GGG G GG G GG GG GG Sbjct: 69 GGNNGGGGNWGGNGGGR-GDWGGNGGGGRGGGGRGDWGGNNNGGGGNWGGGGNNDGGW-- 125 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGGG G GGG GG G G G G GG GG G GGG G G G G Sbjct: 126 -GGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGG-GGRGGGGGRGGGGGGGAG 180 Score = 93.9 bits (223), Expect = 2e-19 Identities = 51/124 (41%), Positives = 51/124 (41%), Gaps = 2/124 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG G GG GG G G G GGG GG G G G GGG Sbjct: 54 GGGWGRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNGGGGRGGGGRGDWGGNNNGGGG 113 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G GGG G G G G G G G G GG G G G GG Sbjct: 114 NWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGGGGRGGGGGRGG 173 Query: 626 XXGG 615 GG Sbjct: 174 GGGG 177 Score = 90.6 bits (215), Expect = 1e-18 Identities = 51/123 (41%), Positives = 51/123 (41%), Gaps = 1/123 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G GGG G G GG G G GG GGG GG GGG G GGG Sbjct: 37 GNRWGGGGGPGGWGNNGGGGWGRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNGGGGR 96 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 GG GG GGG GGG G G G GGGGG G GG G G GG Sbjct: 97 GGGGRGDWGGNNNGGGGNWGGGGNNDG-GWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGG 155 Query: 623 XGG 615 G Sbjct: 156 DWG 158 Score = 89.0 bits (211), Expect = 4e-18 Identities = 50/117 (42%), Positives = 50/117 (42%), Gaps = 1/117 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG GGG GG G G GG GG GG GGG G GGG Sbjct: 30 GRWGGWGGNRWGGGGGPGGWGNNGGGGWGRGGGRGGGDWGGNNGGG-GNWGGNGGGRGDW 88 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGG-XGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGG G G G GG G GG G G GG G G GGG G G G G Sbjct: 89 GGNGGGGRGGGGRGDWGGNNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDG 145 Score = 71.3 bits (167), Expect = 1e-12 Identities = 46/130 (35%), Positives = 46/130 (35%), Gaps = 6/130 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG GGG G G G GG GGG G G GG G GGG G G Sbjct: 33 GGWGGNRWGGGGGPGGWGNNGGGGWGRGGGRGGGDWGGNNGGGGNWGGNGGGRGDWGGNG 92 Query: 805 XGGXGXG----XGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG-- 644 GG G G GG G GG GGGGG G G Sbjct: 93 GGGRGGGGRGDWGGNNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSN 152 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 153 GGGDWGGNGG 162 Score = 69.3 bits (162), Expect = 4e-12 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 4/127 (3%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGG--XGXGXGXXXXGGXGGGGXGXXGGXGGG--XGXXGGGXXXXG 815 G GG G G G G GG G G G G GGGG G GG GGG G GGG G Sbjct: 21 GPGGWGGGPGRWGGWGGNRWGGGGGPGGWGNNGGGGWGRGGGRGGGDWGGNNGGGGNWGG 80 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G G G GG G GG GGGG G G G GG Sbjct: 81 NGGGRGDWGGNGGGGRGGGGRGDWGGNNNG--GGGNWGGGGN---NDGGWGGNNGGGGGG 135 Query: 634 XXGGXXG 614 GG G Sbjct: 136 RGGGGRG 142 Score = 63.3 bits (147), Expect = 3e-10 Identities = 32/71 (45%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGX-GXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGG G GG G GG G G G GG GG G G G GGG GG G Sbjct: 110 GGGGNWGGGGNNDGGWGGNNGGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGGGGRGGGG 169 Query: 808 GXGGXGXGXGG 776 G GG G G G Sbjct: 170 GRGGGGGGGAG 180 Score = 57.2 bits (132), Expect = 2e-08 Identities = 40/105 (38%), Positives = 40/105 (38%), Gaps = 6/105 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGX------GGGGXGXXGGXGGGXGXXGGGXX 824 GG GG G GGG G GG G G GG GG G GG GGG G G G Sbjct: 89 GGNGGGGRGGGGRGDWGGNNNGGGGNWGGGGNNDGGWGGNNGGGGGGRGGG-GRGGDGRG 147 Query: 823 XXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G GG G GG GGGGG Sbjct: 148 PPGSNGGGDWGGNGGG--------------GRGGGGGRGGGGGGG 178 Score = 55.2 bits (127), Expect = 7e-08 Identities = 27/60 (45%), Positives = 27/60 (45%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG GGG G G G GG GGGG G GG GGG G G G G Sbjct: 130 GGGGGGRGGGGRGGDGRGPPGSNGGGDWGGNGGGGRGGGGGRGGGGGGGAGERIAEGVLG 189 >U80023-1|AAG24037.1| 180|Caenorhabditis elegans Hypothetical protein F07C4.7 protein. Length = 180 Score = 94.3 bits (224), Expect = 1e-19 Identities = 51/122 (41%), Positives = 51/122 (41%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G GGG G G G GG G GG GGG GGG GG G Sbjct: 35 GGPGPRGPGEWNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNGGL 94 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GG G G GGG G GG G G G G G GGG G G G GG Sbjct: 95 RGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGGGR 154 Query: 620 GG 615 GG Sbjct: 155 GG 156 Score = 88.6 bits (210), Expect = 6e-18 Identities = 48/112 (42%), Positives = 48/112 (42%), Gaps = 2/112 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GG G G GG G G GGG G G G GG G G GGG GG Sbjct: 49 GGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNGGLRGGNGGGRGGNGGF 108 Query: 788 X--GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G GGG G GG G G G G GG GG GGG G G G Sbjct: 109 DDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGGGRGGNGGG 160 Score = 87.4 bits (207), Expect = 1e-17 Identities = 51/127 (40%), Positives = 51/127 (40%), Gaps = 6/127 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG--GXX 804 G G G G G GG GG G G GG G G G G GG GG G Sbjct: 18 GQWGPGFGGPGFGGPGSGGPGPRGPGEWNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGGG 77 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXG----XGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG G GG G GG GG G G GG G G G GG GG G G G G Sbjct: 78 RGGGRGGNGGFGDNGGLRGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGG 137 Query: 635 XGGXXGG 615 GG GG Sbjct: 138 NGGGRGG 144 Score = 85.8 bits (203), Expect = 4e-17 Identities = 49/112 (43%), Positives = 49/112 (43%), Gaps = 5/112 (4%) Frame = -3 Query: 980 GGXXGXGG--GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GG G GGG G G G G G G G GG GG GG GG Sbjct: 49 GGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNGGLRGGNGGGRGGNGGF 108 Query: 806 XXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGGGG--GXXXXGXGGG 660 GG GG G G GG G G G G GG G G G GGG G G GGG Sbjct: 109 DDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGGGRGGNGGG 160 Score = 59.3 bits (137), Expect = 4e-09 Identities = 31/70 (44%), Positives = 31/70 (44%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GG G GG G G G G GG G G GG G GGG G G Sbjct: 83 GGNGGFGDNGGLRGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNG-GG 141 Query: 805 XGGXGXGXGG 776 GG G G G Sbjct: 142 RGGNGGGNNG 151 Score = 58.8 bits (136), Expect = 5e-09 Identities = 38/101 (37%), Positives = 38/101 (37%), Gaps = 3/101 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGX-GXGXXXXGGXGG--GGXGXXGGXGGGXGXXGGGXXXXGX 812 GGG G GG GG G G G GG GG GG G G GG G GGG G Sbjct: 48 GGGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNGGLRGGNGGGRGGNGG 107 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G GG G GGG Sbjct: 108 FDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGG 148 Score = 58.4 bits (135), Expect = 7e-09 Identities = 42/127 (33%), Positives = 42/127 (33%), Gaps = 4/127 (3%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGX-GGGXGXXGGGXXXXGXXG 806 G GG G G GG G G GGGG GG GGG G GG G G Sbjct: 33 GSGGPGPRGPGEWNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNG 92 Query: 805 --XGGXGXGXGGXXXXXXXXXXXXXGXXGXXG-GXXXGGGGGXXXXXXGXGXXXXXGXGG 635 GG G G GG G G G GGG G G GG Sbjct: 93 GLRGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGG 152 Query: 634 XXGGXXG 614 GG G Sbjct: 153 GRGGNGG 159 Score = 58.0 bits (134), Expect = 1e-08 Identities = 43/119 (36%), Positives = 43/119 (36%), Gaps = 2/119 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGX--GXXGGXGGGXGXXGGGXXXXGX 812 GG G GGG GG G GG GG G G GG GGG G GG G Sbjct: 55 GGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGGFGDNGGLRGGNGGGRGGNGGFDDNGG- 113 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G G GG G G GG G GGG G G GG Sbjct: 114 -GRGGNGGGRGG------------TGGFGDNGGGRGGNGGGRGGNGGGNNGGGRGGNGG 159 Score = 54.8 bits (126), Expect = 9e-08 Identities = 43/125 (34%), Positives = 43/125 (34%), Gaps = 2/125 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G G G G G G G GG GG G G GG G G G G G Sbjct: 21 GPGFGGPGFGGPGSGGPGPRGPGEWNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGG--GR 78 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGG-GGXXXXXXGXGXXXXXGXG-GXX 629 GG G GG G G G GGG GG G G G G G Sbjct: 79 GGGRGGNGGFGDNGGLRGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGN 138 Query: 628 GGXXG 614 GG G Sbjct: 139 GGGRG 143 Score = 54.8 bits (126), Expect = 9e-08 Identities = 43/127 (33%), Positives = 43/127 (33%), Gaps = 4/127 (3%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG--GGGXGXXGGXGG--GXGXXGGGXXXXG 815 G GG G GG G G G G GG G GG G G GG G G GG G Sbjct: 23 GFGGPGFGGPGSGGPGPRGPGE-WNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGG 81 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G GG G GG GGG G G GG Sbjct: 82 RGGNGGFGDN-GGLRGGNGGGRGGNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGG 140 Query: 634 XXGGXXG 614 GG G Sbjct: 141 GRGGNGG 147 Score = 54.8 bits (126), Expect = 9e-08 Identities = 44/127 (34%), Positives = 44/127 (34%), Gaps = 4/127 (3%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG---GGXGXXGGXGGGXGXXGGGXXXXGX 812 G GG G GG G G G GG G GG G G G G GGG G Sbjct: 28 GFGGPGSGGPGPRGPGEWNNGGGRGGFGGNNGWNNGGGGFNGNGGFNGGGRGGGRGGNGG 87 Query: 811 XG-XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G GG G G GG GG GG G G G GG Sbjct: 88 FGDNGGLRGGNGGGRGGNGGFDDNGGGRGGNGGG--RGGTGGFGDNGGGRG-GNGGGRGG 144 Query: 634 XXGGXXG 614 GG G Sbjct: 145 NGGGNNG 151 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GG GGG G GG G G GG GG G GG GGG G G G Sbjct: 104 GNGGFDDNGGGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGGGRGGNGGG 160 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G GGG G GG G G G GG G G GGG GG GG G Sbjct: 113 GGRGGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGG--GNNGGGRGGNGGGRPQISAG 167 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG GG G G G GG G G G GG G GG GGG G Sbjct: 116 GGNGGGRGGTGGFGDNGGGRGGNGGGRGGNGGGNNGGGRGGNGGGRPQISAG 167 >U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 7 protein. Length = 401 Score = 92.7 bits (220), Expect = 4e-19 Identities = 50/128 (39%), Positives = 50/128 (39%), Gaps = 10/128 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP---PXPXPP-- 780 PP PP P P P PPPPP P P P P PPP P P P PP Sbjct: 27 PPPPPPPKPAPYVEQSAQ-PQQTAPPPPPAPYPQQAVPAPAPPPAPYPQHAVPAPAPPLA 85 Query: 781 --PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP---XPXPPPXXXXXPXXPXPPXXPPPX 945 P P PP P P PPP P P P P P P P PP PPP Sbjct: 86 SYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYPPPP 145 Query: 946 PXXPPPXP 969 P PPP P Sbjct: 146 PHYPPPPP 153 Score = 74.5 bits (175), Expect = 1e-13 Identities = 46/132 (34%), Positives = 46/132 (34%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP----PPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P PP P P P P P P P P P P P P P P P P P Sbjct: 63 PAPAPPPAPYPQHAVPAPAPPLASYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAV 122 Query: 784 PXXPPXXXXPPPXXXXPPXPP--PXPPPXPPPXPXPPPXXXXXPXXPXPP----XXPPPX 945 P P PPP PP PP P PPP PP P P P P PPP Sbjct: 123 PAPAPYQQQPPP----PPPPPHYPPPPPHYPPPPPAPHSAYIDHSAPRPAYIEHSAPPPQ 178 Query: 946 PXXPPPXPXXPP 981 P P P P Sbjct: 179 PQYPQQQPPQYP 190 Score = 73.7 bits (173), Expect = 2e-13 Identities = 47/136 (34%), Positives = 47/136 (34%), Gaps = 18/136 (13%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP----PPXPXPXPXPPXPXP-----PPPXXPPPXPXPP 780 P P P PPP P P P P PP P P P PPP P P Sbjct: 15 PESAPAATTPQPPPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPAPYPQ 74 Query: 781 ---PPXXPPXXXXPP---PXXXXPPXPPP---XPPPXPPPXPXPPPXXXXXPXXPXPPXX 933 P PP P P PP P P P P PPP P P P Sbjct: 75 HAVPAPAPPLASYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPP 134 Query: 934 PPPXPXXPPPXPXXPP 981 PPP P PPP P PP Sbjct: 135 PPPPPHYPPPPPHYPP 150 Score = 61.3 bits (142), Expect = 1e-09 Identities = 40/129 (31%), Positives = 40/129 (31%), Gaps = 7/129 (5%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP P P P PPPPP P P P P Sbjct: 27 PPPPPPPKPAPYVEQSAQP--QQTAPPPPPAPYPQQAVPAPAPPPAPYPQHAVPAPAPPL 84 Query: 792 PXPPXPXXPXXXXPP---PXXPXPPPXPPXXPXPP---PPXPPXXXXPXPXPXPPXXPXX 953 P P PP P P P PP P P P P P P P PP P Sbjct: 85 ASYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYPPP 144 Query: 954 PPPXPXPPP 980 PP P PPP Sbjct: 145 PPHYPPPPP 153 Score = 60.9 bits (141), Expect = 1e-09 Identities = 38/127 (29%), Positives = 38/127 (29%), Gaps = 4/127 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXP--PXP 788 P PP P P P P PP P P P Sbjct: 19 PAATTPQPPPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPAPYPQHAVP 78 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXP-PXXXXPXPXPXPPXXPXXPPP 962 P PP P P P P P P P PPP P P P P P P PPP Sbjct: 79 APAPPLASYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPP 138 Query: 963 XPXPPPP 983 PPPP Sbjct: 139 PHYPPPP 145 Score = 34.7 bits (76), Expect = 0.10 Identities = 31/126 (24%), Positives = 31/126 (24%), Gaps = 11/126 (8%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXX---PXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PPP P P PP P Sbjct: 88 PQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYPPPPPH 147 Query: 795 XPPXPXXPXXXX-----PPPXX---PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P PPP P PP P P Sbjct: 148 YPPPPPAPHSAYIDHSAPRPAYIEHSAPPPQPQYPQQQPPQYPQQRQQHSYNAGPRTYHE 207 Query: 951 XPPPXP 968 P P P Sbjct: 208 EPQPYP 213 >Z54238-1|CAA90992.2| 281|Caenorhabditis elegans Hypothetical protein T28C6.1 protein. Length = 281 Score = 90.2 bits (214), Expect = 2e-18 Identities = 51/142 (35%), Positives = 52/142 (36%), Gaps = 2/142 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX--GGGX 807 GG G GG G G GG G GG G GG GG GG GG G G Sbjct: 73 GGRGGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQ 132 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G G GG G GG G G GG GG G GG G G GG Sbjct: 133 GGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGG 192 Query: 626 XXGGXXXXXXXAXSXRSTWSXQ 561 GG + W Q Sbjct: 193 NQGGGGGRGGNQGGEQGGWGGQ 214 Score = 86.2 bits (204), Expect = 3e-17 Identities = 49/124 (39%), Positives = 49/124 (39%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG G GGG GG G G GG G G G G GG G GG Sbjct: 51 GTGGGRGGGRGGSGGGRGGGSG--GGRGGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGS 108 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXG---XGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GG G GG G G GG G G GG G G GG G G G G Sbjct: 109 QGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQG 168 Query: 629 GXXG 618 G G Sbjct: 169 GWGG 172 Score = 84.2 bits (199), Expect = 1e-16 Identities = 49/118 (41%), Positives = 49/118 (41%), Gaps = 1/118 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G GG G GG G GG G G G G GG GGG GG GG GG Sbjct: 146 GGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGRGGNQG 205 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G GG G G GG GG G G G G G GG G GGG G G G Sbjct: 206 GEQGGWGGQG-GSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGGGRGGGWGGWG 262 Score = 83.8 bits (198), Expect = 2e-16 Identities = 48/126 (38%), Positives = 48/126 (38%), Gaps = 4/126 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG GG G G G G GG GG GG GG GG Sbjct: 58 GGRGGSGGGRGGGSGGGRGGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGSQ--GGSQGG 115 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG----GGXGXXGXGXX 633 G GG G GG G GG G GG G G G GG G G Sbjct: 116 SSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQD 175 Query: 632 GGXXGG 615 GG GG Sbjct: 176 GGSQGG 181 Score = 83.8 bits (198), Expect = 2e-16 Identities = 51/142 (35%), Positives = 52/142 (36%), Gaps = 2/142 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXX 804 GG G GG G G G G GG G G GG GG GG GG Sbjct: 91 GGWGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGG 150 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGG-XGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GGGG G GG G GG GG G G GGG G GGG G G GG Sbjct: 151 SQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQGG 210 Query: 626 XXGGXXXXXXXAXSXRSTWSXQ 561 G + W Q Sbjct: 211 WGGQGGSQGGSQGGSQGGWGNQ 232 Score = 83.4 bits (197), Expect = 2e-16 Identities = 50/118 (42%), Positives = 50/118 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GG GG G GGG G G GGG GG GG GG Sbjct: 158 GGGRGGSGGQGGWGGSQDGG-SQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQ---GGWGG 213 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG GG G GG GG GG G G GG GG G GGG G G G G Sbjct: 214 QGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGG---GGRGGGWGGWGRGSRWG 268 Score = 82.2 bits (194), Expect = 5e-16 Identities = 47/122 (38%), Positives = 47/122 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G GG GG G GG GGG GG G G G GG Sbjct: 122 GSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGG 181 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GGG G GG G GG G G G GG G G GG G G G GG Sbjct: 182 WGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQG-GQQGGGR 240 Query: 620 GG 615 GG Sbjct: 241 GG 242 Score = 81.8 bits (193), Expect = 7e-16 Identities = 52/128 (40%), Positives = 52/128 (40%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG--GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GG 810 GG G GG GG G GG G GG G GG GG GG GG G GG Sbjct: 133 GGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGG 192 Query: 809 XXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXG 639 GG GG G GG G GG G G G G GG G GG G G G G Sbjct: 193 NQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGG 252 Query: 638 XXGGXXGG 615 GG GG Sbjct: 253 GRGGGWGG 260 Score = 80.6 bits (190), Expect = 2e-15 Identities = 46/119 (38%), Positives = 46/119 (38%), Gaps = 3/119 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GG G G G GG G G G GGG GGG GG GG GG G G Sbjct: 24 GGSDAGSGIGSSGGWGGSDASAGASAG-GTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAG 82 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG---GXGXXGXGXXGGXXGG 615 GG G G G GG G G G GG G G GG G G GG GG Sbjct: 83 AGGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGG 141 Score = 80.2 bits (189), Expect = 2e-15 Identities = 49/126 (38%), Positives = 49/126 (38%), Gaps = 4/126 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGG- 810 G G GG G GG G GG G GG GGG GG GG GG Sbjct: 115 GSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQ 174 Query: 809 -XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G G G GG GGGG G G G GG GG GG G G G Sbjct: 175 DGGSQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQG--GWGNQ 232 Query: 632 GGXXGG 615 GG GG Sbjct: 233 GGQQGG 238 Score = 77.4 bits (182), Expect = 1e-14 Identities = 50/128 (39%), Positives = 50/128 (39%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG-XX 804 G G G GGG GG G G G G G GGG GG G G GG GG Sbjct: 40 GSDASAGASAGGTGGGRGGGRGGSGG----GRGGGSGGGRGGSGGAGAGGSGSGSGGWGG 95 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXG---XGXGXGGGGG--XXXXGXGGGXGXXGXG 639 GG GG G GG GG G GG G G GG GG GG G G Sbjct: 96 QDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQ 155 Query: 638 XXGGXXGG 615 GG GG Sbjct: 156 NGGGGRGG 163 Score = 76.6 bits (180), Expect = 3e-14 Identities = 46/117 (39%), Positives = 46/117 (39%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G G GG G GGG G GG GG GG G GG Sbjct: 165 GGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGG 224 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G GGG GG G GG G G G GGG G G G G G G Sbjct: 225 SQGGWGNQGGQQGGGR--GGQQGPGGWG-GGGRGGGWGGWGRGSRWGWGRPSWGGWG 278 Score = 76.2 bits (179), Expect = 3e-14 Identities = 48/120 (40%), Positives = 48/120 (40%), Gaps = 2/120 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG-GGXGGGXGGGXGGXXXXGGGXX 804 G G G G G GG G GGG G G GG GGG GGG GG GG Sbjct: 25 GSDAGSGIGSSGGWGGSDASAGASAGGT--GGGRGGGRGGSGGGRGGGSGGGRGGSGGAG 82 Query: 803 XXGGXXGGGG-XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GG G GG GG G G G GG GG G G G G G GG Sbjct: 83 AGGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWG-GQQGG 141 Score = 75.4 bits (177), Expect = 6e-14 Identities = 50/140 (35%), Positives = 50/140 (35%), Gaps = 3/140 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG G G GG G GGG G GG GG G GG GG Sbjct: 129 GSGQGGWGGQQG-GNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNG 187 Query: 800 XG-GXXGGGGXGXGGGXXG--GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GGG G GG G GG G GG G G GG G G G G G Sbjct: 188 GGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPG 247 Query: 629 GXXGGXXXXXXXAXSXRSTW 570 G GG S W Sbjct: 248 GWGGGGRGGGWGGWGRGSRW 267 Score = 74.1 bits (174), Expect = 1e-13 Identities = 46/110 (41%), Positives = 46/110 (41%), Gaps = 2/110 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GG G GG G G GG GG GGG GG GG G G G Sbjct: 19 GDGLFGG-SDAGSGIGSSGGWGGSDASAGASAGGTGGGR--GGGR---GGSGGGRGGGSG 72 Query: 761 GGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GG G GG G G G GG GG G GG G G GG G Sbjct: 73 GGRGGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSSGGWGG 122 Score = 70.5 bits (165), Expect = 2e-12 Identities = 45/126 (35%), Positives = 45/126 (35%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXX 801 G G GG G GG G G G G GGG GG G G G G G Sbjct: 33 GSSGGWGGSDASAGASAGGTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAGAGGSGSGSGG 92 Query: 800 XGGXXGGGGXGXGGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XGXX 633 GG GG G GG GG GG G G G G G GG G G Sbjct: 93 WGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQ 152 Query: 632 GGXXGG 615 GG GG Sbjct: 153 GGQNGG 158 Score = 66.5 bits (155), Expect = 3e-11 Identities = 40/100 (40%), Positives = 40/100 (40%), Gaps = 2/100 (2%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G G GG GG GG GG GGG G GGG GG G G Sbjct: 19 GDGLFGGSDAGSGIGSSGGWGGSDASAGASAGGT---GGGRGGGRGGSGGGRGGGSGGGR 75 Query: 728 GGXGX-GXGXGGGGGXXXXGXGGGXGXXG-XGXXGGXXGG 615 GG G G G G G G GG G G GG GG Sbjct: 76 GGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGG 115 Score = 64.9 bits (151), Expect = 8e-11 Identities = 44/121 (36%), Positives = 44/121 (36%), Gaps = 1/121 (0%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG-XGXXGGGXXXXGXXG 806 GG G G G G GG G GG GGG G GG GGG G GGG G G Sbjct: 24 GGSDAGSGIGSSGGWGGSDASAGASA-GGTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAG 82 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G G GG G G GG G GG G GG G Sbjct: 83 AGGSGSGSGG--WGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQG 140 Query: 625 G 623 G Sbjct: 141 G 141 Score = 63.7 bits (148), Expect = 2e-10 Identities = 42/105 (40%), Positives = 42/105 (40%), Gaps = 7/105 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXX--GGGXGXGGGXGGGXGGGXGGXXXXGG- 813 GG G GG G G GG GG G G GG G GG GG GG GG GG Sbjct: 176 GGSQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQ 235 Query: 812 ---GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G GG G GGG G G G G G G G Sbjct: 236 QGGGRGGQQGPGGWGGGGRGGGWGGWGRGSRWGWGRPSWGGWGRG 280 Score = 63.3 bits (147), Expect = 3e-10 Identities = 43/132 (32%), Positives = 43/132 (32%), Gaps = 8/132 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-------GGXGXXGGGX 827 GGG G G GG G GG G G G G GG G G G G GG G GG Sbjct: 53 GGGRGGGRGGSGGGRGGGSGGGRGGSGGAGAGGSGSGSGGWGGQDGGSSAGGWGGSQGGS 112 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXGXXXX 650 G GG G G GG G GGG G G Sbjct: 113 QGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGG 172 Query: 649 XGXGGXXGGXXG 614 GG GG G Sbjct: 173 SQDGGSQGGWGG 184 Score = 58.4 bits (135), Expect = 7e-09 Identities = 41/124 (33%), Positives = 41/124 (33%), Gaps = 3/124 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GG G G GG GG G GG GG G GG G Sbjct: 140 GGNSNA---GGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGG 196 Query: 805 XGGXGXGXGG-XXXXXXXXXXXXXGXXGXXGGXXXGGG--GGXXXXXXGXGXXXXXGXGG 635 GG G GG G GG GG GG G G G GG Sbjct: 197 GGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGGGRGG 256 Query: 634 XXGG 623 GG Sbjct: 257 GWGG 260 Score = 57.2 bits (132), Expect = 2e-08 Identities = 40/124 (32%), Positives = 40/124 (32%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GG G G G GG GG G GG GG G GG G Sbjct: 159 GGRGGSGGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQG--- 215 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G G GGGG G G G G Sbjct: 216 -GSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGGGRGGGWGGWGRGSRWGWGRPSW 274 Query: 625 GXXG 614 G G Sbjct: 275 GGWG 278 Score = 56.4 bits (130), Expect = 3e-08 Identities = 43/127 (33%), Positives = 43/127 (33%), Gaps = 3/127 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXX-GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 G GG G G GG G G G GG GGG G GG GG G G G G Sbjct: 33 GSSGGWGGSDASAGASAGGTGGGRGGGR-GGSGGGRGGGSGGGRGGSGGAGAGGSGSGSG 91 Query: 808 GXGG--XGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G GG G G G G G G G G GG Sbjct: 92 GWGGQDGGSSAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQG-GNSNAGGWGG 150 Query: 634 XXGGXXG 614 GG G Sbjct: 151 SQGGQNG 157 Score = 52.8 bits (121), Expect = 4e-07 Identities = 43/135 (31%), Positives = 43/135 (31%), Gaps = 11/135 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG--GXGXXGGXGGGXGXXG-------G 833 GG G G G G G GG GG G G GG GG G G G Sbjct: 121 GGSSRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQG 180 Query: 832 GXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG--GGGGXXXXXXGXGX 659 G G GG G GG G G GG G GG G G G Sbjct: 181 GWGGQNGGGQGGNQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGR 240 Query: 658 XXXXGXGGXXGGXXG 614 G GG GG G Sbjct: 241 GGQQGPGGWGGGGRG 255 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXX 600 GG G G GG G G GG GG G GG G G G GG G Sbjct: 24 GGSDAGSGIGSSGGWGGSDASAGASAGGTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAGA 83 Query: 599 XXAXSXRSTWSXQ 561 + S W Q Sbjct: 84 GGSGSGSGGWGGQ 96 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G G G G G G G GG GGGG G G G G G G G Sbjct: 220 GSQGGSQGGWGNQGGQQGGGRG-GQQGPGGWGGGGRGGGWGGWGRGSRWGWGRPSWGGWG 278 Query: 805 XG 800 G Sbjct: 279 RG 280 >Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical protein R08B4.1b protein. Length = 1160 Score = 89.8 bits (213), Expect = 3e-18 Identities = 46/100 (46%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXX 804 GG G GG G GGG GG G G GGG G GGG GG G G GG G GG Sbjct: 791 GGGNGGSGGGGGGGGGGSGGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAG 850 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G G G G G G G G G G G G G G G G G Sbjct: 851 AGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAG 890 Score = 89.4 bits (212), Expect = 3e-18 Identities = 55/153 (35%), Positives = 60/153 (39%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G G G GG G GGG G GG GGG GG GGG Sbjct: 780 GGPTGSSGGGGGGGNGGSGGGGG-------GGGGGSGGSGGGGSNSNSGGGGGNGGGGNG 832 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GGG G G G G G G G G G G G G G G G G G G G Sbjct: 833 GGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNG-NGAGAGNGNG-AGAGNGNGAG 890 Query: 620 GGXXXXXXXAXSXRSTWSXQ*TSXXXLLSTQAA 522 G A ++ + Q + + QAA Sbjct: 891 AGDASAAAAAAQAQAAAAAQAQAAAAAAAQQAA 923 Score = 63.7 bits (148), Expect = 2e-10 Identities = 40/113 (35%), Positives = 40/113 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G GGG G GG G G G GG GGGG G GGG G GGG G Sbjct: 784 GSSGGGGGGGNGGSGGGGGGGGGGS--GGSGGGGSNSNSGGGGGNG--GGGNGGGGNGNG 839 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 GG G G GG G G G G G G G Sbjct: 840 GGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGAG 892 Score = 62.9 bits (146), Expect = 3e-10 Identities = 33/99 (33%), Positives = 33/99 (33%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GG GG G G G GG G GG GG G GGG G G Sbjct: 784 GSSGGGGGGGNGGSGGGGGGGGGGSGGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAG 843 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G G G G Sbjct: 844 DGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAG 882 Score = 59.3 bits (137), Expect = 4e-09 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GGG G GG G G G G G G G G G G G G G Sbjct: 824 GGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGA 883 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 884 GNGNGAGAG 892 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 89.8 bits (213), Expect = 3e-18 Identities = 50/128 (39%), Positives = 50/128 (39%), Gaps = 10/128 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXX--PPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPP 786 PP PP P P PPP P P PPP P PP P PPP P PP PP Sbjct: 261 PPVPPP--PPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPP 318 Query: 787 XXPPXXXXPPPXXXXPPXPPP-------XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP PP PP PPP PPP PP P P P PP P Sbjct: 319 PPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPPSGH 378 Query: 946 PXXPPPXP 969 PPP P Sbjct: 379 GMIPPPPP 386 Score = 86.6 bits (205), Expect = 2e-17 Identities = 45/116 (38%), Positives = 45/116 (38%), Gaps = 4/116 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP----PPPXXPPPXPXPPPPXXPPXXXXP 813 P P PPP PP PP P P PP P PPP PPP P PP P P Sbjct: 261 PPVPPPPPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPP 320 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP PPP P P P P P PP P PP Sbjct: 321 PPSRFGPPGMGGMPPP-PPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPP 375 Score = 81.0 bits (191), Expect = 1e-15 Identities = 44/114 (38%), Positives = 44/114 (38%), Gaps = 10/114 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPX---- 768 PP PP P PPP PPPPP P P PP P PPP PP Sbjct: 274 PPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGM 333 Query: 769 PXPPPPXXP-PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PPPP P PPP P P PP PP P PP P PP Sbjct: 334 PPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPP 387 Score = 62.1 bits (144), Expect = 6e-10 Identities = 44/134 (32%), Positives = 44/134 (32%), Gaps = 14/134 (10%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXX----PPPPP--XXXPPXXPXXXXXXXXXXXXXXXXPPX 785 PP PP P P P PPPPP PP P P Sbjct: 261 PPVPPPPPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPG---------PP 311 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP---PPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P PP PPP PP P PPP PP P PP P P Sbjct: 312 GMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRP 371 Query: 957 PPXP-----XPPPP 983 P P PPPP Sbjct: 372 PAPPSGHGMIPPPP 385 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P PPPPP P PP P Sbjct: 310 PPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPS 369 Query: 795 XPPXPXXPXXXXPPPXXP 848 PP P PPP P Sbjct: 370 RPPAPPSGHGMIPPPPPP 387 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 89.8 bits (213), Expect = 3e-18 Identities = 50/128 (39%), Positives = 50/128 (39%), Gaps = 10/128 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXX--PPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPP 786 PP PP P P PPP P P PPP P PP P PPP P PP PP Sbjct: 271 PPVPPP--PPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPP 328 Query: 787 XXPPXXXXPPPXXXXPPXPPP-------XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP PP PP PPP PPP PP P P P PP P Sbjct: 329 PPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPPSGH 388 Query: 946 PXXPPPXP 969 PPP P Sbjct: 389 GMIPPPPP 396 Score = 86.6 bits (205), Expect = 2e-17 Identities = 45/116 (38%), Positives = 45/116 (38%), Gaps = 4/116 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP----PPPXXPPPXPXPPPPXXPPXXXXP 813 P P PPP PP PP P P PP P PPP PPP P PP P P Sbjct: 271 PPVPPPPPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPP 330 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP PPP P P P P P PP P PP Sbjct: 331 PPSRFGPPGMGGMPPP-PPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPP 385 Score = 81.0 bits (191), Expect = 1e-15 Identities = 44/114 (38%), Positives = 44/114 (38%), Gaps = 10/114 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPX---- 768 PP PP P PPP PPPPP P P PP P PPP PP Sbjct: 284 PPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGM 343 Query: 769 PXPPPPXXP-PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PPPP P PPP P P PP PP P PP P PP Sbjct: 344 PPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPP 397 Score = 62.1 bits (144), Expect = 6e-10 Identities = 44/134 (32%), Positives = 44/134 (32%), Gaps = 14/134 (10%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXX----PPPPP--XXXPPXXPXXXXXXXXXXXXXXXXPPX 785 PP PP P P P PPPPP PP P P Sbjct: 271 PPVPPPPPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPG---------PP 321 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP---PPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P PP PPP PP P PPP PP P PP P P Sbjct: 322 GMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRP 381 Query: 957 PPXP-----XPPPP 983 P P PPPP Sbjct: 382 PAPPSGHGMIPPPP 395 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P PPPPP P PP P Sbjct: 320 PPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPS 379 Query: 795 XPPXPXXPXXXXPPPXXP 848 PP P PPP P Sbjct: 380 RPPAPPSGHGMIPPPPPP 397 >L25598-3|AAM15551.1| 759|Caenorhabditis elegans Calpain family protein 1, isoform d protein. Length = 759 Score = 88.6 bits (210), Expect = 6e-18 Identities = 56/121 (46%), Positives = 56/121 (46%), Gaps = 3/121 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG GG G G GGG G GGG GG G G GGG GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFG-----GGGGGSGGGGGGNNIGSLVGSLIGGGG---GGGN 105 Query: 788 XGGGGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGGG GGG GGGG GG G GGGGG G GGG G G G G Sbjct: 106 YGGGGGNQGGG--GGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDI-LGGIGSLIG 162 Query: 617 G 615 G Sbjct: 163 G 163 Score = 85.4 bits (202), Expect = 6e-17 Identities = 48/121 (39%), Positives = 48/121 (39%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG G G G GGG G G GGG GG GGG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGGGGGGSGGGGGGNNIGSLVGSLIGGGGGGGNYGGGGGNQ 113 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GG GG G G GG G GGG G G G G G G G Sbjct: 114 GGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGG 173 Query: 620 G 618 G Sbjct: 174 G 174 Score = 81.0 bits (191), Expect = 1e-15 Identities = 46/111 (41%), Positives = 46/111 (41%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG GG GGG G GGG GGG GGG GG GGG GG G Sbjct: 37 GAGGDILGGLASN---FFGGGGGGGGGGGGGGFGGGNGGFGGGGGGSGGGGGGNNIGSLV 93 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGGG GG G G GGGGG GG G G GG G Sbjct: 94 GSLIGGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQG 144 Score = 76.6 bits (180), Expect = 3e-14 Identities = 46/124 (37%), Positives = 46/124 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G GGG G GG G G G G GGGG G G GGG G G Sbjct: 52 GGGGGGGGGGGGGGFGGGNG-GFGGGGGGSGGGGGGNNIGSLVGSLIGGGGGGGNYGGGG 110 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G G GGGGG G G G GG Sbjct: 111 GNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYN 170 Query: 625 GXXG 614 G G Sbjct: 171 GGGG 174 Score = 70.1 bits (164), Expect = 2e-12 Identities = 44/114 (38%), Positives = 44/114 (38%), Gaps = 7/114 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGX-------GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXX 822 GG G GGG G GGG G G G GGG GGG GGG G Sbjct: 71 GGFGGGGGGSGGGGGGNNIGSLVGSLIGGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLI 130 Query: 821 XGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G GG GGG G G GG G GG G G GGGG GG Sbjct: 131 NSMGGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 184 Score = 55.2 bits (127), Expect = 7e-08 Identities = 32/84 (38%), Positives = 32/84 (38%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G GG G GGG GGGG G GG G G GGGGG Sbjct: 21 GLIGSIAGNLIRDKVGGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFG-GGGGG 79 Query: 686 XXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GG GG Sbjct: 80 SGGGGGGNNIGSLVGSLIGGGGGG 103 Score = 48.0 bits (109), Expect = 1e-05 Identities = 41/128 (32%), Positives = 41/128 (32%), Gaps = 16/128 (12%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG----GXGGGXG----------G 843 GG G GGG G GGG G GG G GG G GGG G G Sbjct: 103 GGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGSLIG 162 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG--XGGGGGXXXXGX 669 G GG GGG GG G G G G G G G G Sbjct: 163 GGGGGQYNGGGGNVNPNNLNGGMVNVIGNLIGEAAHRFLGVDPGTGRIIGAVAGNVIMGL 222 Query: 668 GGGXGXXG 645 GG G Sbjct: 223 GGKDNSLG 230 Score = 34.7 bits (76), Expect = 0.10 Identities = 35/109 (32%), Positives = 35/109 (32%), Gaps = 3/109 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGG--GXGGGXGGXXXXGGG 810 GG GG G GGG G G G GG G GGG GG GGG GG Sbjct: 127 GGLINSMGG--GGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 184 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G G G G GG G G Sbjct: 185 MVNVIGNLIGEAAHRFLGVDPGTGRIIGAVAGNVIMGLGGKDNSLGNIG 233 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGGG G G G G G GG GGG GG GG Sbjct: 134 GGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 184 >AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform b protein. Length = 518 Score = 83.0 bits (196), Expect = 3e-16 Identities = 44/122 (36%), Positives = 44/122 (36%), Gaps = 4/122 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX--PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP--XXPPPXPXPPP 783 PP PP P PPP P PPPP P P P PPPP PPP P Sbjct: 238 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 297 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP PP PP PPP P PPP PP PP P Sbjct: 298 PPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTG 357 Query: 964 XP 969 P Sbjct: 358 RP 359 Score = 80.6 bits (190), Expect = 2e-15 Identities = 40/110 (36%), Positives = 40/110 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPPP P P P PPPP P P PPP PP PPP Sbjct: 256 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 315 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PPP P PP PP P P Sbjct: 316 QAGGSPPPAGTGSPPPPPRQKRQAPERSPPTG-SPPTGSPPTGRPPRGGP 364 Score = 80.2 bits (189), Expect = 2e-15 Identities = 43/114 (37%), Positives = 43/114 (37%), Gaps = 2/114 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX--PPPXPXPPPPXXPPXXXXPPP 819 P PPP P PP P P P PPPP PPP P PP P PPP Sbjct: 233 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 292 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP P PP PPP P P PPP P P P Sbjct: 293 RAGSPP-PPPPPRGSPPTGSLPPPQAGGSP-PPAGTGSPPPPPRQKRQAPERSP 344 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/90 (38%), Positives = 35/90 (38%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PPP PP PP P PPP PP PP PP PP PPP Sbjct: 232 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 291 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PP PPP P Sbjct: 292 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP 321 Score = 76.6 bits (180), Expect = 3e-14 Identities = 39/104 (37%), Positives = 39/104 (37%), Gaps = 2/104 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP PPPP P P PPP PP P P PP PPP P P Sbjct: 232 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 291 Query: 844 P--PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP PPP PP P P PP PPP P Sbjct: 292 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP--PPAGTGSPPPPP 333 Score = 68.1 bits (159), Expect = 9e-12 Identities = 41/114 (35%), Positives = 41/114 (35%), Gaps = 6/114 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP P PPPPP P P PPPP PPP PP P Sbjct: 256 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPP--PPPRGSPPTGSLP 313 Query: 796 P--XXXXPPPXXXXPPXPPP----XPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PPP P PPP P PP PP P PP P Sbjct: 314 PPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPP---TGSPPTGRPPRGGP 364 Score = 55.2 bits (127), Expect = 7e-08 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 10/128 (7%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 P PP P P PPPPP P P P P PP Sbjct: 233 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 292 Query: 804 XPXXPXXXXPP----PXXPXPPPXPPXXPXPP----PPXPPXXXXPXPXPXPP--XXPXX 953 P PP P PPP P P PP PP P PP P Sbjct: 293 RAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTG 352 Query: 954 PPPXPXPP 977 PP PP Sbjct: 353 SPPTGRPP 360 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/124 (31%), Positives = 39/124 (31%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGGG 810 GG G G G G GG G G GG G GG G G GG GG Sbjct: 92 GGQTGFSGAPQGFGNNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGG 151 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG G G GG G G G G GG G G G Sbjct: 152 QTGFSEAPQGFGNNQQGGFGGNQG-NQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 210 Query: 629 GXXG 618 G Sbjct: 211 QQQG 214 Score = 45.6 bits (103), Expect = 5e-05 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 9/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGG 810 GG G GG G GG G G G GG GG GG G G G Sbjct: 46 GGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSGAPQGFG 105 Query: 809 XXXXGGXXGG-GGXGXGGGXXGG----GGXGXGGXGXGXGXGGGGGXXXXGXG-GGXGXX 648 GG G G G GG G GG G G GG GG G G Sbjct: 106 NNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNN 165 Query: 647 GXGXXGGXXG 618 G GG G Sbjct: 166 QQGGFGGNQG 175 Score = 34.3 bits (75), Expect = 0.14 Identities = 32/99 (32%), Positives = 32/99 (32%), Gaps = 3/99 (3%) Frame = -3 Query: 941 GGGXXGGXGXX-GXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G GG G G GG GG G GG G GG Sbjct: 31 GFGSQSGFGNNQGSQGGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGF-GGNQG 89 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G G GG G G GG G Sbjct: 90 GFGGQTGFSGAPQGFGNNQQGGFGGNQG-NQGGFGGRTG 127 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 5/99 (5%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P P P PP PP PP PP PP P P PP P Sbjct: 404 PRGPRRSPPTGSPPTGSPPTGRPPRGSPPT-GSPPTGLPSRQKRQAPEDRPTGSPPTGSP 462 Query: 859 PXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXPPPXP 969 P P P P P PP P P Sbjct: 463 PTGRPHRGGPGKSESSESREGPRGPRRSPPTGSPPTGSP 501 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/91 (24%), Positives = 22/91 (24%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P P P P PP Sbjct: 407 PRRSPPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRPTGSPPTGSPPTGR 466 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P PP PP Sbjct: 467 PHRGGPGKSESSESREGPRGPRRSPPTGSPP 497 Score = 30.3 bits (65), Expect = 2.2 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 2/100 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG-XGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG-GGXXXXGX 812 G GG G GG G G G G GG G G G G G G Sbjct: 111 GFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNNQQGGF 170 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 G G G GG G G G G GG Sbjct: 171 GGNQGNQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 210 Score = 28.7 bits (61), Expect = 6.7 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 7/99 (7%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP--XPPPXPP 858 PP P PP PP PP PP P P PP PP P Sbjct: 411 PPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRP---TGSPPTGSPPTGRP 467 Query: 859 PXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPXXPPPXP 969 P P P PP PP P P Sbjct: 468 HRGGPGKSESSESREGPRGPRRSPPTGSPPTGSPPTGAP 506 >AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform c protein. Length = 539 Score = 83.0 bits (196), Expect = 3e-16 Identities = 44/122 (36%), Positives = 44/122 (36%), Gaps = 4/122 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX--PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP--XXPPPXPXPPP 783 PP PP P PPP P PPPP P P P PPPP PPP P Sbjct: 259 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 318 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP PP PP PPP P PPP PP PP P Sbjct: 319 PPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTG 378 Query: 964 XP 969 P Sbjct: 379 RP 380 Score = 80.6 bits (190), Expect = 2e-15 Identities = 40/110 (36%), Positives = 40/110 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPPP P P P PPPP P P PPP PP PPP Sbjct: 277 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 336 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PPP P PP PP P P Sbjct: 337 QAGGSPPPAGTGSPPPPPRQKRQAPERSPPTG-SPPTGSPPTGRPPRGGP 385 Score = 80.2 bits (189), Expect = 2e-15 Identities = 43/114 (37%), Positives = 43/114 (37%), Gaps = 2/114 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX--PPPXPXPPPPXXPPXXXXPPP 819 P PPP P PP P P P PPPP PPP P PP P PPP Sbjct: 254 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 313 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP P PP PPP P P PPP P P P Sbjct: 314 RAGSPP-PPPPPRGSPPTGSLPPPQAGGSP-PPAGTGSPPPPPRQKRQAPERSP 365 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/90 (38%), Positives = 35/90 (38%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PPP PP PP P PPP PP PP PP PP PPP Sbjct: 253 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 312 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PP PPP P Sbjct: 313 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP 342 Score = 76.6 bits (180), Expect = 3e-14 Identities = 39/104 (37%), Positives = 39/104 (37%), Gaps = 2/104 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP PPPP P P PPP PP P P PP PPP P P Sbjct: 253 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 312 Query: 844 P--PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP PPP PP P P PP PPP P Sbjct: 313 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP--PPAGTGSPPPPP 354 Score = 68.1 bits (159), Expect = 9e-12 Identities = 41/114 (35%), Positives = 41/114 (35%), Gaps = 6/114 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP P PPPPP P P PPPP PPP PP P Sbjct: 277 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPP--PPPRGSPPTGSLP 334 Query: 796 P--XXXXPPPXXXXPPXPPP----XPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PPP P PPP P PP PP P PP P Sbjct: 335 PPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPP---TGSPPTGRPPRGGP 385 Score = 55.2 bits (127), Expect = 7e-08 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 10/128 (7%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 P PP P P PPPPP P P P P PP Sbjct: 254 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 313 Query: 804 XPXXPXXXXPP----PXXPXPPPXPPXXPXPP----PPXPPXXXXPXPXPXPP--XXPXX 953 P PP P PPP P P PP PP P PP P Sbjct: 314 RAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTG 373 Query: 954 PPPXPXPP 977 PP PP Sbjct: 374 SPPTGRPP 381 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/124 (31%), Positives = 39/124 (31%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGGG 810 GG G G G G GG G G GG G GG G G GG GG Sbjct: 113 GGQTGFSGAPQGFGNNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGG 172 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG G G GG G G G G GG G G G Sbjct: 173 QTGFSEAPQGFGNNQQGGFGGNQG-NQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 231 Query: 629 GXXG 618 G Sbjct: 232 QQQG 235 Score = 45.6 bits (103), Expect = 5e-05 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 9/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGG 810 GG G GG G GG G G G GG GG GG G G G Sbjct: 67 GGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSGAPQGFG 126 Query: 809 XXXXGGXXGG-GGXGXGGGXXGG----GGXGXGGXGXGXGXGGGGGXXXXGXG-GGXGXX 648 GG G G G GG G GG G G GG GG G G Sbjct: 127 NNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNN 186 Query: 647 GXGXXGGXXG 618 G GG G Sbjct: 187 QQGGFGGNQG 196 Score = 34.3 bits (75), Expect = 0.14 Identities = 32/99 (32%), Positives = 32/99 (32%), Gaps = 3/99 (3%) Frame = -3 Query: 941 GGGXXGGXGXX-GXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G GG G G GG GG G GG G GG Sbjct: 52 GFGSQSGFGNNQGSQGGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGF-GGNQG 110 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G G GG G G GG G Sbjct: 111 GFGGQTGFSGAPQGFGNNQQGGFGGNQG-NQGGFGGRTG 148 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 5/99 (5%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P P P PP PP PP PP PP P P PP P Sbjct: 425 PRGPRRSPPTGSPPTGSPPTGRPPRGSPPT-GSPPTGLPSRQKRQAPEDRPTGSPPTGSP 483 Query: 859 PXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXPPPXP 969 P P P P P PP P P Sbjct: 484 PTGRPHRGGPGKSESSESREGPRGPRRSPPTGSPPTGSP 522 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/91 (24%), Positives = 22/91 (24%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P P P P PP Sbjct: 428 PRRSPPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRPTGSPPTGSPPTGR 487 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P PP PP Sbjct: 488 PHRGGPGKSESSESREGPRGPRRSPPTGSPP 518 Score = 30.3 bits (65), Expect = 2.2 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 2/100 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG-XGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG-GGXXXXGX 812 G GG G GG G G G G GG G G G G G G Sbjct: 132 GFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNNQQGGF 191 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 G G G GG G G G G GG Sbjct: 192 GGNQGNQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 231 Score = 28.7 bits (61), Expect = 6.7 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 7/99 (7%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP--XPPPXPP 858 PP P PP PP PP PP P P PP PP P Sbjct: 432 PPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRP---TGSPPTGSPPTGRP 488 Query: 859 PXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPXXPPPXP 969 P P P PP PP P P Sbjct: 489 HRGGPGKSESSESREGPRGPRRSPPTGSPPTGSPPTGAP 527 >AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform a protein. Length = 524 Score = 83.0 bits (196), Expect = 3e-16 Identities = 44/122 (36%), Positives = 44/122 (36%), Gaps = 4/122 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX--PPPXPXXXXPPPPPXPXPXPXPPXPXPPPP--XXPPPXPXPPP 783 PP PP P PPP P PPPP P P P PPPP PPP P Sbjct: 244 PPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 303 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP PP PP PPP P PPP PP PP P Sbjct: 304 PPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTGSPPTG 363 Query: 964 XP 969 P Sbjct: 364 RP 365 Score = 80.6 bits (190), Expect = 2e-15 Identities = 40/110 (36%), Positives = 40/110 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPPP P P P PPPP P P PPP PP PPP Sbjct: 262 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPPPPPRGSPPTGSLPPP 321 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PPP P PP PP P P Sbjct: 322 QAGGSPPPAGTGSPPPPPRQKRQAPERSPPTG-SPPTGSPPTGRPPRGGP 370 Score = 80.2 bits (189), Expect = 2e-15 Identities = 43/114 (37%), Positives = 43/114 (37%), Gaps = 2/114 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX--PPPXPXPPPPXXPPXXXXPPP 819 P PPP P PP P P P PPPP PPP P PP P PPP Sbjct: 239 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 298 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP P PP PPP P P PPP P P P Sbjct: 299 RAGSPP-PPPPPRGSPPTGSLPPPQAGGSP-PPAGTGSPPPPPRQKRQAPERSP 350 Score = 78.2 bits (184), Expect = 8e-15 Identities = 35/90 (38%), Positives = 35/90 (38%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PPP PP PP P PPP PP PP PP PP PPP Sbjct: 238 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 297 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP PP PPP P Sbjct: 298 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP 327 Score = 76.6 bits (180), Expect = 3e-14 Identities = 39/104 (37%), Positives = 39/104 (37%), Gaps = 2/104 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP PPPP P P PPP PP P P PP PPP P P Sbjct: 238 PPAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPP 297 Query: 844 P--PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP PPP PP P P PP PPP P Sbjct: 298 PRAGSPPPPPPPRGSPPTGSLPPPQAGGSP--PPAGTGSPPPPP 339 Score = 68.1 bits (159), Expect = 9e-12 Identities = 41/114 (35%), Positives = 41/114 (35%), Gaps = 6/114 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP P PPPPP P P PPPP PPP PP P Sbjct: 262 PPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSPPPP--PPPRGSPPTGSLP 319 Query: 796 P--XXXXPPPXXXXPPXPPP----XPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PPP P PPP P PP PP P PP P Sbjct: 320 PPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPP---TGSPPTGRPPRGGP 370 Score = 55.2 bits (127), Expect = 7e-08 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 10/128 (7%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 P PP P P PPPPP P P P P PP Sbjct: 239 PAGSPPPPPPPKGSPPLAGSGSPPPPPAAGSPPPPRTGSPPPPPTGSPPPPPAGGSPPPP 298 Query: 804 XPXXPXXXXPP----PXXPXPPPXPPXXPXPP----PPXPPXXXXPXPXPXPP--XXPXX 953 P PP P PPP P P PP PP P PP P Sbjct: 299 RAGSPPPPPPPRGSPPTGSLPPPQAGGSPPPAGTGSPPPPPRQKRQAPERSPPTGSPPTG 358 Query: 954 PPPXPXPP 977 PP PP Sbjct: 359 SPPTGRPP 366 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/124 (31%), Positives = 39/124 (31%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXGGGXGG--GXGGXXXXGGG 810 GG G G G G GG G G GG G GG G G GG GG Sbjct: 98 GGQTGFSGAPQGFGNNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGG 157 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG G G GG G G G G GG G G G Sbjct: 158 QTGFSEAPQGFGNNQQGGFGGNQG-NQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 216 Query: 629 GXXG 618 G Sbjct: 217 QQQG 220 Score = 45.6 bits (103), Expect = 5e-05 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 9/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXG--GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGG 810 GG G GG G GG G G G GG GG GG G G G Sbjct: 52 GGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSGAPQGFG 111 Query: 809 XXXXGGXXGG-GGXGXGGGXXGG----GGXGXGGXGXGXGXGGGGGXXXXGXG-GGXGXX 648 GG G G G GG G GG G G GG GG G G Sbjct: 112 NNQQGGFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNN 171 Query: 647 GXGXXGGXXG 618 G GG G Sbjct: 172 QQGGFGGNQG 181 Score = 34.3 bits (75), Expect = 0.14 Identities = 32/99 (32%), Positives = 32/99 (32%), Gaps = 3/99 (3%) Frame = -3 Query: 941 GGGXXGGXGXX-GXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 G G G G G GG G G GG GG G GG G GG Sbjct: 37 GFGSQSGFGNNQGSQGGFGGNQGGFSGSPQQGGFGGRTGSPPPFGGFSGAPQGF-GGNQG 95 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G G GG G G GG G Sbjct: 96 GFGGQTGFSGAPQGFGNNQQGGFGGNQG-NQGGFGGRTG 133 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 5/99 (5%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 P P P PP PP PP PP PP P P PP P Sbjct: 410 PRGPRRSPPTGSPPTGSPPTGRPPRGSPPT-GSPPTGLPSRQKRQAPEDRPTGSPPTGSP 468 Query: 859 PXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXPPPXP 969 P P P P P PP P P Sbjct: 469 PTGRPHRGGPGKSESSESREGPRGPRRSPPTGSPPTGSP 507 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/91 (24%), Positives = 22/91 (24%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P P P P PP Sbjct: 413 PRRSPPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRPTGSPPTGSPPTGR 472 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P PP PP Sbjct: 473 PHRGGPGKSESSESREGPRGPRRSPPTGSPP 503 Score = 30.3 bits (65), Expect = 2.2 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 2/100 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG-XGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG-GGXXXXGX 812 G GG G GG G G G G GG G G G G G G Sbjct: 117 GFGGNQGNQGGFGGRTGSPPPFGGFSGAPQGFGGNQGGFGGQTGFSEAPQGFGNNQQGGF 176 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 G G G GG G G G G GG Sbjct: 177 GGNQGNQGGFGGQNGQNGQNTGNNGGFGGNQGVTASGFGG 216 Score = 28.7 bits (61), Expect = 6.7 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 7/99 (7%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP--XPPPXPP 858 PP P PP PP PP PP P P PP PP P Sbjct: 417 PPTGSPPTGSPPTGRPPRGSPPTGSPPTGLPSRQKRQAPEDRP---TGSPPTGSPPTGRP 473 Query: 859 PXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPXXPPPXP 969 P P P PP PP P P Sbjct: 474 HRGGPGKSESSESREGPRGPRRSPPTGSPPTGSPPTGAP 512 >AC084154-11|AAK29874.1| 350|Caenorhabditis elegans Hypothetical protein Y22D7AR.1 protein. Length = 350 Score = 81.4 bits (192), Expect = 9e-16 Identities = 46/124 (37%), Positives = 46/124 (37%), Gaps = 2/124 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 165 PEPKPKPKPEPK-PKPKPDPKPK-PKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPK 222 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P P P P P P P Sbjct: 223 PKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKP-NPKPEP 281 Query: 970 XXPP 981 P Sbjct: 282 NPMP 285 Score = 80.2 bits (189), Expect = 2e-15 Identities = 43/123 (34%), Positives = 43/123 (34%), Gaps = 1/123 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 161 PNPKPEPKPKPK-PEPKPKPKPD-PKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPKPKPE 218 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P P Sbjct: 219 PKPKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKPNPK 278 Query: 973 XPP 981 P Sbjct: 279 PEP 281 Score = 76.6 bits (180), Expect = 3e-14 Identities = 45/125 (36%), Positives = 45/125 (36%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 199 PKPEPKPKPKPE-PKPKPKPEPK-PKPKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPK 256 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP-PX 966 P P P P P P P P P P P P P P P P P P P Sbjct: 257 TKLKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPK 316 Query: 967 PXXPP 981 P P Sbjct: 317 PKPRP 321 Score = 75.8 bits (178), Expect = 4e-14 Identities = 42/123 (34%), Positives = 42/123 (34%), Gaps = 1/123 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 169 PKPKPEPKPKPK-PDPKPKPKPK-PKPKPKPNPKPEPKPKPKPEPKPKPKPEPKPKPKPK 226 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P Sbjct: 227 PKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPE 286 Query: 973 XPP 981 P Sbjct: 287 LKP 289 Score = 75.4 bits (177), Expect = 6e-14 Identities = 42/123 (34%), Positives = 42/123 (34%), Gaps = 1/123 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 189 PKPKPKPKPNPK-PEPKPKPKPE-PKPKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPK 246 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P Sbjct: 247 PKPKPEPKPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPK 306 Query: 973 XPP 981 P Sbjct: 307 PKP 309 Score = 73.7 bits (173), Expect = 2e-13 Identities = 43/125 (34%), Positives = 43/125 (34%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 191 PKPKPKPNPKPE-PKPKPKPEPK-PKPKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPKPK 248 Query: 793 PPXXXXPPPXXXXPPXPPPX--PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P P P Sbjct: 249 PKPEPKPKTKLKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPK 308 Query: 967 PXXPP 981 P P Sbjct: 309 PRSKP 313 Score = 72.5 bits (170), Expect = 4e-13 Identities = 42/122 (34%), Positives = 42/122 (34%), Gaps = 1/122 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 177 PKPKPDPKPKPK-PKPKPKPKPN-PKPEPKPKPKPEPKPKPKPEPKPKPKPKPKPKPKPN 234 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P Sbjct: 235 PNPKPEPKPKPKPKPKPEPKPKTKLKSEPKPKPKLKPKP-KPNPKPEPNPMPELKPKPKH 293 Query: 973 XP 978 P Sbjct: 294 KP 295 Score = 65.7 bits (153), Expect = 5e-11 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 201 PEPKPKPKPEPK-PKPKPEPKPK-PKPKPKPKPKPNPNPKPEPKPKPKPKPKPEPKPKTK 258 Query: 793 PPXXXXPPPXXXXPPXP--PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P Sbjct: 259 LKSEPKPKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPKPK 318 Query: 967 PXXPP 981 P P Sbjct: 319 PRPKP 323 Score = 62.1 bits (144), Expect = 6e-10 Identities = 41/124 (33%), Positives = 41/124 (33%), Gaps = 2/124 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P Sbjct: 207 PKPEPKPKPKPE-PKPKPKPKPK-PKPKPNPNPKPEPKPKPKPKPKPEPKPKTKLKSEPK 264 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P P P P P Sbjct: 265 PKPKLKPKPKPNPKPEPNPMPELKPKPKHKPNSRPKPNPRPKPKPRSKPNPKP-KPRPKP 323 Query: 970 XXPP 981 P Sbjct: 324 ELKP 327 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P P P P P P P P P P P P P P P P P P Sbjct: 155 PKLKSKPNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKP-EPKP 213 Query: 925 PXXPPPXPXXPPPXPXXPP 981 P P P P P P P Sbjct: 214 KPKPEPKP-KPKPKPKPKP 231 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/95 (25%), Positives = 24/95 (25%), Gaps = 1/95 (1%) Frame = +2 Query: 701 PXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP-PXXXXXXXXXXXXXXXXX 877 P P P P P P P P P P P P Sbjct: 155 PKLKSKPNPKPEPKPKPKPEPKPKPKPDPKPKPKPKPKPKPKPNPKPEPKPKPKPEPKPK 214 Query: 878 XXPPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 P P P P P P P P P P P P Sbjct: 215 PKPEPKPKPKPKPKPKPKPNPNPKPEPKPKPKPKP 249 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 81.0 bits (191), Expect = 1e-15 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPPPP P P P PPPP PP PPP PP PP PP PPP Sbjct: 708 PITGGPPPPPGLPPITGGPPP-PPPPGGLPPITGGPPPPPPPGGL--PPISGGPPPPPPP 764 Query: 853 PPPXPPPXPXPPP--XXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP P PPP P P P P P P P Sbjct: 765 PGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLP 805 Score = 78.2 bits (184), Expect = 8e-15 Identities = 44/106 (41%), Positives = 44/106 (41%), Gaps = 5/106 (4%) Frame = +1 Query: 640 PXPXXPXPPPX--PXXXXPPPPPXPX---PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P PPP P PPPPP P P P P PPP PP PPPP PP Sbjct: 708 PITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 767 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP PP PP PPP PPP P P P PP Sbjct: 768 CPPPP----PPPPPGGFKGGPPP---PPPPGMFAPMAPVIPDYLPP 806 Score = 76.6 bits (180), Expect = 3e-14 Identities = 44/117 (37%), Positives = 44/117 (37%), Gaps = 5/117 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--PPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PPP P PP PPPP PP PPPP PP PP Sbjct: 681 PKIPLPPPTKMNLSAPSTSAGGSSALPPITGGPPPPPGLPPITGGPPPP--PPPGGLPPI 738 Query: 820 XXXXPPXPPP--XPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP PP PP P PPP P P PP P PPP P Sbjct: 739 TGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAP 795 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 3/94 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP---PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PPP P P PPP P P PP PPP PPP PPPP Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 772 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P PPP P P P P Sbjct: 773 PPP-----PPGGFKGGPPPPPPPGMFAPMAPVIP 801 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 6/91 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXP 777 PP PP P P PP P PPPPP P P PP P PPP PPP P P Sbjct: 716 PPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPP 775 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP PPP P P P PP Sbjct: 776 PPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 806 Score = 61.7 bits (143), Expect = 8e-10 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +1 Query: 616 PPXXPPXX--PXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP PP P P PPP P P PPPP P P PP P PPPP P P Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPP 786 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P PP P Sbjct: 787 PPPPGMFAPMAPVIPDYLPPKKVP 810 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 7/103 (6%) Frame = +3 Query: 690 PPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPXPX--PPXPXXPXXXXPPPXX-PXPP 857 PPPPP P P PP P P PP P PPP P PP Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 772 Query: 858 PXPP---XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP PPPP PP P P P P P Sbjct: 773 PPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPPKKVPKVDGP 815 Score = 50.8 bits (116), Expect = 1e-06 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P PPPPP PP PP P Sbjct: 713 PPPPPGLP----------PITGGPPPPPPPGGLPP---------------ITGGPP--PP 745 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXP 968 PP P PPP PPP P P PPPP PP P P PP P P P Sbjct: 746 PPPGGLPPISGGPPP----PPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIP 801 Query: 969 XPPPP 983 PP Sbjct: 802 DYLPP 806 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 81.0 bits (191), Expect = 1e-15 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPPPP P P P PPPP PP PPP PP PP PP PPP Sbjct: 708 PITGGPPPPPGLPPITGGPPP-PPPPGGLPPITGGPPPPPPPGGL--PPISGGPPPPPPP 764 Query: 853 PPPXPPPXPXPPP--XXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP P PPP P P P P P P P Sbjct: 765 PGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLP 805 Score = 78.2 bits (184), Expect = 8e-15 Identities = 44/106 (41%), Positives = 44/106 (41%), Gaps = 5/106 (4%) Frame = +1 Query: 640 PXPXXPXPPPX--PXXXXPPPPPXPX---PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P PPP P PPPPP P P P P PPP PP PPPP PP Sbjct: 708 PITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 767 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP PP PP PPP PPP P P P PP Sbjct: 768 CPPPP----PPPPPGGFKGGPPP---PPPPGMFAPMAPVIPDYLPP 806 Score = 76.6 bits (180), Expect = 3e-14 Identities = 44/117 (37%), Positives = 44/117 (37%), Gaps = 5/117 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--PPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PPP P PP PPPP PP PPPP PP PP Sbjct: 681 PKIPLPPPTKMNLSAPSTSAGGSSALPPITGGPPPPPGLPPITGGPPPP--PPPGGLPPI 738 Query: 820 XXXXPPXPPP--XPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP PP PP P PPP P P PP P PPP P Sbjct: 739 TGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAP 795 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 3/94 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP---PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PPP P P PPP P P PP PPP PPP PPPP Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 772 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P PPP P P P P Sbjct: 773 PPP-----PPGGFKGGPPPPPPPGMFAPMAPVIP 801 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 6/91 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXP 777 PP PP P P PP P PPPPP P P PP P PPP PPP P P Sbjct: 716 PPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPP 775 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP PPP P P P PP Sbjct: 776 PPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 806 Score = 61.7 bits (143), Expect = 8e-10 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +1 Query: 616 PPXXPPXX--PXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP PP P P PPP P P PPPP P P PP P PPPP P P Sbjct: 727 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPP 786 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P PP P Sbjct: 787 PPPPGMFAPMAPVIPDYLPPKKVP 810 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 7/103 (6%) Frame = +3 Query: 690 PPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPXPX--PPXPXXPXXXXPPPXX-PXPP 857 PPPPP P P PP P P PP P PPP P PP Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 772 Query: 858 PXPP---XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP PPPP PP P P P P P Sbjct: 773 PPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPPKKVPKVDGP 815 Score = 50.8 bits (116), Expect = 1e-06 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P PPPPP PP PP P Sbjct: 713 PPPPPGLP----------PITGGPPPPPPPGGLPP---------------ITGGPP--PP 745 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXP 968 PP P PPP PPP P P PPPP PP P P PP P P P Sbjct: 746 PPPGGLPPISGGPPP----PPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIP 801 Query: 969 XPPPP 983 PP Sbjct: 802 DYLPP 806 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 81.0 bits (191), Expect = 1e-15 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPPPP P P P PPPP PP PPP PP PP PP PPP Sbjct: 291 PITGGPPPPPGLPPITGGPPP-PPPPGGLPPITGGPPPPPPPGGL--PPISGGPPPPPPP 347 Query: 853 PPPXPPPXPXPPP--XXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PPP P PPP P P P P P P P Sbjct: 348 PGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLP 388 Score = 78.2 bits (184), Expect = 8e-15 Identities = 44/106 (41%), Positives = 44/106 (41%), Gaps = 5/106 (4%) Frame = +1 Query: 640 PXPXXPXPPPX--PXXXXPPPPPXPX---PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P PPP P PPPPP P P P P PPP PP PPPP PP Sbjct: 291 PITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 350 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP PP PP PPP PPP P P P PP Sbjct: 351 CPPPP----PPPPPGGFKGGPPP---PPPPGMFAPMAPVIPDYLPP 389 Score = 76.6 bits (180), Expect = 3e-14 Identities = 44/117 (37%), Positives = 44/117 (37%), Gaps = 5/117 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--PPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PPP P PP PPPP PP PPPP PP PP Sbjct: 264 PKIPLPPPTKMNLSAPSTSAGGSSALPPITGGPPPPPGLPPITGGPPPP--PPPGGLPPI 321 Query: 820 XXXXPPXPPP--XPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP PP PP P PPP P P PP P PPP P Sbjct: 322 TGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAP 378 Score = 73.3 bits (172), Expect = 2e-13 Identities = 38/94 (40%), Positives = 38/94 (40%), Gaps = 3/94 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP---PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PPP P P PPP P P PP PPP PPP PPPP Sbjct: 296 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 355 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P PPP P P P P Sbjct: 356 PPP-----PPGGFKGGPPPPPPPGMFAPMAPVIP 384 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 6/91 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXP 777 PP PP P P PP P PPPPP P P PP P PPP PPP P P Sbjct: 299 PPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPP 358 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 PP PPP P P P PP Sbjct: 359 PPGGFKGGPPPPPPPGMFAPMAPVIPDYLPP 389 Score = 61.7 bits (143), Expect = 8e-10 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +1 Query: 616 PPXXPPXX--PXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP PP P P PPP P P PPPP P P PP P PPPP P P Sbjct: 310 PPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPP 369 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P PP P Sbjct: 370 PPPPGMFAPMAPVIPDYLPPKKVP 393 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 7/103 (6%) Frame = +3 Query: 690 PPPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPXPXPX--PPXPXXPXXXXPPPXX-PXPP 857 PPPPP P P PP P P PP P PPP P PP Sbjct: 296 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPP 355 Query: 858 PXPP---XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PP PPPP PP P P P P P Sbjct: 356 PPPPPGGFKGGPPPPPPPGMFAPMAPVIPDYLPPKKVPKVDGP 398 Score = 50.8 bits (116), Expect = 1e-06 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P PPPPP PP PP P Sbjct: 296 PPPPPGLP----------PITGGPPPPPPPGGLPP---------------ITGGPP--PP 328 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP--PPXP 968 PP P PPP PPP P P PPPP PP P P PP P P P Sbjct: 329 PPPGGLPPISGGPPP----PPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAPMAPVIP 384 Query: 969 XPPPP 983 PP Sbjct: 385 DYLPP 389 >L25598-4|AAV58888.1| 737|Caenorhabditis elegans Calpain family protein 1, isoform b protein. Length = 737 Score = 80.6 bits (190), Expect = 2e-15 Identities = 53/114 (46%), Positives = 53/114 (46%), Gaps = 3/114 (2%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG GG GGG G GGG GGG GGG GG GGG GG GGGG Sbjct: 37 GAGGDILGGLASN---FFGGGGGGGGGGGGGGFGGGNGG---FGGG---GGGNYGGGGGN 87 Query: 767 XGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GGGG GG G GGGGG G GGG G G G GG Sbjct: 88 QGGG--GGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDI-LGGIGSLIGG 138 Score = 80.2 bits (189), Expect = 2e-15 Identities = 46/101 (45%), Positives = 46/101 (45%), Gaps = 1/101 (0%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXX 786 GGG G GGG GG G GGG GGG G GGG GG GG G Sbjct: 52 GGGGGGGGGGGGGGFGGGNGGFGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGG 111 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GGGG GG GGGG G G G GGGGG G GG Sbjct: 112 GGGGQRQGG---GGGGFGDILGGIGSLIGGGGGGQYNGGGG 149 Score = 79.8 bits (188), Expect = 3e-15 Identities = 44/107 (41%), Positives = 44/107 (41%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG GG G G GGG GGG GGG G G Sbjct: 53 GGGGGGGGGGGGGFGGGNGGFGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGG 112 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG GGG G G GG G GG G G GGGG GG Sbjct: 113 GGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 159 Score = 72.9 bits (171), Expect = 3e-13 Identities = 46/115 (40%), Positives = 46/115 (40%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GG G G GGG G GGG GG GGG GG GGG GG G Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGGGGGGFGGG-NGGFGGGGGGNYGGGGGNQGGGGGGG 95 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG GG G GG G G GGG G G G G G G G G Sbjct: 96 FNFNDIGGLINSMGGGGGGGQRQG-GGGGGFGDILGGIGSLIGGGGGGQYNGGGG 149 Score = 69.7 bits (163), Expect = 3e-12 Identities = 37/98 (37%), Positives = 37/98 (37%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGGG G GGG G GG G G G GGGG GG GGG G G Sbjct: 52 GGGGGGGGGGGGGGFGGGNGGFGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGG 111 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 GG G GG G GG GGGG Sbjct: 112 GGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGG 149 Score = 65.3 bits (152), Expect = 6e-11 Identities = 46/124 (37%), Positives = 46/124 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG GG GG G G G GG GGG G GG GG G GGG G G Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGGGGGNYG--GGG----GNQG 89 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G G GGGGG G G G GG Sbjct: 90 ----GGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYN 145 Query: 625 GXXG 614 G G Sbjct: 146 GGGG 149 Score = 55.2 bits (127), Expect = 7e-08 Identities = 32/80 (40%), Positives = 32/80 (40%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G GG G GGG GGGG G GG G G GGGG Sbjct: 21 GLIGSIAGNLIRDKVGGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGGGGG- 79 Query: 686 XXXXGXGGGXGXXGXGXXGG 627 GGG G G G GG Sbjct: 80 ----NYGGGGGNQGGGGGGG 95 Score = 50.8 bits (116), Expect = 1e-06 Identities = 45/135 (33%), Positives = 45/135 (33%), Gaps = 23/135 (17%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXX--------GGGXGXG---GGXGGGXG---- 846 GG G GGG G GGG GG G G GGG G G GG GGG G Sbjct: 71 GGFGGGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILG 130 Query: 845 ------GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG--XGGGG 690 GG GG GGG GG G G G G G G Sbjct: 131 GIGSLIGGGGGGQYNGGGGNVNPNNLNGGMVNVIGNLIGEAAHRFLGVDPGTGRIIGAVA 190 Query: 689 GXXXXGXGGGXGXXG 645 G G GG G Sbjct: 191 GNVIMGLGGKDNSLG 205 Score = 34.7 bits (76), Expect = 0.10 Identities = 35/109 (32%), Positives = 35/109 (32%), Gaps = 3/109 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGG--GXGGGXGGXXXXGGG 810 GG GG G GGG G G G GG G GGG GG GGG GG Sbjct: 102 GGLINSMGG--GGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 159 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G G G G GG G G Sbjct: 160 MVNVIGNLIGEAAHRFLGVDPGTGRIIGAVAGNVIMGLGGKDNSLGNIG 208 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGGG G G G G G GG GGG GG GG Sbjct: 109 GGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 159 >U62772-1|AAB04136.1| 763|Caenorhabditis elegans RNA helicase protein. Length = 763 Score = 80.2 bits (189), Expect = 2e-15 Identities = 51/130 (39%), Positives = 51/130 (39%), Gaps = 8/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GGG GG G G G G G G G G GGG G GGG Sbjct: 22 GGFGGGNNGGSGFGGGKNGGTGFGGGNTG-GSGFGGGNTGGSGFGGGKAGGSGFGGGNTC 80 Query: 800 XGGXXGG--GGXGXGGGXXG-GGGXGXGGXGXG-----XGXGGGGGXXXXGXGGGXGXXG 645 G GG GG GG G GG G G G G GG G G G G G G Sbjct: 81 GSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFG 140 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 141 GGNSGFGEGG 150 Score = 73.7 bits (173), Expect = 2e-13 Identities = 51/129 (39%), Positives = 51/129 (39%), Gaps = 11/129 (8%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXXXXG 795 G G G G GGG GG G G GG G GGG G G GGG G GGG Sbjct: 17 GFGSGG-GFGGGNNGGSGFGGGK---NGGTGFGGGNTGGSGFGGGNTGGSGFGGGKAGGS 72 Query: 794 GXXGG-------GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG--XXGX 642 G GG GG GG GG G GG G G G G GG G G Sbjct: 73 GFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGF 132 Query: 641 GXXGGXXGG 615 G GG GG Sbjct: 133 GSGGGSFGG 141 Score = 73.3 bits (172), Expect = 2e-13 Identities = 46/120 (38%), Positives = 46/120 (38%), Gaps = 3/120 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXX 804 G G GGG G G G G G GG G GGG G G GGG G GG Sbjct: 40 GGTGFGGGNTGGSGFGGGNTGGSGFGGGKAGGSGFGGGNTCGSGFGGGSTGGSPYGGASS 99 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G GG G G GGG GGG G G GG Sbjct: 100 GFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGG------SFGGGNSGFGEGGHGG 153 Score = 60.5 bits (140), Expect = 2e-09 Identities = 39/124 (31%), Positives = 39/124 (31%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GGG G G G G GG GG G GG GG G GG G G Sbjct: 27 GNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKAGGSGFGGGNTCGSGFGG 86 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G GG G GG GG G G GG G Sbjct: 87 GSTGGSPYGGASSGFGGSTATSGFGSGEKSS-AFGGSGGFGGSATGFGSGGGSFGGGNSG 145 Query: 625 GXXG 614 G Sbjct: 146 FGEG 149 Score = 55.2 bits (127), Expect = 7e-08 Identities = 29/70 (41%), Positives = 29/70 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G GGG G G G G GG GG G GG GG G GG G G Sbjct: 17 GFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKAGGSGFGG 76 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 77 GNTCGSGFGG 86 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 6/85 (7%) Frame = -3 Query: 977 GXXGXGGGXX---GXGGGXXGGXGXXGXXXXXGGGX---GXGGGXGGGXGGGXGGXXXXG 816 G G GGG G GGG GG G GG G G G GG GG Sbjct: 70 GGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSA 129 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGG 741 G GG GGG G G G GGG Sbjct: 130 TGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/92 (35%), Positives = 33/92 (35%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G G G GG G G G GG Sbjct: 66 GGKAGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATS-GFGSGEKSSAFGGSGG 124 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G G GGG GGG G G G G G Sbjct: 125 FGG--SATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 6/69 (8%) Frame = -1 Query: 985 GGG--GGXGXGGGXXGXXGGX---GXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGGGXX 824 GGG GG GG G G G G G G GG G G G G G GGG Sbjct: 85 GGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNS 144 Query: 823 XXGXXGXGG 797 G G GG Sbjct: 145 GFGEGGHGG 153 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G G G G G G G GGG G G G G GGG Sbjct: 103 GSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GG G G GG G GG G G G G Sbjct: 210 GGFGGGAGFGNNGGNDGFGGDGGFGGGEERG 240 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG 914 GGG G G GG G G G G G Sbjct: 213 GGGAGFGNNGGNDGFGGDGGFGGG 236 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG G G G G GG G GG G G GGG Sbjct: 207 GRTGGFGGGAGFGN-NGGNDGFGGDG---GFGGG 236 >L19948-1|AAC27384.1| 763|Caenorhabditis elegans RNA helicase protein. Length = 763 Score = 79.4 bits (187), Expect = 4e-15 Identities = 51/130 (39%), Positives = 51/130 (39%), Gaps = 8/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GGG GG G G G G G G G G GGG G GGG Sbjct: 22 GGFGGGNNGGSGFGGGKNGGTGFGGGNTG-GSGFGGGNTGGSGFGGGKTGGSGFGGGNTC 80 Query: 800 XGGXXGG--GGXGXGGGXXG-GGGXGXGGXGXG-----XGXGGGGGXXXXGXGGGXGXXG 645 G GG GG GG G GG G G G G GG G G G G G G Sbjct: 81 GSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFG 140 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 141 GGNSGFGEGG 150 Score = 73.7 bits (173), Expect = 2e-13 Identities = 51/129 (39%), Positives = 51/129 (39%), Gaps = 11/129 (8%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXXXXG 795 G G G G GGG GG G G GG G GGG G G GGG G GGG Sbjct: 17 GFGSGG-GFGGGNNGGSGFGGGK---NGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGS 72 Query: 794 GXXGG-------GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG--XXGX 642 G GG GG GG GG G GG G G G G GG G G Sbjct: 73 GFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGF 132 Query: 641 GXXGGXXGG 615 G GG GG Sbjct: 133 GSGGGSFGG 141 Score = 72.5 bits (170), Expect = 4e-13 Identities = 46/120 (38%), Positives = 46/120 (38%), Gaps = 3/120 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXX 804 G G GGG G G G G G GG G GGG G G GGG G GG Sbjct: 40 GGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASS 99 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G GG G G GGG GGG G G GG Sbjct: 100 GFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGG------SFGGGNSGFGEGGHGG 153 Score = 59.7 bits (138), Expect = 3e-09 Identities = 39/124 (31%), Positives = 39/124 (31%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GGG G G G G GG GG G GG GG G GG G G Sbjct: 27 GNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGG 86 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G GG G GG GG G G GG G Sbjct: 87 GSTGGSPYGGASSGFGGSTATSGFGSGEKSS-AFGGSGGFGGSATGFGSGGGSFGGGNSG 145 Query: 625 GXXG 614 G Sbjct: 146 FGEG 149 Score = 55.2 bits (127), Expect = 7e-08 Identities = 29/70 (41%), Positives = 29/70 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G GGG G G G G GG GG G GG GG G GG G G Sbjct: 17 GFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGG 76 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 77 GNTCGSGFGG 86 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 6/85 (7%) Frame = -3 Query: 977 GXXGXGGGXX---GXGGGXXGGXGXXGXXXXXGGGX---GXGGGXGGGXGGGXGGXXXXG 816 G G GGG G GGG GG G GG G G G GG GG Sbjct: 70 GGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSA 129 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGG 741 G GG GGG G G G GGG Sbjct: 130 TGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/92 (35%), Positives = 33/92 (35%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G G G GG G G G GG Sbjct: 66 GGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATS-GFGSGEKSSAFGGSGG 124 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G G GGG GGG G G G G G Sbjct: 125 FGG--SATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 6/69 (8%) Frame = -1 Query: 985 GGG--GGXGXGGGXXGXXGGX---GXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGGGXX 824 GGG GG GG G G G G G G GG G G G G G GGG Sbjct: 85 GGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNS 144 Query: 823 XXGXXGXGG 797 G G GG Sbjct: 145 GFGEGGHGG 153 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G G G G G G G GGG G G G G GGG Sbjct: 103 GSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GG G G GG G GG G G G G Sbjct: 210 GGFGGGAGFGNNGGNDGFGGDGGFGGGEERG 240 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG 914 GGG G G GG G G G G G Sbjct: 213 GGGAGFGNNGGNDGFGGDGGFGGG 236 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG G G G G GG G GG G G GGG Sbjct: 207 GRTGGFGGGAGFGN-NGGNDGFGGDG---GFGGG 236 >AF000197-1|AAB52901.2| 763|Caenorhabditis elegans Germ-line helicase protein 1 protein. Length = 763 Score = 79.4 bits (187), Expect = 4e-15 Identities = 51/130 (39%), Positives = 51/130 (39%), Gaps = 8/130 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GGG GG G G G G G G G G GGG G GGG Sbjct: 22 GGFGGGNNGGSGFGGGKNGGTGFGGGNTG-GSGFGGGNTGGSGFGGGKTGGSGFGGGNTC 80 Query: 800 XGGXXGG--GGXGXGGGXXG-GGGXGXGGXGXG-----XGXGGGGGXXXXGXGGGXGXXG 645 G GG GG GG G GG G G G G GG G G G G G G Sbjct: 81 GSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFG 140 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 141 GGNSGFGEGG 150 Score = 73.7 bits (173), Expect = 2e-13 Identities = 51/129 (39%), Positives = 51/129 (39%), Gaps = 11/129 (8%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXXXXG 795 G G G G GGG GG G G GG G GGG G G GGG G GGG Sbjct: 17 GFGSGG-GFGGGNNGGSGFGGGK---NGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGS 72 Query: 794 GXXGG-------GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG--XXGX 642 G GG GG GG GG G GG G G G G GG G G Sbjct: 73 GFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGF 132 Query: 641 GXXGGXXGG 615 G GG GG Sbjct: 133 GSGGGSFGG 141 Score = 72.5 bits (170), Expect = 4e-13 Identities = 46/120 (38%), Positives = 46/120 (38%), Gaps = 3/120 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG--XGGGXGGGXGGXXXXGGGXX 804 G G GGG G G G G G GG G GGG G G GGG G GG Sbjct: 40 GGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASS 99 Query: 803 XXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G GG G G GGG GGG G G GG Sbjct: 100 GFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGG------SFGGGNSGFGEGGHGG 153 Score = 59.7 bits (138), Expect = 3e-09 Identities = 39/124 (31%), Positives = 39/124 (31%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GGG G G G G GG GG G GG GG G GG G G Sbjct: 27 GNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGG 86 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G GG G GG GG G G GG G Sbjct: 87 GSTGGSPYGGASSGFGGSTATSGFGSGEKSS-AFGGSGGFGGSATGFGSGGGSFGGGNSG 145 Query: 625 GXXG 614 G Sbjct: 146 FGEG 149 Score = 55.2 bits (127), Expect = 7e-08 Identities = 29/70 (41%), Positives = 29/70 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G GGG G G G G GG GG G GG GG G GG G G Sbjct: 17 GFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGG 76 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 77 GNTCGSGFGG 86 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 6/85 (7%) Frame = -3 Query: 977 GXXGXGGGXX---GXGGGXXGGXGXXGXXXXXGGGX---GXGGGXGGGXGGGXGGXXXXG 816 G G GGG G GGG GG G GG G G G GG GG Sbjct: 70 GGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSA 129 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGG 741 G GG GGG G G G GGG Sbjct: 130 TGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/92 (35%), Positives = 33/92 (35%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G G G GG G G G GG Sbjct: 66 GGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATS-GFGSGEKSSAFGGSGG 124 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G G GGG GGG G G G G G Sbjct: 125 FGG--SATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 6/69 (8%) Frame = -1 Query: 985 GGG--GGXGXGGGXXGXXGGX---GXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGGGXX 824 GGG GG GG G G G G G G GG G G G G G GGG Sbjct: 85 GGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNS 144 Query: 823 XXGXXGXGG 797 G G GG Sbjct: 145 GFGEGGHGG 153 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G G G G G G G GGG G G G G GGG Sbjct: 103 GSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNSGFGEGGHGGG 154 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GG G G GG G GG G G G G Sbjct: 210 GGFGGGAGFGNNGGNDGFGGDGGFGGGEERG 240 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG 914 GGG G G GG G G G G G Sbjct: 213 GGGAGFGNNGGNDGFGGDGGFGGG 236 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GG G G G G GG G GG G G GGG Sbjct: 207 GRTGGFGGGAGFGN-NGGNDGFGGDG---GFGGG 236 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 78.2 bits (184), Expect = 8e-15 Identities = 34/65 (52%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Frame = +1 Query: 724 PPXPXPPPPXX-PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP--PPXPPPXPXPPPX 894 PP P PPPP PPP P PPPP PP PPP PP PPP P PP PPP P P Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPPMPSYSPC 87 Query: 895 XXXXP 909 P Sbjct: 88 QSYAP 92 Score = 74.1 bits (174), Expect = 1e-13 Identities = 33/69 (47%), Positives = 33/69 (47%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P PPP P P P PP PPPP PPP P PPPP PP PPP Sbjct: 29 PCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPP---PPPPMPSYS 85 Query: 835 PXPPPXPPP 861 P P P Sbjct: 86 PCQSYAPAP 94 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/60 (45%), Positives = 27/60 (45%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PPP P PPPP P PP PP P PP PPP P PPP P P P P Sbjct: 27 PPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPPMPSYSP 86 Score = 63.7 bits (148), Expect = 2e-10 Identities = 31/68 (45%), Positives = 31/68 (45%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PPP PP PPP PP P P PP PP PPP P P PP PPP P Sbjct: 27 PPPCPPP----PPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPP----P 78 Query: 958 PPXPXXPP 981 PP P P Sbjct: 79 PPMPSYSP 86 Score = 61.3 bits (142), Expect = 1e-09 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P P P PP P P PP P PPPP PP P P P P Sbjct: 27 PPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPPMPSYSP 86 Query: 796 PXXXXPPP 819 P P Sbjct: 87 CQSYAPAP 94 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPP--PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P PP P PPP P P PP P PPPP PP P P PP P Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPP-PPPPMCP---PPPPPMPS 83 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 84 YSPCQSYAPAP 94 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P P P P P P PPPPP PP P Sbjct: 42 PLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPP 79 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 3/83 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXP---PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPX 785 P PP PP P P P PPPP PP P PP Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPP----------------PPP 71 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP 854 P PP P P P P Sbjct: 72 PMCPPPPPPMPSYSPCQSYAPAP 94 >D10877-1|BAA01645.1| 346|Caenorhabditis elegans hnRNP like protein protein. Length = 346 Score = 78.2 bits (184), Expect = 8e-15 Identities = 51/127 (40%), Positives = 51/127 (40%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG G GG GGG GG GG G G Sbjct: 208 GGRSRDGQRGGYNGGGGGGGGWGGPAQR--GGPGAYGGPGGGGQGGYGGDYGGGWGQQGG 265 Query: 797 GGXXGGGGX-----GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XG 639 GG G GG G G G GGGG G G GG GG G GGG G G G Sbjct: 266 GGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQG 325 Query: 638 XXGGXXG 618 GG G Sbjct: 326 GWGGQSG 332 Score = 60.5 bits (140), Expect = 2e-09 Identities = 40/104 (38%), Positives = 40/104 (38%), Gaps = 5/104 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 G GG GGG G GG G GG GGGG G GG GGG G GGG G Sbjct: 214 GQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGDYGGGWGQQGGG-GQGGWG 272 Query: 808 G----XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G G GGGGG Sbjct: 273 GPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGG 316 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G GGGG G GG G GG G Sbjct: 257 GGGWGQ-QGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGG 315 Query: 808 GXGGXGXGXGG 776 G GG G GG Sbjct: 316 GWGGQGQQQGG 326 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG GGG G GG G GGG G GG G G GG Sbjct: 279 GGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGG 329 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG G G G G GG GGGG G G GG G G Sbjct: 280 GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGG-GGGGWGGQGQQQGGWGGQSG 332 >AF038613-7|ABB51185.1| 308|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform c protein. Length = 308 Score = 78.2 bits (184), Expect = 8e-15 Identities = 51/127 (40%), Positives = 51/127 (40%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG G GG GGG GG GG G G Sbjct: 170 GGRSRDGQRGGYNGGGGGGGGWGGPAQR--GGPGAYGGPGGGGQGGYGGDYGGGWGQQGG 227 Query: 797 GGXXGGGGX-----GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XG 639 GG G GG G G G GGGG G G GG GG G GGG G G G Sbjct: 228 GGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQG 287 Query: 638 XXGGXXG 618 GG G Sbjct: 288 GWGGQSG 294 Score = 60.5 bits (140), Expect = 2e-09 Identities = 40/104 (38%), Positives = 40/104 (38%), Gaps = 5/104 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 G GG GGG G GG G GG GGGG G GG GGG G GGG G Sbjct: 176 GQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGDYGGGWGQQGGG-GQGGWG 234 Query: 808 G----XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G G GGGGG Sbjct: 235 GPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGG 278 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G GGGG G GG G GG G Sbjct: 219 GGGWGQ-QGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGG 277 Query: 808 GXGGXGXGXGG 776 G GG G GG Sbjct: 278 GWGGQGQQQGG 288 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG GGG G GG G GGG G GG G G GG Sbjct: 241 GGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGG 291 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG G G G G GG GGGG G G GG G G Sbjct: 242 GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGG-GGGGWGGQGQQQGGWGGQSG 294 >AF038613-5|AAB92051.1| 346|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform a protein. Length = 346 Score = 78.2 bits (184), Expect = 8e-15 Identities = 51/127 (40%), Positives = 51/127 (40%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG G GG GGG GG GG G G Sbjct: 208 GGRSRDGQRGGYNGGGGGGGGWGGPAQR--GGPGAYGGPGGGGQGGYGGDYGGGWGQQGG 265 Query: 797 GGXXGGGGX-----GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XG 639 GG G GG G G G GGGG G G GG GG G GGG G G G Sbjct: 266 GGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQG 325 Query: 638 XXGGXXG 618 GG G Sbjct: 326 GWGGQSG 332 Score = 60.5 bits (140), Expect = 2e-09 Identities = 40/104 (38%), Positives = 40/104 (38%), Gaps = 5/104 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 G GG GGG G GG G GG GGGG G GG GGG G GGG G Sbjct: 214 GQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGDYGGGWGQQGGG-GQGGWG 272 Query: 808 G----XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G G GGGGG Sbjct: 273 GPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGG 316 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G GGGG G GG G GG G Sbjct: 257 GGGWGQ-QGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGG 315 Query: 808 GXGGXGXGXGG 776 G GG G GG Sbjct: 316 GWGGQGQQQGG 326 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG GGG G GG G GGG G GG G G GG Sbjct: 279 GGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGG 329 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG G G G G GG GGGG G G GG G G Sbjct: 280 GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGG-GGGGWGGQGQQQGGWGGQSG 332 >AF038613-8|AAL02515.2| 309|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform b protein. Length = 309 Score = 76.2 bits (179), Expect = 3e-14 Identities = 53/124 (42%), Positives = 53/124 (42%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G GGG G GG GG G G G G G GG GGG GG G GGG Sbjct: 179 GGYNGGGGGGGGWGGPAQRGGPGAYG-----GPGGGGQGGYGGGNYGG-GWGQQGGGGQG 232 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XGXXG 630 GG G G G G GGGG G G GG GG G GGG G G G G Sbjct: 233 GWGGPQQQQG-GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWG 291 Query: 629 GXXG 618 G G Sbjct: 292 GQSG 295 Score = 73.7 bits (173), Expect = 2e-13 Identities = 52/130 (40%), Positives = 52/130 (40%), Gaps = 9/130 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG G GG GGG GG GG GG Sbjct: 170 GGRSRDGQRGGYNGGGGGGGGWGGPAQR--GGPGAYGGPGGGGQGGYGGGNYGGGW---- 223 Query: 797 GGXXGGGGXGXGGG---XXGGGGXGXGGXGXGXGXGG------GGGXXXXGXGGGXGXXG 645 G GGGG G GG GGGG G G G G GG GG GGG G G Sbjct: 224 -GQQGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGG 282 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 283 QGQQQGGWGG 292 Score = 60.1 bits (139), Expect = 2e-09 Identities = 41/103 (39%), Positives = 41/103 (39%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGG----GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 GGGGG G GG G G GG G G GG GGG G G GGG G GG Sbjct: 184 GGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGGNYGGGWGQQG--GGGQGGWGGPQQQQ 241 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G G GG GGGGG Sbjct: 242 GGGGWGQQGGGGQG------GWGGPQQQQQGGWGGPQQGGGGG 278 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/105 (38%), Positives = 40/105 (38%), Gaps = 6/105 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 G GG GGG G GG G GG GGGG G GG GGG G GGG G Sbjct: 176 GQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGGNYGGGWGQQGGG-GQGGW 234 Query: 811 XG----XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G G GGGGG Sbjct: 235 GGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGG 279 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G GGGG G GG G GG G Sbjct: 220 GGGWGQ-QGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGG 278 Query: 808 GXGGXGXGXGG 776 G GG G GG Sbjct: 279 GWGGQGQQQGG 289 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG GGG G GG G GGG G GG G G GG Sbjct: 242 GGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGG 292 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG G G G G GG GGGG G G GG G G Sbjct: 243 GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGG-GGGGWGGQGQQQGGWGGQSG 295 >AF038613-6|ABB51186.1| 347|Caenorhabditis elegans Human hnrnp a1 homolog protein1, isoform d protein. Length = 347 Score = 76.2 bits (179), Expect = 3e-14 Identities = 53/124 (42%), Positives = 53/124 (42%), Gaps = 3/124 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G GGG G GG GG G G G G G GG GGG GG G GGG Sbjct: 217 GGYNGGGGGGGGWGGPAQRGGPGAYG-----GPGGGGQGGYGGGNYGG-GWGQQGGGGQG 270 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG--XGXXG 630 GG G G G G GGGG G G GG GG G GGG G G G G Sbjct: 271 GWGGPQQQQG-GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWG 329 Query: 629 GXXG 618 G G Sbjct: 330 GQSG 333 Score = 73.7 bits (173), Expect = 2e-13 Identities = 52/130 (40%), Positives = 52/130 (40%), Gaps = 9/130 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG G GG GGG GG GG GG Sbjct: 208 GGRSRDGQRGGYNGGGGGGGGWGGPAQR--GGPGAYGGPGGGGQGGYGGGNYGGGW---- 261 Query: 797 GGXXGGGGXGXGGG---XXGGGGXGXGGXGXGXGXGG------GGGXXXXGXGGGXGXXG 645 G GGGG G GG GGGG G G G G GG GG GGG G G Sbjct: 262 -GQQGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGG 320 Query: 644 XGXXGGXXGG 615 G G GG Sbjct: 321 QGQQQGGWGG 330 Score = 60.1 bits (139), Expect = 2e-09 Identities = 41/103 (39%), Positives = 41/103 (39%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGG----GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 GGGGG G GG G G GG G G GG GGG G G GGG G GG Sbjct: 222 GGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGGNYGGGWGQQG--GGGQGGWGGPQQQQ 279 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G G G GG GGGGG Sbjct: 280 GGGGWGQQGGGGQG------GWGGPQQQQQGGWGGPQQGGGGG 316 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/105 (38%), Positives = 40/105 (38%), Gaps = 6/105 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGX 812 G GG GGG G GG G GG GGGG G GG GGG G GGG G Sbjct: 214 GQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGGNYGGGWGQQGGG-GQGGW 272 Query: 811 XG----XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G G GGGGG Sbjct: 273 GGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGG 317 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-XGGGXGXXGGGXXXXGXX 809 GGG G GGG G GG G G GGGG G GG G GG G Sbjct: 258 GGGWGQ-QGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGG 316 Query: 808 GXGGXGXGXGG 776 G GG G GG Sbjct: 317 GWGGQGQQQGG 327 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG GGG G GG G GGG G GG G G GG Sbjct: 280 GGGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGGGGGGWGGQGQQQGGWGG 330 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG G G G G GG GGGG G G GG G G Sbjct: 281 GGGWGQQGGGGQGGWGGPQQQQQGGWGGPQQGG-GGGGWGGQGQQQGGWGGQSG 333 >U60449-1|AAB03510.1| 974|Caenorhabditis elegans GLH-2 protein. Length = 974 Score = 75.4 bits (177), Expect = 6e-14 Identities = 39/96 (40%), Positives = 39/96 (40%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G GG G G G G G G Sbjct: 154 GGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHE 213 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GG G GGG GG G G GG G G GGGG Sbjct: 214 SGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGG 249 Score = 73.7 bits (173), Expect = 2e-13 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 74 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA 133 Query: 797 GGXXGG----GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG G G G GG G G GG G G G GG G G GG G G Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTG-FGSGKAGGTGFGGNS 192 Query: 638 XXGGXXG 618 G G Sbjct: 193 NSGSGFG 199 Score = 72.1 bits (169), Expect = 6e-13 Identities = 45/126 (35%), Positives = 45/126 (35%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 84 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNA 143 Query: 797 GGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 144 GGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLT 203 Query: 632 GGXXGG 615 G G Sbjct: 204 NGFGSG 209 Score = 71.7 bits (168), Expect = 7e-13 Identities = 47/129 (36%), Positives = 47/129 (36%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG--GGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G G G GG GG G G GG G G G GG G G G G G Sbjct: 41 GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGS 100 Query: 806 XXXGGXXGG----GGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G GG G G G G G G G GG G G Sbjct: 101 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGS 160 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 161 GNAGGTGFG 169 Score = 71.3 bits (167), Expect = 1e-12 Identities = 43/122 (35%), Positives = 43/122 (35%), Gaps = 1/122 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 114 GGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA 173 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G G G G G G G GG G G G GG Sbjct: 174 GGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSG 233 Query: 620 GG 615 G Sbjct: 234 FG 235 Score = 70.1 bits (164), Expect = 2e-12 Identities = 48/123 (39%), Positives = 48/123 (39%), Gaps = 7/123 (5%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G GG G G G GG G G G G G GG Sbjct: 69 GNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGF 128 Query: 782 G----GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G GG G G G GG G G GG G G G GG G G GG G G G GG Sbjct: 129 GSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTG-FGSGKAGGTG-FGSGKAGGT 186 Query: 623 XGG 615 G Sbjct: 187 GFG 189 Score = 68.9 bits (161), Expect = 5e-12 Identities = 46/125 (36%), Positives = 46/125 (36%), Gaps = 8/125 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 124 GGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKA 183 Query: 797 GGXXGGG----GXGXGGGXXGGGGXGXG---GXGXGXGXG-GGGGXXXXGXGGGXGXXGX 642 GG GG G G G G G G G G G G G GGG G G G G Sbjct: 184 GGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGF 243 Query: 641 GXXGG 627 G GG Sbjct: 244 GSGGG 248 Score = 68.9 bits (161), Expect = 5e-12 Identities = 44/121 (36%), Positives = 44/121 (36%), Gaps = 4/121 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXX 801 G G G G G G G G G GG G G G GG G G G G GG Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSN 193 Query: 800 XGGXXGGG---GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G G G G G G G G GG G G G G G G Sbjct: 194 SGSGFGSGLTNGFGSGNNHESGFGGGKSG-GFGGGNSGGSGFGSGGNSNGFGSGGGGQDR 252 Query: 629 G 627 G Sbjct: 253 G 253 Score = 67.7 bits (158), Expect = 1e-11 Identities = 45/128 (35%), Positives = 45/128 (35%), Gaps = 7/128 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG--GXGGGXGGXXXXGGGXX 804 G G G G G G G G G GG G G G G G G G G G G Sbjct: 104 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNA 163 Query: 803 XXGGXXGG--GGXGXGGGXXGG---GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G G G GG GG G G G G G G G G G Sbjct: 164 GGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGG 223 Query: 638 XXGGXXGG 615 GG GG Sbjct: 224 FGGGNSGG 231 Score = 66.9 bits (156), Expect = 2e-11 Identities = 44/126 (34%), Positives = 44/126 (34%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G GG G G G GG G G G G G Sbjct: 54 GGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA 113 Query: 797 GGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 114 GGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA 173 Query: 632 GGXXGG 615 GG G Sbjct: 174 GGTGFG 179 Score = 66.5 bits (155), Expect = 3e-11 Identities = 48/129 (37%), Positives = 48/129 (37%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG------XGGGXGGGXGGXXXX 819 GG G G G G G G G G GG G GG G G GG G Sbjct: 25 GGGSGFGSGNTGGFGS--GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGN 82 Query: 818 GGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G G G G GG G G G GG G G GG G G Sbjct: 83 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTG-FGSGNAGGTG-LGS 140 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 141 GNAGGTGFG 149 Score = 64.5 bits (150), Expect = 1e-10 Identities = 41/115 (35%), Positives = 41/115 (35%), Gaps = 1/115 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G G GG G G G G GG G G G G G Sbjct: 23 GFGGGS-GFGSGNTGGFGS-GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGS 80 Query: 788 XGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G G G G G G G GG G G G GG Sbjct: 81 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGG 135 Score = 64.5 bits (150), Expect = 1e-10 Identities = 44/127 (34%), Positives = 44/127 (34%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G G GG G G G G G Sbjct: 36 GGFGSGNAGGTGFGSSNNGGSGFGGNNNV---GPRFGNGNAGGTGFGSGNAGGTGFGSGN 92 Query: 800 XGGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 93 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGN 152 Query: 635 XGGXXGG 615 GG G Sbjct: 153 AGGTGFG 159 Score = 60.1 bits (139), Expect = 2e-09 Identities = 39/117 (33%), Positives = 39/117 (33%), Gaps = 1/117 (0%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GGG G G G G G G GG G G G G Sbjct: 18 GSNPSGFGGGSGFGSGNTG-----GFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGN 72 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G GG G G G G G G G GG G G G GG G Sbjct: 73 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFG 129 Score = 54.8 bits (126), Expect = 9e-08 Identities = 42/135 (31%), Positives = 42/135 (31%), Gaps = 11/135 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGGGXXXX 818 G GG G G G G G G G G G GG G G GG G G G GG Sbjct: 91 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGS 150 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGG-------GGXXXXXXGXGX 659 G G G G G G G GG GG G G G Sbjct: 151 GNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGN 210 Query: 658 XXXXGXGGXXGGXXG 614 G GG G G Sbjct: 211 NHESGFGGGKSGGFG 225 Score = 53.6 bits (123), Expect = 2e-07 Identities = 40/128 (31%), Positives = 40/128 (31%), Gaps = 7/128 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGG---GX 827 G GG G G G G G G G G G GG G G GG G G G GG G Sbjct: 121 GNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGS 180 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXX 647 G G GG G GG GG GG G G Sbjct: 181 GKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNS 240 Query: 646 GXGGXXGG 623 G GG Sbjct: 241 NGFGSGGG 248 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG--GXXXXGX 812 G GG G G G G G G G GG G G GG G G G G Sbjct: 131 GNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGG 190 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G G G G G GG G GG G G GG Sbjct: 191 NSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGGQ 250 Query: 631 XGG 623 G Sbjct: 251 DRG 253 Score = 51.6 bits (118), Expect = 8e-07 Identities = 42/136 (30%), Positives = 42/136 (30%), Gaps = 12/136 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGG---------GXGXXGGXGGGXGX 842 G GGG G G G G G G G G GG G G G G GG G G G Sbjct: 23 GFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGN 82 Query: 841 XGGGXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXG 662 GG G G G G G G G GG G G G G Sbjct: 83 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA-GGTGLGSG 141 Query: 661 XXXXXGXGGXXGGXXG 614 G G G G Sbjct: 142 NAGGTGFGSGNAGGTG 157 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GG G GGG G G G G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSG-NNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G GG G GGG GGG G G G G G GG G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 42.3 bits (95), Expect = 5e-04 Identities = 38/131 (29%), Positives = 38/131 (29%), Gaps = 8/131 (6%) Frame = -1 Query: 982 GGGGXGXGGG---XXGXXGGXGXG-XGXXXXGGXGGGGXGXXG----GXGGGXGXXGGGX 827 G G GGG G GG G G G G GG G G G G G GG Sbjct: 18 GSNPSGFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTG 77 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXX 647 G G G G G G G GG G G G G Sbjct: 78 FGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA-GGTGFGSGNAGGT 136 Query: 646 GXGGXXGGXXG 614 G G G G Sbjct: 137 GLGSGNAGGTG 147 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX-GXGGGGGXXX 678 G G GG GGG G G G G G G G G GG G G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQD 365 Query: 677 XG 672 G Sbjct: 366 RG 367 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GG G GGG GG G G G G G G GG G G G G Sbjct: 306 GRNGFTGG-SSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQ 364 Query: 707 GXG 699 G Sbjct: 365 DRG 367 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GGG GG G G G G G G G G GG G G G G Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXG 645 GG GG GGG G G G G G G G G GG GG G GGG G Sbjct: 312 GGSSGFGG-GNGGGTGFDSGLTNGFGSGNNGES-GFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 979 GGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GGG G G G G G G G G G GG G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFG-SGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G GGG G G G G G G G G GG G G G GG G Sbjct: 313 GSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSG--GFGGNSNGFGSGGGGQDRG 367 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GGG G G G G GG GG G G GG Sbjct: 320 GNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXX--GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG G GG G G G G G G G G GG G G G Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNG------FGS 359 Query: 802 GGXGXGXG 779 GG G G Sbjct: 360 GGGGQDRG 367 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG G GGG G G G G G G GG G G G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFG-GNSNGFGSGGG 362 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGG G G G G G G G G G G GG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G G GG G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGS--GGFGGNSNGFGSGGGG 363 Query: 737 XGXG 726 G Sbjct: 364 QDRG 367 >U60194-1|AAB03337.1| 974|Caenorhabditis elegans RNA helicase GLH-2 protein. Length = 974 Score = 75.4 bits (177), Expect = 6e-14 Identities = 39/96 (40%), Positives = 39/96 (40%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G GG G G G G G G Sbjct: 154 GGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHE 213 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GG G GGG GG G G GG G G GGGG Sbjct: 214 SGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGG 249 Score = 73.7 bits (173), Expect = 2e-13 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 74 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA 133 Query: 797 GGXXGG----GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG G G G GG G G GG G G G GG G G GG G G Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTG-FGSGKAGGTGFGGNS 192 Query: 638 XXGGXXG 618 G G Sbjct: 193 NSGSGFG 199 Score = 72.1 bits (169), Expect = 6e-13 Identities = 45/126 (35%), Positives = 45/126 (35%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 84 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNA 143 Query: 797 GGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 144 GGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLT 203 Query: 632 GGXXGG 615 G G Sbjct: 204 NGFGSG 209 Score = 71.7 bits (168), Expect = 7e-13 Identities = 47/129 (36%), Positives = 47/129 (36%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG--GGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G G G GG GG G G GG G G G GG G G G G G Sbjct: 41 GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGS 100 Query: 806 XXXGGXXGG----GGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G GG G G G G G G G GG G G Sbjct: 101 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGS 160 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 161 GNAGGTGFG 169 Score = 71.3 bits (167), Expect = 1e-12 Identities = 43/122 (35%), Positives = 43/122 (35%), Gaps = 1/122 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 114 GGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA 173 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G G G G G G G GG G G G GG Sbjct: 174 GGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSG 233 Query: 620 GG 615 G Sbjct: 234 FG 235 Score = 70.1 bits (164), Expect = 2e-12 Identities = 48/123 (39%), Positives = 48/123 (39%), Gaps = 7/123 (5%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G GG G G G GG G G G G G GG Sbjct: 69 GNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGF 128 Query: 782 G----GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G GG G G G GG G G GG G G G GG G G GG G G G GG Sbjct: 129 GSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTG-FGSGKAGGTG-FGSGKAGGT 186 Query: 623 XGG 615 G Sbjct: 187 GFG 189 Score = 68.9 bits (161), Expect = 5e-12 Identities = 46/125 (36%), Positives = 46/125 (36%), Gaps = 8/125 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 124 GGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKA 183 Query: 797 GGXXGGG----GXGXGGGXXGGGGXGXG---GXGXGXGXG-GGGGXXXXGXGGGXGXXGX 642 GG GG G G G G G G G G G G G GGG G G G G Sbjct: 184 GGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGF 243 Query: 641 GXXGG 627 G GG Sbjct: 244 GSGGG 248 Score = 68.9 bits (161), Expect = 5e-12 Identities = 44/121 (36%), Positives = 44/121 (36%), Gaps = 4/121 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXX 801 G G G G G G G G G GG G G G GG G G G G GG Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSN 193 Query: 800 XGGXXGGG---GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G G G G G G G G GG G G G G G G Sbjct: 194 SGSGFGSGLTNGFGSGNNHESGFGGGKSG-GFGGGNSGGSGFGSGGNSNGFGSGGGGQDR 252 Query: 629 G 627 G Sbjct: 253 G 253 Score = 67.7 bits (158), Expect = 1e-11 Identities = 45/128 (35%), Positives = 45/128 (35%), Gaps = 7/128 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG--GXGGGXGGXXXXGGGXX 804 G G G G G G G G G GG G G G G G G G G G G Sbjct: 104 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNA 163 Query: 803 XXGGXXGG--GGXGXGGGXXGG---GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G G G GG GG G G G G G G G G G Sbjct: 164 GGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGG 223 Query: 638 XXGGXXGG 615 GG GG Sbjct: 224 FGGGNSGG 231 Score = 66.9 bits (156), Expect = 2e-11 Identities = 44/126 (34%), Positives = 44/126 (34%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G GG G G G GG G G G G G Sbjct: 54 GGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA 113 Query: 797 GGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 114 GGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA 173 Query: 632 GGXXGG 615 GG G Sbjct: 174 GGTGFG 179 Score = 66.5 bits (155), Expect = 3e-11 Identities = 48/129 (37%), Positives = 48/129 (37%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG------XGGGXGGGXGGXXXX 819 GG G G G G G G G G GG G GG G G GG G Sbjct: 25 GGGSGFGSGNTGGFGS--GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGN 82 Query: 818 GGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G G G G GG G G G GG G G GG G G Sbjct: 83 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTG-FGSGNAGGTG-LGS 140 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 141 GNAGGTGFG 149 Score = 64.5 bits (150), Expect = 1e-10 Identities = 41/115 (35%), Positives = 41/115 (35%), Gaps = 1/115 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G G GG G G G G GG G G G G G Sbjct: 23 GFGGGS-GFGSGNTGGFGS-GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGS 80 Query: 788 XGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G G G G G G G GG G G G GG Sbjct: 81 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGG 135 Score = 64.5 bits (150), Expect = 1e-10 Identities = 44/127 (34%), Positives = 44/127 (34%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G G GG G G G G G Sbjct: 36 GGFGSGNAGGTGFGSSNNGGSGFGGNNNV---GPRFGNGNAGGTGFGSGNAGGTGFGSGN 92 Query: 800 XGGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 93 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGN 152 Query: 635 XGGXXGG 615 GG G Sbjct: 153 AGGTGFG 159 Score = 60.1 bits (139), Expect = 2e-09 Identities = 39/117 (33%), Positives = 39/117 (33%), Gaps = 1/117 (0%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GGG G G G G G G GG G G G G Sbjct: 18 GSNPSGFGGGSGFGSGNTG-----GFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGN 72 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G GG G G G G G G G GG G G G GG G Sbjct: 73 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFG 129 Score = 54.8 bits (126), Expect = 9e-08 Identities = 42/135 (31%), Positives = 42/135 (31%), Gaps = 11/135 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGGGXXXX 818 G GG G G G G G G G G G GG G G GG G G G GG Sbjct: 91 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGLGSGNAGGTGFGS 150 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGG-------GGXXXXXXGXGX 659 G G G G G G G GG GG G G G Sbjct: 151 GNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGN 210 Query: 658 XXXXGXGGXXGGXXG 614 G GG G G Sbjct: 211 NHESGFGGGKSGGFG 225 Score = 53.6 bits (123), Expect = 2e-07 Identities = 40/128 (31%), Positives = 40/128 (31%), Gaps = 7/128 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGG---GX 827 G GG G G G G G G G G G GG G G GG G G G GG G Sbjct: 121 GNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGS 180 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXX 647 G G GG G GG GG GG G G Sbjct: 181 GKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNS 240 Query: 646 GXGGXXGG 623 G GG Sbjct: 241 NGFGSGGG 248 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG--GXXXXGX 812 G GG G G G G G G G GG G G GG G G G G Sbjct: 131 GNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGG 190 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G G G G G GG G GG G G GG Sbjct: 191 NSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGGQ 250 Query: 631 XGG 623 G Sbjct: 251 DRG 253 Score = 51.6 bits (118), Expect = 8e-07 Identities = 42/136 (30%), Positives = 42/136 (30%), Gaps = 12/136 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGG---------GXGXXGGXGGGXGX 842 G GGG G G G G G G G G GG G G G G GG G G G Sbjct: 23 GFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGN 82 Query: 841 XGGGXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXG 662 GG G G G G G G G GG G G G G Sbjct: 83 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA-GGTGLGSG 141 Query: 661 XXXXXGXGGXXGGXXG 614 G G G G Sbjct: 142 NAGGTGFGSGNAGGTG 157 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GG G GGG G G G G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSG-NNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G GG G GGG GGG G G G G G GG G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 42.3 bits (95), Expect = 5e-04 Identities = 38/131 (29%), Positives = 38/131 (29%), Gaps = 8/131 (6%) Frame = -1 Query: 982 GGGGXGXGGG---XXGXXGGXGXG-XGXXXXGGXGGGGXGXXG----GXGGGXGXXGGGX 827 G G GGG G GG G G G G GG G G G G G GG Sbjct: 18 GSNPSGFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTG 77 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXX 647 G G G G G G G GG G G G G Sbjct: 78 FGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNA-GGTGFGSGNAGGT 136 Query: 646 GXGGXXGGXXG 614 G G G G Sbjct: 137 GLGSGNAGGTG 147 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX-GXGGGGGXXX 678 G G GG GGG G G G G G G G G GG G G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQD 365 Query: 677 XG 672 G Sbjct: 366 RG 367 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GG G GGG GG G G G G G G GG G G G G Sbjct: 306 GRNGFTGG-SSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQ 364 Query: 707 GXG 699 G Sbjct: 365 DRG 367 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GGG GG G G G G G G G G GG G G G G Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXG 645 GG GG GGG G G G G G G G G GG GG G GGG G Sbjct: 312 GGSSGFGG-GNGGGTGFDSGLTNGFGSGNNGES-GFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 979 GGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GGG G G G G G G G G G GG G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFG-SGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G GGG G G G G G G G G GG G G G GG G Sbjct: 313 GSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSG--GFGGNSNGFGSGGGGQDRG 367 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GGG G G G G GG GG G G GG Sbjct: 320 GNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXX--GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG G GG G G G G G G G G GG G G G Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNG------FGS 359 Query: 802 GGXGXGXG 779 GG G G Sbjct: 360 GGGGQDRG 367 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG G GGG G G G G G G GG G G G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFG-GNSNGFGSGGG 362 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGG G G G G G G G G G G GG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G G GG G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGS--GGFGGNSNGFGSGGGG 363 Query: 737 XGXG 726 G Sbjct: 364 QDRG 367 >AC006625-11|AAK68269.1| 974|Caenorhabditis elegans Germ-line helicase protein 2 protein. Length = 974 Score = 75.4 bits (177), Expect = 6e-14 Identities = 39/96 (40%), Positives = 39/96 (40%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G GG G G G G G G Sbjct: 154 GGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHE 213 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GG G GGG GG G G GG G G GGGG Sbjct: 214 SGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGG 249 Score = 74.5 bits (175), Expect = 1e-13 Identities = 46/126 (36%), Positives = 46/126 (36%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G GGG GG G G G G G Sbjct: 84 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNAGGTGLGSGNA 143 Query: 797 GGXXGG----GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 GG G GG G G G GG G G G G G G G GG G G G Sbjct: 144 GGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLT 203 Query: 632 GGXXGG 615 G G Sbjct: 204 NGFGSG 209 Score = 74.1 bits (174), Expect = 1e-13 Identities = 48/129 (37%), Positives = 48/129 (37%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXG--GGXGXGGGXGGGXGGGXGGXXXXGGGX 807 G G G G GG GG G G GG G G G GG G G G G G Sbjct: 41 GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGS 100 Query: 806 XXXGGXXGG----GGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G GGG GG G G G G G G G GG G G Sbjct: 101 GNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGS 160 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 161 GNAGGTGFG 169 Score = 73.7 bits (173), Expect = 2e-13 Identities = 48/127 (37%), Positives = 48/127 (37%), Gaps = 7/127 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 74 GGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNA 133 Query: 797 GGXXGG----GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG G G G GG G G GG G G G GG G G GG G G Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTG-FGSGKAGGTGFGGNS 192 Query: 638 XXGGXXG 618 G G Sbjct: 193 NSGSGFG 199 Score = 73.7 bits (173), Expect = 2e-13 Identities = 44/122 (36%), Positives = 44/122 (36%), Gaps = 1/122 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG G G G G G GG G G G GG G G G G G Sbjct: 114 GGTGFGGGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA 173 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G G G G G G G GG G G G GG Sbjct: 174 GGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSG 233 Query: 620 GG 615 G Sbjct: 234 FG 235 Score = 71.7 bits (168), Expect = 7e-13 Identities = 51/128 (39%), Positives = 51/128 (39%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G GG G G G G G G G G G G G GGG Sbjct: 65 GPRFGNGNAGGTGFGSGNAGGTGF-GSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNA 123 Query: 803 XXGGXXGG--GGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G G G GG G G GG G G G GG G G GG G G G Sbjct: 124 GGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTG-FGSGKAGGTG-FGSG 181 Query: 638 XXGGXXGG 615 GG G Sbjct: 182 KAGGTGFG 189 Score = 69.3 bits (162), Expect = 4e-12 Identities = 45/126 (35%), Positives = 45/126 (35%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GGG GG G G G G G G G G G G G G G Sbjct: 107 GFGSGNAGGTGFGGGNAGGTGF-GSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGG 165 Query: 797 GGXXGG--GGXGXGGGXXGG---GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G GG G G G GG GG G G G G G G G G G Sbjct: 166 TGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFG 225 Query: 632 GGXXGG 615 GG GG Sbjct: 226 GGNSGG 231 Score = 68.9 bits (161), Expect = 5e-12 Identities = 46/125 (36%), Positives = 46/125 (36%), Gaps = 8/125 (6%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG G G G GG G G G G G Sbjct: 124 GGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKA 183 Query: 797 GGXXGGG----GXGXGGGXXGGGGXGXG---GXGXGXGXG-GGGGXXXXGXGGGXGXXGX 642 GG GG G G G G G G G G G G G GGG G G G G Sbjct: 184 GGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGF 243 Query: 641 GXXGG 627 G GG Sbjct: 244 GSGGG 248 Score = 68.9 bits (161), Expect = 5e-12 Identities = 44/121 (36%), Positives = 44/121 (36%), Gaps = 4/121 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXX 801 G G G G G G G G G GG G G G GG G G G G GG Sbjct: 134 GGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSN 193 Query: 800 XGGXXGGG---GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G G G G G G G G G GG G G G G G G Sbjct: 194 SGSGFGSGLTNGFGSGNNHESGFGGGKSG-GFGGGNSGGSGFGSGGNSNGFGSGGGGQDR 252 Query: 629 G 627 G Sbjct: 253 G 253 Score = 68.1 bits (159), Expect = 9e-12 Identities = 46/127 (36%), Positives = 46/127 (36%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G G G GG G G G G G G G G G G G G G Sbjct: 54 GGSGFGGNNNVGPRFGNGNAGGTGF-GSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGN 112 Query: 806 XXXGGXXGG--GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GG GG G G G GG G G G G G G G GG G G G Sbjct: 113 AGGTGFGGGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGK 172 Query: 635 XGGXXGG 615 GG G Sbjct: 173 AGGTGFG 179 Score = 66.9 bits (156), Expect = 2e-11 Identities = 42/115 (36%), Positives = 42/115 (36%), Gaps = 1/115 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G G GG G G G G GG G G G G G Sbjct: 23 GFGGGS-GFGSGNTGGFGS-GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGS 80 Query: 788 XGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G GG G G G G G G G GG G G G G GG Sbjct: 81 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNAGG 135 Score = 66.5 bits (155), Expect = 3e-11 Identities = 48/129 (37%), Positives = 48/129 (37%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGG------XGGGXGGGXGGXXXX 819 GG G G G G G G G G GG G GG G G GG G Sbjct: 25 GGGSGFGSGNTGGFGS--GNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGN 82 Query: 818 GGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G G G G GG G G G GG G G GG G G Sbjct: 83 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTG-FGSGNAGGTG-LGS 140 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 141 GNAGGTGFG 149 Score = 65.3 bits (152), Expect = 6e-11 Identities = 48/129 (37%), Positives = 48/129 (37%), Gaps = 7/129 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G G GG G G G G G Sbjct: 36 GGFGSGNAGGTGFGSSNNGGSGFGGNNNV---GPRFGNGNAGGTGFGSGNAGGTGFGSGN 92 Query: 800 XGGXXGG----GGXGXGGGXXGG---GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG G GG G G G GG GG GG G G G GG G G GG G G Sbjct: 93 AGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNAGGTG-LGSGNAGGTG-FGS 150 Query: 641 GXXGGXXGG 615 G GG G Sbjct: 151 GNAGGTGFG 159 Score = 60.5 bits (140), Expect = 2e-09 Identities = 42/117 (35%), Positives = 42/117 (35%), Gaps = 1/117 (0%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GGG G G G G G G GG G G G G Sbjct: 18 GSNPSGFGGGSGFGSGNTG-----GFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGN 72 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G G G GG G G G G G G G GG G G G G G GG GG Sbjct: 73 AGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGG---TGFGSG-NAGGTGFGGGNAGG 125 Score = 54.8 bits (126), Expect = 9e-08 Identities = 40/128 (31%), Positives = 40/128 (31%), Gaps = 4/128 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG-GXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGGGXXXX 818 G GG G G G G G G G G G GG G G GG G G G GG Sbjct: 71 GNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGS 130 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXG 638 G G G G G G G GG G G G G G G Sbjct: 131 GNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKA-GGTGFGSGKAGGTGFG 189 Query: 637 GXXGGXXG 614 G G Sbjct: 190 GNSNSGSG 197 Score = 52.8 bits (121), Expect = 4e-07 Identities = 40/127 (31%), Positives = 40/127 (31%), Gaps = 3/127 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GGG G G G G G G G G GG G GG G G G GG G Sbjct: 23 GFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGN-GNAGGTGFGSG 81 Query: 814 XXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G G G G G G GG GGG G G G G Sbjct: 82 NAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNA-GGTGFGSGNAGGTGLGS 140 Query: 634 XXGGXXG 614 G G Sbjct: 141 GNAGGTG 147 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 2/123 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG--GXXXXGX 812 G GG G G G G G G G GG G G GG G G G G Sbjct: 131 GNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGG 190 Query: 811 XGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGX 632 G G G G G GG G GG G G GG Sbjct: 191 NSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGGQ 250 Query: 631 XGG 623 G Sbjct: 251 DRG 253 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GG G GGG G G G G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSG-NNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G GG G GGG GGG G G G G G GG G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX-GXGGGGGXXX 678 G G GG GGG G G G G G G G G GG G G G GGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQD 365 Query: 677 XG 672 G Sbjct: 366 RG 367 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G G GG G GGG GG G G G G G G GG G G G G Sbjct: 306 GRNGFTGG-SSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQ 364 Query: 707 GXG 699 G Sbjct: 365 DRG 367 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GGG GG G G G G G G G G GG G G G G Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXG 645 GG GG GGG G G G G G G G G GG GG G GGG G Sbjct: 312 GGSSGFGG-GNGGGTGFDSGLTNGFGSGNNGES-GFGSGGFGGNSNGFGSGGGGQDRG 367 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -1 Query: 979 GGGXGXGGGXXGXXG---GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GGG G G G G G G G G G GG G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFG-SGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G GGG G G G G G G G G GG G G G GG G Sbjct: 313 GSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSG--GFGGNSNGFGSGGGGQDRG 367 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GGG G G G G GG GG G G GG Sbjct: 320 GNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGG 363 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXX--GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG G GG G G G G G G G G GG G G G Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNG------FGS 359 Query: 802 GGXGXGXG 779 GG G G Sbjct: 360 GGGGQDRG 367 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG G GGG G G G G G G GG G G G G GGG Sbjct: 312 GGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFG-GNSNGFGSGGG 362 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGG G G G G G G G G G G GG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGG 362 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G G GG G G G G G GG G G GGGG Sbjct: 306 GRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGS--GGFGGNSNGFGSGGGG 363 Query: 737 XGXG 726 G Sbjct: 364 QDRG 367 >Z78413-7|CAB01657.1| 352|Caenorhabditis elegans Hypothetical protein T01C3.7 protein. Length = 352 Score = 74.5 bits (175), Expect = 1e-13 Identities = 43/106 (40%), Positives = 43/106 (40%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GG G G GG G GGG G GGG G G G GG G Sbjct: 9 GGGGGGFRGGRGGDRGGSRGGFGGGGRGGYGGGDRGSFGGGDRGGFRGGRGGGDRGGFRG 68 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G GG GG G GG G GG G G GG G G Sbjct: 69 GRGGGDRGG-FGGRGSPRGGFGGRGSPRGGRGSPRGGRGGAGGMRG 113 Score = 72.9 bits (171), Expect = 3e-13 Identities = 44/105 (41%), Positives = 44/105 (41%), Gaps = 2/105 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGGXXXXGGGXX 804 GG G GG G GG GG G G GG G GGG GG GG GG G Sbjct: 10 GGGGGFRGGRGGDRGGSRGGFGGGGRGGYGGGDRGSFGGGDRGGFRGGRGGGDRGGFRGG 69 Query: 803 XXGGXXGG-GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GG GG GG G G GG G GG G G GG G G Sbjct: 70 RGGGDRGGFGGRGSPRGGFGGRGSPRGGRGSPRGGRGGAGGMRGG 114 Score = 72.5 bits (170), Expect = 4e-13 Identities = 45/111 (40%), Positives = 45/111 (40%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG GG G G G GGG GG GGG G G GG GG G Sbjct: 10 GGGGGFRGGRGGD----RGGSRGGFGGGGRGGYGGGDRGSFGGGDRGGFRGGRGGGDRGG 65 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GG G GG G G GG G G G G G G GG GG Sbjct: 66 FRGGRGGGDRGGFGGRGSPRGGFGGRGSPRGGRGSPRG--GRGGAGGMRGG 114 Score = 58.4 bits (135), Expect = 7e-09 Identities = 36/84 (42%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GGG GG GG GG GG GGG G GGG G G G G G GG G Sbjct: 9 GGGGGGFRGGRGGDRGG--SRGGFGGGGRGGYGGGDRGSFGGGDRGGFRGGRGGGDRGGF 66 Query: 680 XXGXGGG--XGXXGXGXXGGXXGG 615 G GGG G G G G GG Sbjct: 67 RGGRGGGDRGGFGGRGSPRGGFGG 90 Score = 58.0 bits (134), Expect = 1e-08 Identities = 36/99 (36%), Positives = 36/99 (36%), Gaps = 2/99 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG--XGGGXGXXGGGXXXXGXX 809 GGGG G GG G GG G G GG GGG G GG GG G GGG Sbjct: 9 GGGGGGFRGGRGGDRGGSRGGFGGGGRGGYGGGDRGSFGGGDRGGFRGGRGGGDRGGFRG 68 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGG 692 G GG G G G G G GG Sbjct: 69 GRGGGDRGGFGGRGSPRGGFGGRGSPRGGRGSPRGGRGG 107 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/70 (41%), Positives = 29/70 (41%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G GG GGG G G GG G G G Sbjct: 31 GGGGRGGYGGGDRGSFGGGDRG---GFRGGRGGGDRGGFRGGRGGGDRGGFGGRGSPRGG 87 Query: 805 XGGXGXGXGG 776 GG G GG Sbjct: 88 FGGRGSPRGG 97 >U41557-2|AAA83301.1| 309|Caenorhabditis elegans Hypothetical protein C50F7.5 protein. Length = 309 Score = 73.7 bits (173), Expect = 2e-13 Identities = 41/117 (35%), Positives = 41/117 (35%), Gaps = 2/117 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P PP P P P Sbjct: 162 PSVEPSEDPQPSGP-PSPGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSED 220 Query: 796 PXXXXPPPXXXXPPXPPPXP--PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP P P P PP PP P PP P P PP PP P PP Sbjct: 221 PKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGPPTRRPPGP--PGPPTRRPPGPPGPP 275 Score = 68.5 bits (160), Expect = 7e-12 Identities = 40/111 (36%), Positives = 40/111 (36%), Gaps = 3/111 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP--PPPXX 792 P PP P P P P P P P P P P P P P P P P PP Sbjct: 172 PSGPPS-PGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSEDPKPSEPPSPG 230 Query: 793 P-PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP PP PP P P P P P PP PP Sbjct: 231 PVDPSDEPSPSDPPGPPGPPGPPTRRPPGP-PGPPTRRPPGPPGPPTRRPP 280 Score = 67.3 bits (157), Expect = 2e-11 Identities = 44/132 (33%), Positives = 44/132 (33%), Gaps = 11/132 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX---PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-- 783 P PP P P P P P P P P P P P P P P P P Sbjct: 145 PSGPPS-PGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDE 203 Query: 784 --PXXPPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPPPXXXXXPXXP-XPPXXPPPX 945 P PP P P PP P P P P P PP P P P PP Sbjct: 204 PSPSGPPSPGPVDPSEDPKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGPPTRRPPGPPGP 263 Query: 946 PXXPPPXPXXPP 981 P PP P PP Sbjct: 264 PTRRPPGPPGPP 275 Score = 57.6 bits (133), Expect = 1e-08 Identities = 39/128 (30%), Positives = 39/128 (30%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP-XPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P P PP P P P Sbjct: 101 PSGPPS-PGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPSEDHQPSGPPSPGPVDPSED 159 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP----PPXXXXXPXXPXPPXXPPPXPXXP-- 957 P P P PP P P P P P P P P P P P Sbjct: 160 PQPSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSE 219 Query: 958 PPXPXXPP 981 P P PP Sbjct: 220 DPKPSEPP 227 Score = 55.6 bits (128), Expect = 5e-08 Identities = 34/114 (29%), Positives = 34/114 (29%), Gaps = 4/114 (3%) Frame = +1 Query: 631 PXXPXPXXPXPP--PXPXXXXPPPPPXPX--PXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P PP P P P P Sbjct: 74 PILPTSVVPQPSNEPSPGTVAPSDEPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDP 133 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P PP P P P P P PP P P P Sbjct: 134 QPSVEPSEDHQPSGPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDPSEDP 187 Score = 55.2 bits (127), Expect = 7e-08 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P Sbjct: 126 PVDPSEDPQPSVEPSEDHQPSGPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDPSE 185 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P PP P P P P P P P P Sbjct: 186 DPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSEDPKPSEPPSPGPVDPSDEPSPSDPPG 245 Query: 958 PPXPXXPP 981 PP P PP Sbjct: 246 PPGPPGPP 253 Score = 53.6 bits (123), Expect = 2e-07 Identities = 37/124 (29%), Positives = 37/124 (29%), Gaps = 7/124 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P Sbjct: 95 PSDEPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPSEDHQPSGPPSPGPV 154 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P P Sbjct: 155 DPSEDPQPSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSP-GPVDPSDEPSPSGPPSPG 213 Query: 967 PXXP 978 P P Sbjct: 214 PVDP 217 Score = 52.4 bits (120), Expect = 5e-07 Identities = 33/118 (27%), Positives = 33/118 (27%), Gaps = 1/118 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P P P PP P P P PP P P P P P Sbjct: 84 PSNEPSPGTVAPSDEPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPSEDH 143 Query: 808 XPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P P Sbjct: 144 QPSGPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSP-GPVDPSEDPQPSGSSSPGPVDP 200 Score = 52.4 bits (120), Expect = 5e-07 Identities = 40/131 (30%), Positives = 40/131 (30%), Gaps = 10/131 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXP----XPPXPXPPPPXXPPPXPXPP 780 PP P P P PP P P P P P P P P P P P P Sbjct: 104 PPSPGPVNPSEDPQPSGPPSPGPVDPSEDPQPSVEPSEDHQPSGPPSPGPVDPSEDPQPS 163 Query: 781 -PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP-PXXP--PPXP 948 P P PP P P P P P P P P P P P P Sbjct: 164 VEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSEDPKP 223 Query: 949 XXPP-PXPXXP 978 PP P P P Sbjct: 224 SEPPSPGPVDP 234 Score = 52.0 bits (119), Expect = 6e-07 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 5/121 (4%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP-----PPXXXPPXXPXXXXXXXXXXXXXXXXP 779 P P P P P P P P P P P P Sbjct: 162 PSVEPSEDPQPSGPPSPGPVDPSEDPQPSGSSSPGPVDPSDEPSPSGPPSPGPVDPSEDP 221 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P PP PP P PP PP P P PP P P Sbjct: 222 KPSEPPSPGPVDPSDE-PSPSDPPGPPGPPGPPTRRPPGPPGPPTRRP-PGPPGPPTRRP 279 Query: 960 P 962 P Sbjct: 280 P 280 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P PP P P PP P PP PP P PP P Sbjct: 221 PKPSEPPSPGPVDPSDEPSPSDPPGPPGPPGPPTRRPPGPPGPPTRRPPGPPGPPTRRPP 280 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/112 (30%), Positives = 34/112 (30%), Gaps = 7/112 (6%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P PP P P P P PP P Sbjct: 74 PILPTSVVPQPSNEPSPGTVAPSDEPSPSG--PPSPGPVNPSEDPQPSGPPSPGPVDPSE 131 Query: 844 PPXPPPXP----PPXPXPPPXXXXXPXXPXPPXXP--PPXPXXPP-PXPXXP 978 P P P P P P P P P P P PP P P P Sbjct: 132 DPQPSVEPSEDHQPSGPPSPGPVDPSEDPQPSVEPSEDPQPSGPPSPGPVDP 183 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/66 (25%), Positives = 17/66 (25%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P P P P Sbjct: 74 PILPTSVVPQPSNEPSPGTVAPSDEPSPSGPPSPGPVNPSEDPQPSGPPSPGPVDPSEDP 133 Query: 964 XPXXPP 981 P P Sbjct: 134 QPSVEP 139 >U14635-1|AAC46657.2| 448|Caenorhabditis elegans Hypothetical protein C27H5.3 protein. Length = 448 Score = 73.3 bits (172), Expect = 2e-13 Identities = 43/98 (43%), Positives = 43/98 (43%), Gaps = 2/98 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXX 804 GG G GG G GGG G G G GG G GGG GG GG G GG G Sbjct: 292 GGERGGRGGRGGFGGGRGGPMGGRGGFGGDRGGYGGGGGRGGFDGGRGGGGGFRGGDRGG 351 Query: 803 XXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGG 693 GG GG G GG GG G GG G G GGG Sbjct: 352 FRGGDRGGFRGGDRGGFRGGDRGGDRGGFRGGRGVGGG 389 Score = 70.5 bits (165), Expect = 2e-12 Identities = 40/91 (43%), Positives = 40/91 (43%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G GG GGG GG GG GG GG GGGG G G GGGG GG G Sbjct: 296 GGRGGRGGFGGGRGGPMGGRGGFGGDR---GGYGGGGGRGGFDGGRGGGGGFRGGDRGGF 352 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GG G G GG GG Sbjct: 353 RGGDRGGFRGGDRGGFRGGDRGGDRGGFRGG 383 Score = 60.1 bits (139), Expect = 2e-09 Identities = 42/111 (37%), Positives = 42/111 (37%), Gaps = 2/111 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX--GGGX 807 GG G GG G GGG GG G G GG G GG GG GGG GG GG Sbjct: 88 GGGRGGFGGSRG-GGGYDGGRG--GSRGGYDGGRGGYGGDRGGRGGGRGGYDGERRGGSR 144 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GG G G G G G G GGGG G G Sbjct: 145 WDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGGGAASGNREFGSDG 195 Score = 56.8 bits (131), Expect = 2e-08 Identities = 40/115 (34%), Positives = 40/115 (34%), Gaps = 1/115 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G GG G G GG G GGG GG GG GG GG G Sbjct: 70 GQGSGGQS-GGSDPYGQSRGGGRGGFGGSRG-GGGYDGGRGGSRGGYDGGRGGYGGDRGG 127 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGG G G GG G G GG GG G G G GG Sbjct: 128 RGGGRGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGG 182 Score = 54.8 bits (126), Expect = 9e-08 Identities = 40/120 (33%), Positives = 40/120 (33%), Gaps = 4/120 (3%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G GG G GG GG GG GG GG G G Sbjct: 65 GADPYGQGSGGQSGGSDPYGQSRGGGRGGFGGSRGG--GGYDGGRGGSRGGYDGGRGGYG 122 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG----GXGXXGXGXXGGXXGG 615 G G GGG G G GG G G G GG G G GG GG Sbjct: 123 GDRGGRGGGRGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGG 182 Score = 52.0 bits (119), Expect = 6e-07 Identities = 39/121 (32%), Positives = 39/121 (32%), Gaps = 5/121 (4%) Frame = -3 Query: 977 GXXGXGGGXX----GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G GG GGG G G G GG G GG GG GG G GGG Sbjct: 72 GSGGQSGGSDPYGQSRGGGRGGFGGSRGGGGYDGGRGGSRGGYDGGRGGYGGDRGGRGGG 131 Query: 809 XXXXGG-XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G GG G GG G G G G G GGG G Sbjct: 132 RGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGGGAASGNREF 191 Query: 632 G 630 G Sbjct: 192 G 192 Score = 46.4 bits (105), Expect = 3e-05 Identities = 38/117 (32%), Positives = 38/117 (32%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GG G G G GG GGG G GG GG G GG G Sbjct: 70 GQGSGGQSGG---SDPYGQSRGGGRGGFGGSRGGG-GYDGGRGGSRGGYDGGRGGYG-GD 124 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 GG G G GG G GG G GG G G GG Sbjct: 125 RGGRGGGRGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGG 181 >Z68008-4|CAA92000.4| 1137|Caenorhabditis elegans Hypothetical protein R08B4.1a protein. Length = 1137 Score = 72.9 bits (171), Expect = 3e-13 Identities = 43/123 (34%), Positives = 48/123 (39%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G GG GGG GG GGG GG GGG G G G G G G G G Sbjct: 780 GGPTGSSGGGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNG 839 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWSXQ*TSXXXLLST 531 G G G G G G G G G G G G A ++ + Q + + Sbjct: 840 NGAGAGNG-NGAGAGNGNG-AGAGNGNGAGAGDASAAAAAAQAQAAAAAQAQAAAAAAAQ 897 Query: 530 QAA 522 QAA Sbjct: 898 QAA 900 Score = 70.1 bits (164), Expect = 2e-12 Identities = 38/93 (40%), Positives = 38/93 (40%), Gaps = 1/93 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GG G G GGG G GGG G G GG G G G Sbjct: 780 GGPTGSSGGGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAG---NGNGAGA 836 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXG 705 G G G G G G G G G G G G G G Sbjct: 837 GNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGAG 869 Score = 69.7 bits (163), Expect = 3e-12 Identities = 37/88 (42%), Positives = 37/88 (42%), Gaps = 1/88 (1%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G GG G GGG G GG GGG G G GG GG G G G G Sbjct: 781 GPTGSSGGGGGGSNSNSGGGGGNGGGGNGGGGNGNG-GGAGDGNGGAGAGNGNGAGAGNG 839 Query: 767 XGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G G G G G G G G G G G G G Sbjct: 840 NGAGAGNGNGAGAGNGNGAGAGNGNGAG 867 Score = 68.9 bits (161), Expect = 5e-12 Identities = 35/91 (38%), Positives = 35/91 (38%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G GG GG GG G GGG G GG G G G G G Sbjct: 780 GGPTGSSGGGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNG 839 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G G G G G G G G G G Sbjct: 840 NGAGAGNGNGAGAGNG-NGAGAGNGNGAGAG 869 Score = 68.5 bits (160), Expect = 7e-12 Identities = 48/154 (31%), Positives = 53/154 (34%), Gaps = 1/154 (0%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG G G G G GGG GG G G GG GG GG G G G G Sbjct: 780 GGPTGSSGGGGGGSNSNSG---GGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGA 836 Query: 758 GXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSX 582 G G G G G G G G G G G G G G G G A + Sbjct: 837 GNGNGAGAGNGNGAGAGNGNGAGAG---NGNGAGAGDASAAAAAAQAQAAAAAQAQAAAA 893 Query: 581 RSTWSXQ*TSXXXLLSTQAAFRDEQSNPVSVLVA 480 + + AA +NP+S LVA Sbjct: 894 AAAQQAAAAAAAANAQQAAAAAAAAANPLSALVA 927 Score = 59.3 bits (137), Expect = 4e-09 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GGG G GG G G G G G G G G G G G G G Sbjct: 801 GGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGA 860 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 861 GNGNGAGAG 869 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G G G G G G G G G G G G G G G G G G Sbjct: 799 GGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGA 858 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 859 GAGNGNGAG 867 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG GG G GG G G GG G G G G G G G G G Sbjct: 789 GGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGN 848 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 849 GAGAGNGNG 857 Score = 53.2 bits (122), Expect = 3e-07 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 3/72 (4%) Frame = -1 Query: 985 GGGGGX---GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGGG GGG G G G G G G G GG G G G G G G G Sbjct: 788 GGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNG 847 Query: 814 XXGXGGXGXGXG 779 G G G G Sbjct: 848 NGAGAGNGNGAG 859 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GGG G G G G GG GGGG G GG G G G G G G Sbjct: 781 GPTGSSGGGGGGSNSNSGGGGGNG---GGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAG 837 Query: 805 XG-GXGXGXG 779 G G G G G Sbjct: 838 NGNGAGAGNG 847 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 6/75 (8%) Frame = -1 Query: 985 GGGGGX------GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXX 824 GGGGG G GG G GG G G G G GG G G G G G G G Sbjct: 787 GGGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGN 846 Query: 823 XXGXXGXGGXGXGXG 779 G G G G G Sbjct: 847 GNGAGAGNGNGAGAG 861 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG G GG GG G G G GG G GG G G G G G G Sbjct: 784 GSSGGGG-GGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGA 842 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 843 GAGNGNGAG 851 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 71.7 bits (168), Expect = 7e-13 Identities = 46/127 (36%), Positives = 46/127 (36%), Gaps = 5/127 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPXP---PXPXPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 126 PMLFPKPMPIPK-PMPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPMPKPKPKP 184 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P P P P P Sbjct: 185 KPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPMPKHKPKPFPKPMLFPKPMP-IPK 243 Query: 961 PXPXXPP 981 P P P Sbjct: 244 PMPFPKP 250 Score = 71.3 bits (167), Expect = 1e-12 Identities = 44/128 (34%), Positives = 44/128 (34%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 154 PKPMPKSKPKSEPFPNPMPFPK-PMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMP 212 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXP---XXP 957 P P P P P P P P P P P P P P P P P P P Sbjct: 213 FPKPMPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPKPKPKPMPKPKPKLKLKP 272 Query: 958 PPXPXXPP 981 P P P Sbjct: 273 KPMPFPKP 280 Score = 68.1 bits (159), Expect = 9e-12 Identities = 44/124 (35%), Positives = 44/124 (35%), Gaps = 2/124 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 106 PMPFPKPKPMPKHKPKPFPKPMLF-PKPMPIPKPMPFPKPMLFPKPMPFPKPMPKSKPKS 164 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P P P P P P P Sbjct: 165 EPFPNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKP-MPIPKPMPFPKP-MPKPMP 222 Query: 970 XXPP 981 P Sbjct: 223 KHKP 226 Score = 67.3 bits (157), Expect = 2e-11 Identities = 43/123 (34%), Positives = 43/123 (34%), Gaps = 1/123 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 144 PMLFPKPMPFPK-PMPKSKPKSE-PFPNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLF 201 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P P P P Sbjct: 202 PKPMPIPKPMPFPKPMPKPMPKHKPKPFPKPMLFPKPMP-IPKPMPFPKPMP-KPKPKPK 259 Query: 973 XPP 981 P Sbjct: 260 PMP 262 Score = 66.9 bits (156), Expect = 2e-11 Identities = 44/125 (35%), Positives = 44/125 (35%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 94 PKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMLFPKPMPF 153 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P P P P P P Sbjct: 154 PKPMPKSKPKSEPFPNPMPFPKPMPKPKPKPKPMPKHKPKP-FPKPMLFPKPMP-IPKPM 211 Query: 967 PXXPP 981 P P Sbjct: 212 PFPKP 216 Score = 66.9 bits (156), Expect = 2e-11 Identities = 45/128 (35%), Positives = 45/128 (35%), Gaps = 6/128 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPP---PPPXPXPXPXP-PXPXPPPPXXPPPXPXPP 780 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 162 PKSEPFPNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPM 221 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXP 957 P P P P P P P P P P P P P P P P P P P P Sbjct: 222 PKHKPKPF--PKPMLFPKPMPIPKPMPFPKPMPKPKPKPKPMP-KPKPKLKLKPKPMPFP 278 Query: 958 PPXPXXPP 981 P P P Sbjct: 279 KPKPKLKP 286 Score = 66.5 bits (155), Expect = 3e-11 Identities = 44/130 (33%), Positives = 44/130 (33%), Gaps = 9/130 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXP------PPXP 771 P P P P P P P P P P P P P P P P P P P P Sbjct: 18 PKPMPKSKPKSEPFPSPMPFPK-PMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPKHKPKP 76 Query: 772 XPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P P P P P P P P P P P P P P P P P P P Sbjct: 77 FPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKPKP-FPKPMLFPKPMP- 134 Query: 952 XPPPXPXXPP 981 P P P P Sbjct: 135 IPKPMPFPKP 144 Score = 66.1 bits (154), Expect = 4e-11 Identities = 39/122 (31%), Positives = 39/122 (31%), Gaps = 1/122 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P P P P Sbjct: 90 PKPMPKSKPKSEPFPNPMPFPK-PKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMLFP 148 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P P P P P P P P P P P P P P P P Sbjct: 149 KPMPFPKPMPKSKPKSEPFPNPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIP 208 Query: 976 PP 981 P Sbjct: 209 KP 210 Score = 65.3 bits (152), Expect = 6e-11 Identities = 43/123 (34%), Positives = 43/123 (34%), Gaps = 1/123 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 140 PFPKPMLFPKPM-PFPKPMPKSK-PKSEPFPNPMPFPK-PMPKPKPKPKPMPKHKPKPFP 196 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P P P P Sbjct: 197 KPMLFPKPMPI--PKPMPFPKPMPKPMPKHKPKPFPKPMLFPKPMPIPKPMP-FPKPMPK 253 Query: 973 XPP 981 P Sbjct: 254 PKP 256 Score = 65.3 bits (152), Expect = 6e-11 Identities = 44/127 (34%), Positives = 44/127 (34%), Gaps = 5/127 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 178 PKPKPKPKPMPKHKPKPFPKPMLF-PKPMPIPKPMPFPK-PMPKPMPKHKPKPFPKPMLF 235 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP--- 960 P P P P P P P P P P P P P P P P P P P Sbjct: 236 PKPMPIPKPMPF--PKPMPKPKPKPKPMPKPKPKLKLKPKPMPFPKPKPKLKPKTKPKKN 293 Query: 961 PXPXXPP 981 P P P Sbjct: 294 PVPILKP 300 Score = 64.9 bits (151), Expect = 8e-11 Identities = 42/125 (33%), Positives = 42/125 (33%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P P P Sbjct: 70 PKHKPKPFPKPMLFPKPMPFPKPM-PKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKPML 128 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P P P P P Sbjct: 129 FPKPMPIPKPMPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPMPKPKP-KPKPM 187 Query: 967 PXXPP 981 P P Sbjct: 188 PKHKP 192 Score = 63.3 bits (147), Expect = 3e-10 Identities = 41/120 (34%), Positives = 41/120 (34%), Gaps = 4/120 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 188 PKHKPKPFPKPMLFPKPMPIPK---PMPFPKPMPKPMPKHKPKPFPKPMLFPKPMPIPKP 244 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P P P P PP Sbjct: 245 MPFPKPMPKPKPKPKPMPKPKPKLKLKPKPMPFPKPKPKLKP-KTKPKKNPVPILKPIPP 303 Score = 62.9 bits (146), Expect = 3e-10 Identities = 45/131 (34%), Positives = 45/131 (34%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXP---PXPXPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 34 PMPFPKPMPKPK-PKPKPMPKHKPKPFPKPMLFPKPMPKHKPKPFPKPMLFPKPMPFPKP 92 Query: 784 --PXXPPXXXXPPPXXXXPPXPPPX--PPPXPPPXPXPPPXXXXXPXX-PXPPXXPPPXP 948 P P P P P P P P P P P P P P P P P P Sbjct: 93 MPKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMLFPKPMP 152 Query: 949 XXPPPXPXXPP 981 P P P P Sbjct: 153 -FPKPMPKSKP 162 Score = 62.5 bits (145), Expect = 4e-10 Identities = 44/132 (33%), Positives = 44/132 (33%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXX-PPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPP--P 783 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 8 PTPKPKSEPFPK-PMPKSKPKSEPFPSPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFP 66 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP---XXPXPPXXPPPXP-- 948 P P P P P P P P P P P P P P P P P Sbjct: 67 KPMPKHKPKPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKP 126 Query: 949 -XXPPPXPXXPP 981 P P P P Sbjct: 127 MLFPKPMPIPKP 138 Score = 62.1 bits (144), Expect = 6e-10 Identities = 45/132 (34%), Positives = 45/132 (34%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPX--PXPXP---PXPXPPPPXXPPPXPXP 777 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 116 PKHKPKPFPKPMLFPKPMPIPK---PMPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMP 172 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXP-- 948 P P P P P P P P P P P P P P P P P P P Sbjct: 173 FPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPMPKHKPKPFPKP 232 Query: 949 -XXPPPXPXXPP 981 P P P P Sbjct: 233 MLFPKPMPIPKP 244 Score = 60.9 bits (141), Expect = 1e-09 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 8/123 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P Sbjct: 22 PKSKPKSEPFPSPMPFPKPMPKPKPKPKPMPKHKPKPFPKPMLFPKPMPKHKPKPFPKPM 81 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXX-----PXPPXXPPPXPX 951 P P P P P P P P P P P P P P P P P P Sbjct: 82 LFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPF 141 Query: 952 XPP 960 P Sbjct: 142 PKP 144 Score = 59.7 bits (138), Expect = 3e-09 Identities = 38/122 (31%), Positives = 38/122 (31%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P P Sbjct: 4 PKSKPTPKPKSEPFPKPMPKSKPKSEPFPSPMPF---PKPMPKPKPKPKPMPKHKPKPFP 60 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P P P Sbjct: 61 KPMLFPKPMPKHKPKPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMPKHKP 120 Query: 973 XP 978 P Sbjct: 121 KP 122 Score = 56.4 bits (130), Expect = 3e-08 Identities = 34/115 (29%), Positives = 34/115 (29%), Gaps = 1/115 (0%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P P P P Sbjct: 2 PEPKSKPTPKPKSEPFPKPMPKSKPKSEPFPSPMPFPKPMPKPKPKPKPMPKHKPKPFPK 61 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P P P P P Sbjct: 62 PMLFPKPMPKHKPKPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPFPKPKPMP 116 Score = 56.4 bits (130), Expect = 3e-08 Identities = 41/125 (32%), Positives = 41/125 (32%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P Sbjct: 52 PKHKPKPFPKPML-FPKPMPKHK-PKPFPKPMLFPKPMPFPKPMPKSKPKSEPFPNPMPF 109 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPXXPP-PX 966 P P P P P P P P P P P P P P P P P P Sbjct: 110 PKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMLFPKPMPFPKPMPKSKPKSEPFPN 169 Query: 967 PXXPP 981 P P Sbjct: 170 PMPFP 174 Score = 39.9 bits (89), Expect = 0.003 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 5/128 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPP---PPPXXXPPXXPXXXXXXXXXXXXXXXXPPX 785 P P P P P P P P P P P P Sbjct: 178 PKPKPKPKPMPKHKPKPFPKPMLFPKPMPIPKPMPFPKPMPKPMPKHKPKPFPKPMLFPK 237 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXXP-XXPP 959 P P P P P P P P P P P P P P P P P P Sbjct: 238 PMPIPKPMPFPKPMPKPKPKPKPMPKPKPKLKLKPKPMP--FPKPKPKLKPKTKPKKNPV 295 Query: 960 PXPXPPPP 983 P P PP Sbjct: 296 PILKPIPP 303 >AF016448-12|AAB65959.1| 316|Caenorhabditis elegans Hypothetical protein F41E6.11 protein. Length = 316 Score = 71.7 bits (168), Expect = 7e-13 Identities = 42/115 (36%), Positives = 42/115 (36%), Gaps = 6/115 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXX 831 P P P P PP PP P P PP P P P P P PP P PP P Sbjct: 28 PCPEPMPVCATPPCPPQYAPLPPPPMPAPAPAYNPYPCANPPCIVVEPMPVAPPAPAPAY 87 Query: 832 PPXP---PPXPPP--XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P P P P P P P P PPP P P PP Sbjct: 88 NPYPCATPPCPLPYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYEPYACAAPP 142 Score = 62.1 bits (144), Expect = 6e-10 Identities = 41/128 (32%), Positives = 41/128 (32%), Gaps = 6/128 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P P P P P P PP P P P Sbjct: 39 PPCPPQYAPLPPPPMPAPAPAYN-PYPCANPPCIVVEPMPVAPPAPAPAYNPYPCATPPC 97 Query: 796 PXXXXPPPXXXXP-PXPPPXP-----PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P PP PPP P P P P P P P Sbjct: 98 PLPYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYEPYACAAPPCPAPVAPQPVIQHVP 157 Query: 958 PPXPXXPP 981 P P P Sbjct: 158 VPVPVQVP 165 Score = 59.3 bits (137), Expect = 4e-09 Identities = 38/122 (31%), Positives = 38/122 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P P P P P P PP P P P P Sbjct: 95 PPCPLPYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYE--PYACAAPPCPAPVAPQ-P 151 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P P P P P P P P P P P P P P P P Sbjct: 152 VIQHVPVPVPVQVPVPIRVPVPVPVPTPVYQPTYCAVPPCPAPAATPVYAQPAPRPMPVY 211 Query: 976 PP 981 P Sbjct: 212 AP 213 Score = 57.6 bits (133), Expect = 1e-08 Identities = 39/124 (31%), Positives = 39/124 (31%), Gaps = 7/124 (5%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXP-----PPXPXPPPPXX 792 P P P P P PP P P P P P P P P P PP P P P Sbjct: 75 PMPVAPPAPAPAYNPYPCATPPCPLPYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYE 134 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP-PXP 969 P PP P P P P P P P P P P PP P P Sbjct: 135 PYACAAPPCPAPVAPQPVIQHVPVPVPVQVPVPIRVPVPVPVPTPVYQPTYCAVPPCPAP 194 Query: 970 XXPP 981 P Sbjct: 195 AATP 198 Score = 54.4 bits (125), Expect = 1e-07 Identities = 37/109 (33%), Positives = 37/109 (33%), Gaps = 12/109 (11%) Frame = +1 Query: 691 PPPPXPXPX----PXPPX--PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PP P P P P PP P PPPP P P P P P PP P P Sbjct: 27 PPCPEPMPVCATPPCPPQYAPLPPPPMPAPAPAYNPYPCANPPCIVVEPMPVAPPAPAPA 86 Query: 853 PPPXP---PPXPXPPPXXXXXPXXPXPPXXPP---PXPXXPPPXPXXPP 981 P P PP P P P P P P PPP P P Sbjct: 87 YNPYPCATPPCPLPYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYEP 135 Score = 54.4 bits (125), Expect = 1e-07 Identities = 42/133 (31%), Positives = 42/133 (31%), Gaps = 11/133 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP--PPPXXPPPXPXP---- 777 P PP P PP P P P P PP P P P P P P P P Sbjct: 64 PCANPPCIVVEPMPVAPPAPA-----PAYNPYPCATPPCPLPYIPEPVAPVPAPAPVYEP 118 Query: 778 ----PPPXXPPXXXXPPPXXXXPPXPPP-XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP PP P PP P P P P P P P P P P P Sbjct: 119 YACAAPPCPPPTPVYEPYACAAPPCPAPVAPQPVIQHVPVPVPVQVPVPIR-VPVPVPVP 177 Query: 943 XPXXPPPXPXXPP 981 P P PP Sbjct: 178 TPVYQPTYCAVPP 190 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 4/108 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX----PXPPPPXXPPPXPXPPP 783 P P P P P P PP P P P P P P P P P P Sbjct: 114 PVYEPYACAAPPCPPPTPVYEPYACAAPPCPAPVAPQPVIQHVPVPVPVQVPVPIRVPVP 173 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P P P P P P P PP Sbjct: 174 VPVPTPVYQPTYCAVPPCPAPAATPVYAQPAPRPMPVYAPAPACAQPP 221 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/103 (28%), Positives = 29/103 (28%), Gaps = 1/103 (0%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P P P P P P P P P P P P Sbjct: 125 PCPPPTPVYEPYACAAPPCPAPVAPQPVIQHVPVPVPVQVPVPIRVPVPVPVPTPVYQPT 184 Query: 835 PXP-PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P P PP P P Sbjct: 185 YCAVPPCPAPAATPVYAQPAPRPMPVYAPAPACAQPPCPAYNP 227 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/126 (26%), Positives = 33/126 (26%), Gaps = 3/126 (2%) Frame = +3 Query: 615 PXXP-PXXP-PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P PPP P P P P Sbjct: 100 PYIPEPVAPVPAPAPVYEPYACAAPPCPPPTPVYEPYACAAPPCPAPVAPQPVIQHVPVP 159 Query: 789 XPXP-PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPX 965 P P P P P P P P P P P P P P P P Sbjct: 160 VPVQVPVPIRVPVPVPVPTPVYQPTYCAVPPCPAPAATPVYAQPAPRPMPVYAP--APAC 217 Query: 966 PXPPPP 983 PP P Sbjct: 218 AQPPCP 223 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP 762 P P P P P P P P P P P P PP P P Sbjct: 179 PVYQPTYCAVPPCPAPAATPVYAQPAPRPMPVYAPAPACAQPPCPAYNP 227 >Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical protein C56A3.1 protein. Length = 393 Score = 70.9 bits (166), Expect = 1e-12 Identities = 43/113 (38%), Positives = 43/113 (38%), Gaps = 4/113 (3%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G G GGG G GGG GGG GGG GG GGG GG GG G Sbjct: 86 GGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGG-GGYASGGSGGFA 144 Query: 761 GGXXGGGGXGXGGX---GXGXGXGGGGGXXXXGX-GGGXGXXGXGXXGGXXGG 615 GG GG G GGG G GG GG Sbjct: 145 SAPVSLPAPSYGGPPPPAPSFSHAPSGGYSSGGSSGGGYSSGGSSGGGGYAGG 197 Score = 70.5 bits (165), Expect = 2e-12 Identities = 41/117 (35%), Positives = 41/117 (35%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG G GGG GG G G G G G GGG GGG GGG GG G G Sbjct: 86 GGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGGSGGFAS 145 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G GGG G GG G G G Sbjct: 146 APVSLPAPSYGGPPPPAPSFSHAPSGGYSSGGSSGGGYSSGGSSGGGGYAGGAAAAG 202 Score = 59.7 bits (138), Expect = 3e-09 Identities = 27/51 (52%), Positives = 27/51 (52%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGG G GGG G GG G G G GG GGG G GG GGG G G Sbjct: 91 GGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGGSG 141 Score = 58.8 bits (136), Expect = 5e-09 Identities = 31/59 (52%), Positives = 31/59 (52%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G G G GG GG G G GG GGG G GGG G G Sbjct: 86 GGGGCG-GGGCGGGGGGCG-GGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGGSGG 142 Score = 57.2 bits (132), Expect = 2e-08 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG GG G GGG G GG G G G G GGGG GG GGG G GG Sbjct: 88 GGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGG 139 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/46 (54%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGX-GXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGGGG G GGG G GG G G G GG GGGG G G GG Sbjct: 97 GGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGGSGG 142 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGG G G GGG G GG G G GG GG G Sbjct: 113 GGGCGGGGGGGCGGGGGGGGGGYASGGSGGFASAPVSLPAPSYGGPPPPAPSFSHAPSGG 172 Query: 805 XGGXGXGXGG 776 G GG Sbjct: 173 YSSGGSSGGG 182 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 891 PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PPP P P PP Sbjct: 41 PQPASCGCAPACPQAPSCPVCPPPQPCPAPP 71 >U61288-1|AAB17543.1| 790|Caenorhabditis elegans CE protein. Length = 790 Score = 70.5 bits (165), Expect = 2e-12 Identities = 42/123 (34%), Positives = 47/123 (38%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G GGG GG GGG GG GGG G G G G G G G G Sbjct: 433 GGPTGSSGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNG 492 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWSXQ*TSXXXLLST 531 G G G G G G G G G G G G A ++ + Q + + Sbjct: 493 NGAGAGNG-NGAGAGNGNG-AGAGNGNGAGAGDASAAAAAAQAQAAAAAQAQAAAAAAAQ 550 Query: 530 QAA 522 QAA Sbjct: 551 QAA 553 Score = 70.1 bits (164), Expect = 2e-12 Identities = 39/88 (44%), Positives = 39/88 (44%), Gaps = 4/88 (4%) Frame = -3 Query: 938 GGXXG--GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXG 768 GG G G G G GGG G GGG GG G G GG G GG G G G G Sbjct: 433 GGPTGSSGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNG 492 Query: 767 XGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G G G G G G G G G G G G G Sbjct: 493 NGAGAGNGNGAGAGNGNGAGAGNGNGAG 520 Score = 67.7 bits (158), Expect = 1e-11 Identities = 37/93 (39%), Positives = 37/93 (39%), Gaps = 1/93 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G GGG G GGG G G GG G G G Sbjct: 433 GGPTGSSGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAG---NGNGAGA 489 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXG 705 G G G G G G G G G G G G G G Sbjct: 490 GNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGAG 522 Score = 65.3 bits (152), Expect = 6e-11 Identities = 47/148 (31%), Positives = 54/148 (36%), Gaps = 5/148 (3%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG-XXGGGGXGXGGGXXGGGGXG 732 G G G G G GGG GG GGG GG G GG G G G G G G Sbjct: 433 GGPTGSSGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNG 492 Query: 731 XG-GXGXGXGXG-GGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRSTWSXQ* 558 G G G G G G G G G G G G A + + + Q Sbjct: 493 NGAGAGNGNGAGAGNGNGAGAGNGNGAGAGDASAAAAAAQAQAAAAAQAQAAAAAAAQQA 552 Query: 557 TSXXXLLSTQ--AAFRDEQSNPVSVLVA 480 + + Q AA +NP+S LVA Sbjct: 553 AAAAAAANAQQAAAAAAAAANPLSALVA 580 Score = 59.3 bits (137), Expect = 4e-09 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GGG G GG G G G G G G G G G G G G G Sbjct: 454 GGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGAGA 513 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 514 GNGNGAGAG 522 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G G G G G G G G G G G G G G G G G G Sbjct: 452 GGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGAGAGNGNGA 511 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 512 GAGNGNGAG 520 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG GG G GG G G GG G G G G G G G G G Sbjct: 442 GGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGN 501 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 502 GAGAGNGNG 510 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GGG G G G G GG GGGG G GG G G G G G G Sbjct: 434 GPTGSSGSGGGGSNSNSGGGGGNG---GGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAG 490 Query: 805 XG-GXGXGXG 779 G G G G G Sbjct: 491 NGNGAGAGNG 500 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GGG G G G G G G G GG G G G G G G G Sbjct: 444 GGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNGA 503 Query: 805 XGGXGXGXG 779 G G G G Sbjct: 504 GAGNGNGAG 512 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXG-XXGGXGGGXGXXGGGXXXXGXX 809 G G G GG GG G G G GG G GGG G GG G G G G G Sbjct: 437 GSSGSGGGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAG 496 Query: 808 GXGGXGXGXG 779 G G G G Sbjct: 497 AGNGNGAGAG 506 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 3/72 (4%) Frame = -1 Query: 985 GGGGGX---GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGG G GG G GG G G G G GG G G G G G G G G Sbjct: 443 GGGSNSNSGGGGGNGGGGNGGGGNGNGGGAGDGNGGAGAGNGNGAGAGNGNGAGAGNGNG 502 Query: 814 XXGXGGXGXGXG 779 G G G G Sbjct: 503 AGAGNGNGAGAG 514 >Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical protein F58E10.3a protein. Length = 561 Score = 70.1 bits (164), Expect = 2e-12 Identities = 39/76 (51%), Positives = 39/76 (51%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG GG GGG GG GG GGG GG GG G G GGG GGGG G GG G G Sbjct: 7 GGSRSYGGSSGGGSRGGYGGGGRGGGG----GGYSGGRGGGYGGG--GGGGYGGGGYG-G 59 Query: 710 XGXGGGGGXXXXGXGG 663 G GGG G GG Sbjct: 60 GGRGGGRGGSNGSAGG 75 Score = 67.3 bits (157), Expect = 2e-11 Identities = 35/69 (50%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGX-GGGXXGGGGXG-XGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG GG GGG G GGG GGGG G GG G G G GGGGG G GGG G Sbjct: 7 GGSRSYGGSSGGGSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGGRGGGR 66 Query: 641 GXXGGXXGG 615 G G GG Sbjct: 67 GGSNGSAGG 75 Score = 64.9 bits (151), Expect = 8e-11 Identities = 37/77 (48%), Positives = 37/77 (48%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GG GG GGG GGG GG GG GG GGGG G GGG GG Sbjct: 5 GYGGSRSYGGSSGGGSRGGYGGGGRGGGGGG---YSGG--RGGGYGGGGGGGYGGGGYGG 59 Query: 743 GGXGXGGXGXGXGXGGG 693 GG G GG G G GG Sbjct: 60 GGRG-GGRGGSNGSAGG 75 Score = 63.3 bits (147), Expect = 3e-10 Identities = 33/75 (44%), Positives = 33/75 (44%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GG G G GG G GGG GGG GG GG GGG GG GGG Sbjct: 2 GDRGYGGSRSYGGSSGGGSRGGYGGGGRGGG-GGGYSGGRGGGYGGGGGGGYGGGGYGGG 60 Query: 776 GXGXGGGXXGGGGXG 732 G G G G G G Sbjct: 61 GRGGGRGGSNGSAGG 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 G G GG G G GG GGGG G GG GGG G GGG G G GG Sbjct: 2 GDRGYGGSRSYGGSSGGGSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGG 61 Query: 796 XGXGXGG 776 G G GG Sbjct: 62 RGGGRGG 68 Score = 62.1 bits (144), Expect = 6e-10 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G G GGG G GG GGG GGG GG GG Sbjct: 2 GDRGYGGSRSYGGSSGGGSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGG----Y 57 Query: 797 GGXXGGGGXGXGGGXXGG 744 GG GGG G G GG Sbjct: 58 GGGGRGGGRGGSNGSAGG 75 Score = 58.0 bits (134), Expect = 1e-08 Identities = 28/51 (54%), Positives = 28/51 (54%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GG GG G GGG G GG G G G GG GGGG G GG GGG G G Sbjct: 22 GGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYG-GGGRGGGRGGSNG 71 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGX 636 G GG GG GG G GG G GG G G G GGG G GG G G G G Sbjct: 2 GDRGYGGSRSYGGSSGGGSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGG 61 Query: 635 XGGXXGG 615 GG GG Sbjct: 62 RGGGRGG 68 Score = 57.2 bits (132), Expect = 2e-08 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G GGG G GGG G G GGG G GG GGG GGG GG GG Sbjct: 19 GSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGGRGGGRGGSNGSAGG 75 Score = 55.2 bits (127), Expect = 7e-08 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGG G GGG G GG G G GG G GG G GG GG G GG Sbjct: 25 GGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGGRGGGRGGSNGSAGG 75 Score = 54.8 bits (126), Expect = 9e-08 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G G GG G G GG G G GGG GGG GG GGG Sbjct: 7 GGSRSYGGSSGGGSRGGYGGGGRGGGGGGYSGGRGGG--YGGGGGGGYGGGGYGGGG--- 61 Query: 800 XGGXXGGGGXGXGG 759 GG GG GG Sbjct: 62 RGGGRGGSNGSAGG 75 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GG GG G GG G G GG GGGG G GG G G G GGG Sbjct: 14 GSSGGGSRGGYGGGGRGGGGGGYSGGRGGGYGGGGGGGYGGGGYGGGGRGGG 65 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGX 794 G GGG G GG G G G GG GG G GG GGG G GGG G G G Sbjct: 13 GGSSGGGSRGGYGGGGRGGGG---GGYSGGRGGGYGGGGGG-GYGGGGYGGGGRGGGRGG 68 Query: 793 GXGXGG 776 G G Sbjct: 69 SNGSAG 74 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXG-----XGXGXXXGGGGGXXXXXXGXG 661 G G G GG GG GGGG G G G G GGGGG G G Sbjct: 2 GDRGYGGSRSYGGSSGGGSRGG--YGGGGRG-GGGGGYSGGRGGGYGGGGGGGYGGGGYG 58 >AF000198-8|AAP68908.1| 435|Caenorhabditis elegans Collagen protein 51 protein. Length = 435 Score = 68.5 bits (160), Expect = 7e-12 Identities = 42/101 (41%), Positives = 42/101 (41%), Gaps = 4/101 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGGGX 807 G G GG GG G GG G GGG GG GGG GG GGG Sbjct: 284 GNDGQPGGPGQPGGPGQDGGPGTDAAYCPCPPRTPAGGGGGGDFPAGGGGGGYSTGGGGG 343 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G GG G GG GGGG G G G G GGGGG Sbjct: 344 RADSGGAAGGAGGAGGYSGGGGGGGGGAAAGGGYNAGGGGG 384 Score = 65.7 bits (153), Expect = 5e-11 Identities = 43/112 (38%), Positives = 43/112 (38%), Gaps = 2/112 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXG-GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GGG GGG G G G GG G GG GG GGG GG GGG GG Sbjct: 321 GGGGGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGG----GGGAAAGGG 376 Query: 791 -XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGGG G G G GGG G GG G G G Sbjct: 377 YNAGGGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAGGGGGYAGGAGAG 428 Score = 61.3 bits (142), Expect = 1e-09 Identities = 35/105 (33%), Positives = 35/105 (33%), Gaps = 2/105 (1%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G GGG G G GGG G GG GG GGGG GG Sbjct: 320 GGGGGGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGGGAAAGGGYNA 379 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGG--GXGXXGXGXXGGXXGG 615 GG G G GG G G G GG GG Sbjct: 380 GGGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAGGGGGYAGG 424 Score = 60.9 bits (141), Expect = 1e-09 Identities = 40/109 (36%), Positives = 40/109 (36%), Gaps = 5/109 (4%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXG----GGXGGGXGG-XXXXGGGXXXXGGXXGGGGXGXG 762 GG G GGG GGG G GG GG GG GGG GG GGG G Sbjct: 321 GGGGGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGGGAAAGGGYNAG 380 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G GGG G G G GG G Sbjct: 381 GGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAG-GGGGYAGGAGAG 428 Score = 60.1 bits (139), Expect = 2e-09 Identities = 40/109 (36%), Positives = 40/109 (36%), Gaps = 2/109 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG--XGGXXXXGGGX 807 GG GGG G G GG G GG G G GGG GGG GG GGG Sbjct: 324 GGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGGGAAAGGGYNAGGGG 383 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GGG GG G G GGGGG G G G Sbjct: 384 GGAPQAAPAPQAAPAPAAPAGGGYNAGG---GGGAGGGGG-YAGGAGAG 428 Score = 56.4 bits (130), Expect = 3e-08 Identities = 36/99 (36%), Positives = 36/99 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G G G GG GG G G GGG G GGG G Sbjct: 320 GGGGGGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGG-GGGGAAAGGGYN 378 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 GG G GG GG GGGGG Sbjct: 379 AGG---GGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGG 414 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/118 (31%), Positives = 37/118 (31%), Gaps = 7/118 (5%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP----PPXXPPXXXXP 813 P P PP P P P P PPPP PP P PP P P P Sbjct: 179 PAGPPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPPG-PPGPPGPPGNDGQPGAPGQDGQP 237 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPP--XXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P PP P PP P PP P PP P P P Sbjct: 238 GAPGTNTVNSPGGPGPAGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQP 295 Score = 44.8 bits (101), Expect = 1e-04 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 1/92 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGX 714 GGG GGG GGG GGG GG G G G G G G G G Sbjct: 105 GGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQAG 164 Query: 713 GXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G G Sbjct: 165 QADSGSSGQACITCPAGPPGPPGPDGNAGPAG 196 Score = 42.7 bits (96), Expect = 4e-04 Identities = 33/120 (27%), Positives = 33/120 (27%), Gaps = 14/120 (11%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPP------PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P P P PPP P P P P P P Sbjct: 179 PAGPPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPG 238 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXP--------PPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P PP PP P PP P PP P P P P Sbjct: 239 APGTNTVNSPGGPGPAGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGP 298 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/125 (27%), Positives = 34/125 (27%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPX-PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX---PXPPPP 786 P P P P PP P PP PP P P P P P P Sbjct: 194 PAGAPGVPGPDGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGP 253 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP PP P PP P PP P P P P P Sbjct: 254 AGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPC 313 Query: 964 XPXXP 978 P P Sbjct: 314 PPRTP 318 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG G GGG GG GGG G G G G G G G G Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQ 162 Query: 692 GGXXXXGXGG 663 G G G Sbjct: 163 AGQADSGSSG 172 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-GGXGXXGGGXXXXGXX 809 GGGGG GGG GG G GG GG G GGG G Sbjct: 366 GGGGGAAAGGGYNAGGGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAGGGGGYAGGA 425 Query: 808 GXG 800 G G Sbjct: 426 GAG 428 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GGGG GG G G G GGGGG G G G Sbjct: 104 GGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPG 143 Score = 35.9 bits (79), Expect = 0.044 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 3/97 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXGG--GXXXX 798 G GGG GGG GG G G G G G G G G G G Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQ 162 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G G G G G Sbjct: 163 AGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPG 199 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGGG GG GGGG G GG G G G G G G G Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDG 158 Score = 34.3 bits (75), Expect = 0.14 Identities = 29/105 (27%), Positives = 29/105 (27%), Gaps = 14/105 (13%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP---------- 762 PP PP P P P P P P P P P P PP Sbjct: 211 PPPGPPGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPAGPPGPPGPPGQDGSGG 270 Query: 763 -PXPXPPPPXXPPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P PP P P P P P PP Sbjct: 271 AAQPGPPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPCPP 315 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/97 (26%), Positives = 26/97 (26%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G GGG GGG GG G G G G G G G Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQ 162 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G G G Sbjct: 163 AGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPG 199 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG 836 GGGGG GGG G GG G G G G G G G Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPG 152 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P PPP P PP PP P P P P Sbjct: 194 PAGAPGVPGPDGDAGSPPPPG-PPGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPG 252 Query: 960 PXPXPPPP 983 P P PP Sbjct: 253 PAGPPGPP 260 Score = 32.3 bits (70), Expect = 0.54 Identities = 23/98 (23%), Positives = 23/98 (23%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PP PP P PP P PP P P P P Sbjct: 182 PPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPGAPG 241 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P PP P Sbjct: 242 TNTVNSPGGPGPAGPPGPPGPPGQDGSGGAAQPGPPGP 279 Score = 32.3 bits (70), Expect = 0.54 Identities = 28/107 (26%), Positives = 28/107 (26%), Gaps = 9/107 (8%) Frame = +3 Query: 663 PXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPX 842 P P PPPP PP P P P P P Sbjct: 201 PGPDGDAGSPPPPGPPGPPGPPGNDGQPGA---------PGQDGQPGAPGTNTVNSPGGP 251 Query: 843 XPXPPPXPPXXP---------XPPPPXPPXXXXPXPXPXPPXXPXXP 956 P PP PP P P PP PP P P P P Sbjct: 252 GPAGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGP 298 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG-GGXXXXGXX 809 GGGGG G GGG G G G G G G G G G G Sbjct: 112 GGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQAGQADSGSS 171 Query: 808 G 806 G Sbjct: 172 G 172 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP P P P P P PP P PP P Sbjct: 179 PAGPPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPPGPPGPPGP 221 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/77 (42%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = +1 Query: 655 PXPPPXPXXXXP----PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P PPP P PPPP P P P P PPP PP PP P P P P Sbjct: 122 PPPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPRRPP--MTPPSPQRRPPRTPPSPE 179 Query: 823 XXXPPXPPPXPPPXPPP 873 PP PP P P PPP Sbjct: 180 PRNPPRTPPSPIPPPPP 196 Score = 67.3 bits (157), Expect = 2e-11 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P P P P P P PPP PPP PP PP PP PP Sbjct: 123 PPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPR---RPPMTPPSPQRRPP--RTPPS 177 Query: 841 PPPXPPPXPPPXPXPPP 891 P P PP PP P PPP Sbjct: 178 PEPRNPPRTPPSPIPPP 194 Score = 66.1 bits (154), Expect = 4e-11 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PPPPP P PPPP PP P PPP PP P P Sbjct: 111 PAPQHGDHEASPPPPPPPRKSRAGGSSPPPPP--PPRVPRTPPPRSPPPRRPP----MTP 164 Query: 835 PXPPPXPPPXPP-PXPXPPPXXXXXPXXPXPP 927 P P PP PP P P PP P P PP Sbjct: 165 PSPQRRPPRTPPSPEPRNPPRTPPSPIPPPPP 196 Score = 64.5 bits (150), Expect = 1e-10 Identities = 42/126 (33%), Positives = 42/126 (33%), Gaps = 17/126 (13%) Frame = +1 Query: 616 PPXXP---PXXPXPXXPX----PPPXPXXXXPPPPPXPXPXPXPPX-------PXPPPPX 753 PP P P P P P P P P P P P P PPPP Sbjct: 70 PPPYPYQHPHQPPPAHPHHLQHPHPYAYPGYPVPGQEGHQVPAPQHGDHEASPPPPPPPR 129 Query: 754 XPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXP 924 PPP PP PP PP PP PP P PP P P P P Sbjct: 130 KSRAGGSSPPPPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPPRTPPSPEPRNPPRTPPS 189 Query: 925 PXXPPP 942 P PPP Sbjct: 190 PIPPPP 195 Score = 60.9 bits (141), Expect = 1e-09 Identities = 42/125 (33%), Positives = 42/125 (33%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P P P P P P PP PPP Sbjct: 78 PHQPPPAHPHHLQHPHPYAYPGYPVPGQEGHQVPAPQHGDHEASPPPPPPPRKSRAGGSS 137 Query: 793 PPXXXXPPPXXXXPPXPPP-XPPPXPPPXPXPPPXXXXXPXXPXP-PXXPPPXPXXPPPX 966 PP PPP P PPP PPP PP P P P P P PP P P P Sbjct: 138 PP----PPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPPRTPPSPEPRNPPRTP--PSPI 191 Query: 967 PXXPP 981 P PP Sbjct: 192 PPPPP 196 Score = 58.4 bits (135), Expect = 7e-09 Identities = 46/128 (35%), Positives = 46/128 (35%), Gaps = 21/128 (16%) Frame = +1 Query: 661 PPPXPXXXXPPPPPX-------PXPXPXPPXPXPPPPXXPPPXPX-------PPPPXXPP 798 PPP P PPP P P P P P P P PPPP PP Sbjct: 70 PPPYPYQHPHQPPPAHPHHLQHPHPYAYPGYPVPGQEGHQVPAPQHGDHEASPPPP--PP 127 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP-XXXXXPXXP--XPPXXPP-PXPXXP--- 957 PP PPP P PPP PPP P P PP PP P P P Sbjct: 128 PRKSRAGGSSPPPPPPPRVPRTPPP-RSPPPRRPPMTPPSPQRRPPRTPPSPEPRNPPRT 186 Query: 958 PPXPXXPP 981 PP P PP Sbjct: 187 PPSPIPPP 194 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/93 (29%), Positives = 27/93 (29%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P PPP PP P PP P Sbjct: 123 PPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPRRP-------------PMTPPSPQR 169 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 PP PP P PP P P PPPP Sbjct: 170 RPP-------RTPPSPEPRNPPRTPPSPIPPPP 195 >AL117204-23|CAB55137.1| 285|Caenorhabditis elegans Hypothetical protein Y116A8C.35 protein. Length = 285 Score = 67.7 bits (158), Expect = 1e-11 Identities = 34/61 (55%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGX 714 G G G GGG GGG G G GG GGG G GGGG G G GG GGGG G GG G Sbjct: 214 GSGGGGGGGGGGGYGSG-GGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGG 272 Query: 713 G 711 G Sbjct: 273 G 273 Score = 67.3 bits (157), Expect = 2e-11 Identities = 33/61 (54%), Positives = 33/61 (54%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GGG GG GGG GG G GGG GG G G GG G G G GGGG Sbjct: 213 GGSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGG-GGGRGYGGGGGGGGYGYGGGG 271 Query: 689 G 687 G Sbjct: 272 G 272 Score = 66.1 bits (154), Expect = 4e-11 Identities = 32/61 (52%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXGGXX 621 GG GGGG G GGG GGG G GG G GG GGG G GGG G G G GG Sbjct: 213 GGSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGG 272 Query: 620 G 618 G Sbjct: 273 G 273 Score = 66.1 bits (154), Expect = 4e-11 Identities = 33/63 (52%), Positives = 33/63 (52%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GGG GGG GGG G GGG GG G G GG GGGG GG G G G G Sbjct: 214 GSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGG---GGGGYGYGGG 270 Query: 698 GGG 690 GGG Sbjct: 271 GGG 273 Score = 64.9 bits (151), Expect = 8e-11 Identities = 35/77 (45%), Positives = 35/77 (45%), Gaps = 6/77 (7%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG------XGXGGXGXGXG 705 G G G GG GG GGGG G GGG GGGG G GG G G G Sbjct: 196 GRRGRRADAAGHYPSQRGGSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRG 255 Query: 704 XGGGGGXXXXGXGGGXG 654 GGGGG G GGG G Sbjct: 256 YGGGGGGGGYGYGGGGG 272 Score = 58.4 bits (135), Expect = 7e-09 Identities = 28/57 (49%), Positives = 28/57 (49%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G GGG G GGG GG G GG G G G GGG GGG G GGG Sbjct: 217 GGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGGG 273 Score = 57.2 bits (132), Expect = 2e-08 Identities = 32/77 (41%), Positives = 32/77 (41%), Gaps = 5/77 (6%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG-----XGXGGGGGXXX 678 G G G GGG G GGG G G G GG G G G GGGGG Sbjct: 196 GRRGRRADAAGHYPSQRGGSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRG 255 Query: 677 XGXGGGXGXXGXGXXGG 627 G GGG G G G GG Sbjct: 256 YGGGGGGGGYGYGGGGG 272 Score = 56.8 bits (131), Expect = 2e-08 Identities = 30/56 (53%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXG--XXXXGGXGGGGXG---XXGGXGGGXGXXGGG 830 GGGG G GGG G GG G G G GG GGGG G GG GGG G GGG Sbjct: 216 GGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGGGYGYGGGG 271 Score = 56.0 bits (129), Expect = 4e-08 Identities = 34/70 (48%), Positives = 34/70 (48%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GGG GG G G G GG GGG GG GGG GGG G G Sbjct: 213 GGSGGGGGGGG----GGGYGSGGG---WGGGGGGRDRDRGGWGGG----GGGRGYGGGGG 261 Query: 805 XGGXGXGXGG 776 GG G G GG Sbjct: 262 GGGYGYGGGG 271 Score = 56.0 bits (129), Expect = 4e-08 Identities = 27/51 (52%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGXXGGXXGG 615 GG GGGG G GG G G G GGGGG GG G G G G GG GG Sbjct: 213 GGSGGGGGGGGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGG 263 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG G GGG G GG G GG G G G GG G G G GGG Sbjct: 222 GGGGGYGSGGGWGGGGGGRDRDRGGWGGGGGGRGYGGGGGGGGYGYGGGGGG 273 >AF043700-5|AAB97575.2| 573|Caenorhabditis elegans Lipid depleted protein 6 protein. Length = 573 Score = 67.3 bits (157), Expect = 2e-11 Identities = 46/118 (38%), Positives = 46/118 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G G G G G GG G GGG GG G GG Sbjct: 460 GGFRGRGGDRGGFRGRDRDGGGFRGRSVDRGGFRG-GGGDRGGFRGRSSDRGGDRGGFRG 518 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G G GGGG G G G GGGGG GG G G G GG Sbjct: 519 RSGDRDGGFRG-GFGGRGGGGFRGGDRGGFRGRGGGGGF----RGGRGGDRGGGFRGG 571 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 967 GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGX 788 G GG G G G GG GGGG G GG G GGG G G G G Sbjct: 511 GDRGGFRGRSGDRDGGF-RGGFGGRGGGGF-RGGDRGGFRGRGGGGGFRGGRGGDRGGGF 568 Query: 787 GXG 779 G Sbjct: 569 RGG 571 Score = 33.9 bits (74), Expect = 0.18 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 11/88 (12%) Frame = -3 Query: 848 GGGXGGXXXXG---GGXXXXGGXXGG--GGXGXGGGXXG-----GGGXGXGGXGXG-XGX 702 GG GG G GG GG GG G GGG G GG G GG G G Sbjct: 446 GGFRGGFRGRGEDRGGFRGRGGDRGGFRGRDRDGGGFRGRSVDRGGFRGGGGDRGGFRGR 505 Query: 701 GGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G GG G Sbjct: 506 SSDRGGDRGGFRGRSGDRDGGFRGGFGG 533 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG 881 G GGG GG G G G G GG GGG Sbjct: 533 GRGGGGFRGGDRGGFRGRGGGGGFRGGRGGDRGGG 567 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 66.9 bits (156), Expect = 2e-11 Identities = 40/92 (43%), Positives = 40/92 (43%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G GG GG G GG GG GG GGG GG GGG GG Sbjct: 171 GGGSSG-GGRFGGGGGDRFNDRGSRGGDRYGGDRRGG-GGGGGGDRYGGGGGDRYGGDRY 228 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G GG GG G G GGGG Sbjct: 229 GGGGGRRGSPDRRGGFRSGGGGGGYMRSGGGG 260 Score = 61.3 bits (142), Expect = 1e-09 Identities = 41/107 (38%), Positives = 41/107 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GG G GGG G GG GG GG G GGG Sbjct: 177 GGRFGGGGGDRFNDRGSRGGDRYGG--DRRGGGGGGGGDRYGGGGGDRYGGDRYGGGGGR 234 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G GG GGG GGG GG G G G GGG Sbjct: 235 RGSPDRRGGFRSGGG--GGGYMRSGGGGGGPDRRDHRDNDRNGGGGG 279 Score = 60.9 bits (141), Expect = 1e-09 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG GGG GG GG GG G GGGG G G GGGG GG G Sbjct: 171 GGGSSGGGRFGGGGGDRFNDRGSRGGDRYGGDRRGGGGGGGGDRYGGGGGDRYGGDRYGG 230 Query: 707 GXG-GGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G GG GG Sbjct: 231 GGGRRGSPDRRGGFRSGGGGGGYMRSGGGGGG 262 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 G GGG G GGG G G GG GGG G GG G G G G Sbjct: 167 GDRRGGGSSGGGRFGGGGGDRFNDRGSRGGDRYGGDRRGGGGGGGGDRYGGGGGDRYGGD 226 Query: 680 XXGXGGGXGXXGXGXXGGXXGG 615 G GGG G GG Sbjct: 227 RYGGGGGRRGSPDRRGGFRSGG 248 Score = 47.2 bits (107), Expect = 2e-05 Identities = 36/114 (31%), Positives = 36/114 (31%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG GGG G GG GG GG GG GGG GGG G GG Sbjct: 171 GGGSSGGGRFGGGGGDRFND-RGSRGGDRYGGDRRGGGGGGGGDRYGGG----GGDRYGG 225 Query: 796 XGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGG 635 G GG G G GGGGG G GG Sbjct: 226 DRYGGGGGRRGSPDRRGGFRSGGGGGGYMRSGGGGGGPDRRDHRDNDRNGGGGG 279 Score = 44.4 bits (100), Expect = 1e-04 Identities = 39/133 (29%), Positives = 39/133 (29%), Gaps = 9/133 (6%) Frame = -1 Query: 985 GGGGGXGXGGG------XXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG---GGXGXXGG 833 G GG GGG G GG G G GG GGGG GG G GG GG Sbjct: 173 GSSGGGRFGGGGGDRFNDRGSRGGDRYG-GDRRGGGGGGGGDRYGGGGGDRYGGDRYGGG 231 Query: 832 GXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXX 653 G GG G GG GGGGG Sbjct: 232 GGRRGSPDRRGGFRSGGGGGGYMRSGGGGGGPDRRDHRDNDRNGGGGGHRPYDPSFRRRV 291 Query: 652 XXGXGGXXGGXXG 614 G GG G Sbjct: 292 ESYGSGNSGGGGG 304 Score = 37.5 bits (83), Expect = 0.014 Identities = 34/123 (27%), Positives = 34/123 (27%) Frame = -1 Query: 946 GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGGXXX 767 G G G G G GGGG G G GG G G GG G GG Sbjct: 163 GQYMGDRRGGGSSGGGRFGGGGGDRFNDRGSRGGDRYGGDRRGGGGGGGGDRYGGGGGDR 222 Query: 766 XXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXGGXXGXXXXXXXXX 587 GG GGGGG G G GG G Sbjct: 223 Y---------------GGDRYGGGGGRRGSPDRRGGFRSGGGGGGYMRSGGGGGGPDRRD 267 Query: 586 HXD 578 H D Sbjct: 268 HRD 270 >Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical protein F15B9.4 protein. Length = 1140 Score = 65.7 bits (153), Expect = 5e-11 Identities = 42/118 (35%), Positives = 42/118 (35%), Gaps = 13/118 (11%) Frame = +1 Query: 646 PXXPXPP----PXPXXXXPPPPPXPXPXPXPPXPXPPPPXX--PPPXPXPPPPXXPPXXX 807 P P PP P PPPPP P P P PPPP P PPP PP Sbjct: 470 PPPPGPPSSLLPLINTNAPPPPPMPSINGHAPNPPPPPPLLGIAPMSTNAPPP--PPMPG 527 Query: 808 XPPPXXXXPPXPPPXP-------PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P PPP P PP PPP P P PPP P PP Sbjct: 528 MAPLSTGAPTPPPPPPVGMANGGPPPPPPLPLDLLKGAVAGLKSVPGGPPPPPPPPPP 585 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/99 (33%), Positives = 33/99 (33%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPPP P P PP P P P PP PPP P Sbjct: 464 PINANAPPPPGPPSSLLPLINTNAPPPPPMPSINGHAPNPPP----PPPLLGIAPMSTNA 519 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP PP P P P P PP PPP P Sbjct: 520 PPP--PPMPGMAPLSTGAPTPPPPPPVGMANGGPPPPPP 556 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 1/117 (0%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P PPPPP P P PP P Sbjct: 470 PPPPGPPSSLLPLINTNAPPPPPMPSINGHAPNPPPPPPLLGIAPMSTNAP-PPPPMPGM 528 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PPP PPPP P P P PPP P PPPP Sbjct: 529 APLSTGAPTPPPPPPVGMANGGPPPPPPLPLDLLKGAVAGLKSVPGGPPPPPPPPPP 585 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/99 (34%), Positives = 34/99 (34%), Gaps = 11/99 (11%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXX--------PPPPPXPXPXPXP---PXPXPPPPXXPP 762 PP P P PPP P PPPPP P P P P PPPP Sbjct: 488 PPPPPMPSINGHAPNPPPPPPLLGIAPMSTNAPPPPPMPGMAPLSTGAPTPPPPPPVGMA 547 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPPP P P PPP PPP P Sbjct: 548 NGGPPPPPPLP-LDLLKGAVAGLKSVPGGPPPPPPPPPP 585 Score = 52.4 bits (120), Expect = 5e-07 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 10/95 (10%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-----PXPPPXPXPP 888 PP P PP P PPP PP P P PPP PP P P PP Sbjct: 470 PPPPGPPSSLLPLINTNAPPP--PPM----PSINGHAPNPPPPPPLLGIAPMSTNAPPPP 523 Query: 889 PXXXXXPXXPXPPXXPPPXP-----XXPPPXPXXP 978 P P P PPP P PPP P P Sbjct: 524 PMPGMAPLSTGAPTPPPPPPVGMANGGPPPPPPLP 558 Score = 32.3 bits (70), Expect = 0.54 Identities = 31/128 (24%), Positives = 31/128 (24%), Gaps = 13/128 (10%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP P P P PPPPP P P PP Sbjct: 488 PPPPPMPSINGHAPNP------PPPPPLLGIAPMSTNAPPPPPMPGMAPLSTGAPTPPPP 541 Query: 804 XPXXPXXXXPPPXXPXP-------------PPXPPXXPXPPPPXPPXXXXPXPXPXPPXX 944 P PPP P P P P P PPPP P P Sbjct: 542 PPVGMANGGPPPPPPLPLDLLKGAVAGLKSVPGGPPPPPPPPPPSFMFNGKVPNAFSPGT 601 Query: 945 PXXPPPXP 968 P P Sbjct: 602 STSPVLSP 609 >AF045646-2|AAK29827.1| 371|Caenorhabditis elegans Collagen protein 103 protein. Length = 371 Score = 65.7 bits (153), Expect = 5e-11 Identities = 39/94 (41%), Positives = 39/94 (41%), Gaps = 2/94 (2%) Frame = -3 Query: 890 GGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG-GXG 717 GGG G GGG GG GGG GG GGG GG GG G GGG GGGG G G Sbjct: 75 GGGGGYGGGHGGAAVGGGYGGAVGGGGGGGYGGGHGGGHGGAVGGGYGGGGGGGGGCQCS 134 Query: 716 XGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GG Sbjct: 135 PSSNTCPPGPRGPPGQAGLDGLPGAPGQPGSNGG 168 Score = 61.7 bits (143), Expect = 8e-10 Identities = 40/114 (35%), Positives = 40/114 (35%), Gaps = 2/114 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G GGG GG G GG G GGG GGG GGG GG GGG GG Sbjct: 70 GYAQYGGGGGYGGGHGGAAVGGGYGGAVGGGGGGGYGGGHGGGHGG--AVGGGYGGGGGG 127 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GG G G G G G G G G G GG Sbjct: 128 GGGCQCSPSSNTCPPGPRGPPGQAGLDGLPGAPGQPGSNGGAGSNGASEGSAGG 181 Score = 58.8 bits (136), Expect = 5e-09 Identities = 47/135 (34%), Positives = 47/135 (34%), Gaps = 14/135 (10%) Frame = -3 Query: 980 GGXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG- 810 GG G GGG G GGG G G G G G G GGG GG GGG GG GGG Sbjct: 75 GGGGGYGGGHGGAAVGGGYGGAVGGGGGG---GYGGGHGGGHGGAVGGGYGGGGGGGGGC 131 Query: 809 ------XXXXGGXXGGGGXGXGGGXXG-----GGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G G G G G G G GG G G Sbjct: 132 QCSPSSNTCPPGPRGPPGQAGLDGLPGAPGQPGSNGGAGSNGASEGSAGGCKTCPAGPPG 191 Query: 662 GXGXXGXGXXGGXXG 618 G G G G Sbjct: 192 PPGPAGQAGRPGNDG 206 Score = 55.6 bits (128), Expect = 5e-08 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXGGGXGXXGGG 830 GGGGG G G G GG G G GG GGG G G G GGG G GGG Sbjct: 75 GGGGGYGGGHGGAAVGGGYGGAVGGGGGGGYGGGHGGGHGGAVGGGYGGGGGG 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG GG G GG GG G GGG G G GG GG Sbjct: 70 GYAQYGGGGGYGGGHGGAAVGGGYGGAVGGGGGGGYGGGHGGGHGGAVGG 119 Score = 39.5 bits (88), Expect = 0.004 Identities = 37/130 (28%), Positives = 37/130 (28%), Gaps = 9/130 (6%) Frame = -3 Query: 977 GXXGXGG--GXXGXGG--GXXGGXGXXGXXXXXGGG-----XGXGGGXGGGXGGGXGGXX 825 G G G G G G G GG G G GG G G G G G Sbjct: 146 GPPGQAGLDGLPGAPGQPGSNGGAGSNGASEGSAGGCKTCPAGPPGPPGPAGQAGRPGND 205 Query: 824 XXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G G G G G G GG G G G G Sbjct: 206 GQPGAPSFGGGVGAPGAPGPAGDAGSPGQPGAPGQPGRPGKNAQGGSSRPGPPGPAGPPG 265 Query: 644 XGXXGGXXGG 615 G GG Sbjct: 266 PPGNNGAPGG 275 Score = 35.5 bits (78), Expect = 0.058 Identities = 35/118 (29%), Positives = 35/118 (29%), Gaps = 5/118 (4%) Frame = -3 Query: 956 GXXGXGG--GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G G G G GGG G G G G G G G Sbjct: 191 GPPGPAGQAGRPGNDGQPGAPSF-GGGVGAPGAPGPAGDAGSPGQPGAPGQPGRPGKNAQ 249 Query: 782 GGGXGXG-GGXXG--GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G G G G G G G G G G G G G G G Sbjct: 250 GGSSRPGPPGPAGPPGPPGNNGAPGGGYGVGPPGPPGPSGRPGAPGQPGPDGQPGAPG 307 Score = 33.9 bits (74), Expect = 0.18 Identities = 28/115 (24%), Positives = 28/115 (24%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P P P P P P P P P P Sbjct: 186 PAGPPGPPGPAGQAGRPG-NDGQPGAPSFGGGVGAPGAPGPAGDAGSPGQPGAPGQPGRP 244 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PP P P P P P P P P P Sbjct: 245 GKNAQGGSSRPGPPGPAGPPGPPGNNGAPGGGYGVGPPGPPGPSGRPGAPGQPGP 299 Score = 32.7 bits (71), Expect = 0.41 Identities = 30/112 (26%), Positives = 30/112 (26%), Gaps = 1/112 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GG G G G G G G G G Sbjct: 197 GQAGRPGNDGQPGAPSFGGGVGAPGAPGPAGDAGSPGQPGAPGQPGRPGKNAQGGSSRPG 256 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G G GGG G G G G G G G G G Sbjct: 257 PPGPAGPPGPPGNNGAPGGG-YGVGPPGPPGPSGRPGAPGQPGPDGQPGAPG 307 Score = 29.1 bits (62), Expect = 5.1 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 11/98 (11%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG----G 810 G GG G G G G GGG G G G G G G G Sbjct: 245 GKNAQGGSSRPGPPGPAGPPGPPGNNGAPGGGYGVGPPGPPGPSGRPGAPGQPGPDGQPG 304 Query: 809 XXXXGGXXGGG-------GXGXGGGXXGGGGXGXGGXG 717 G G G G GGG G G G G Sbjct: 305 APGNDGTPGTDAAYCPCPGRGGGGGGYGAGAHHGGPQG 342 >AC024790-13|AAL32247.1| 311|Caenorhabditis elegans Hypothetical protein Y47D7A.13 protein. Length = 311 Score = 65.3 bits (152), Expect = 6e-11 Identities = 44/117 (37%), Positives = 44/117 (37%), Gaps = 3/117 (2%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG--GXGGGXGGXXXXGGGXXXXG-GX 789 GG G G GG GG GGG GG G GG GGG G G Sbjct: 38 GGGCGGGAPAAGGYAVAPQAPIGGGYAQPGGGYGGAGGFGGAYQAAPAIGGGGSYAGAGP 97 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G GG G G G G G G G GG G G G G G GG G Sbjct: 98 IGGGFGGAQGGYAGAGPIGGGAQGGYAGAGPIGGGAQGGYAGA-GPIGGGAQGGYAG 153 Score = 63.3 bits (147), Expect = 3e-10 Identities = 45/125 (36%), Positives = 45/125 (36%), Gaps = 4/125 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG-GXX 804 GG GGG G GG GG GG G GGG GG GG G G Sbjct: 61 GGYAQPGGGYGGAGG--FGGAYQAAPAIGGGGSYAGAGPIGGGFGGAQGGYAGAGPIGGG 118 Query: 803 XXGGXXGGG--GXGXGGGXXGGGGXGXGGXGXGXG-XGGGGGXXXXGXGGGXGXXGXGXX 633 GG G G G G GG G G G G G G GGG G G G Sbjct: 119 AQGGYAGAGPIGGGAQGGYAGAGPIGGGAQGGYAGPIGGGAGYQGGAPAQGAGYQQGPAV 178 Query: 632 GGXXG 618 GG G Sbjct: 179 GGGAG 183 Score = 57.6 bits (133), Expect = 1e-08 Identities = 36/103 (34%), Positives = 36/103 (34%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G G GGG G GGG GG GG G G GG Sbjct: 24 GGGGCCAPPPPPPCGGGCGGGAPAAGGYAVAPQAPIGGGYAQPGGGYGGAG-GFGGAYQA 82 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G GGG G G G G G GG G Sbjct: 83 APAIGGGGSYAGAGPIGGGFGGAQGGYAGAGPIGGGAQGGYAG 125 Score = 56.0 bits (129), Expect = 4e-08 Identities = 47/129 (36%), Positives = 47/129 (36%), Gaps = 11/129 (8%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXX-GGGXGXGGGXGG--------GXGGGXGGXXXXG 816 G GGG GG G GGG G GG GG G GG G G Sbjct: 40 GCGGGAPAAGGYAVAPQAPIGGGYAQPGGGYGGAGGFGGAYQAAPAIGGGGSYAGAGPIG 99 Query: 815 GGXXXXGGXXGG-GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG-X 642 GG GG GG G G GG GG G G G G GG G G G G G Sbjct: 100 GGF---GGAQGGYAGAGPIGGGAQGGYAGAGPIG-GGAQGGYAGAGPIGGGAQGGYAGPI 155 Query: 641 GXXGGXXGG 615 G G GG Sbjct: 156 GGGAGYQGG 164 Score = 54.4 bits (125), Expect = 1e-07 Identities = 39/111 (35%), Positives = 39/111 (35%), Gaps = 2/111 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXXG-GGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G G G GG GG G GG G GGG GG G GGG Sbjct: 88 GGGSYAGAGPIGGGFGGAQGGYAGAGPIGGGAQGGYAGAGPIGGGAQGGYAGAGPIGGGA 147 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG G G G G GG G G GGG G G G Sbjct: 148 Q--GGY--AGPIGGGAGYQGGAPAQGAGYQQGPAVGGGAGYQQQAPAQGAG 194 Score = 42.7 bits (96), Expect = 4e-04 Identities = 39/121 (32%), Positives = 39/121 (32%), Gaps = 1/121 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G GG G G G GGG G GG G G GGG G G Sbjct: 68 GGYGGAGGFGGAYQAAPAIGGGGSYAGAGPIGGGFGGAQGGYAGA-GPIGGG-AQGGYAG 125 Query: 805 XGGXGXG-XGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 G G G GG G G GG G G G G GG Sbjct: 126 AGPIGGGAQGGYAGAGPIGGGAQGGYAGPIGG---GAGYQGGAPAQGAGYQQGPAVGGGA 182 Query: 628 G 626 G Sbjct: 183 G 183 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/124 (26%), Positives = 33/124 (26%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG GG G G G GG GG G G GGG Sbjct: 39 GGCGGGAPAAGGYAVAPQAPIGGGYAQPGGGYGGAGGFGGAYQAAPAIGGGGSYAGAGPI 98 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 GG G GG G G G GG G G G G G Sbjct: 99 GGGFGGAQGGYAGAGPIGGGAQGGYAG--AGPIGGGAQGGYAGAGPIGGGAQGGYAGPIG 156 Query: 625 GXXG 614 G G Sbjct: 157 GGAG 160 Score = 33.5 bits (73), Expect = 0.24 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Frame = -3 Query: 977 GXXGXGGGXXGX--GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G GGG G G G GG G GGG G GG G G GG Sbjct: 125 GAGPIGGGAQGGYAGAGPIGGGAQGGYAGPIGGGAGYQGGAPAQGAGYQQGPAVGGGAGY 184 Query: 803 XXGGXXGGGGXGXGGGXXGGG 741 G G G G Sbjct: 185 QQQAPAQGAGYQQQAPAQGAG 205 >Z68750-1|CAA92963.1| 284|Caenorhabditis elegans Hypothetical protein K01A6.4 protein. Length = 284 Score = 64.9 bits (151), Expect = 8e-11 Identities = 44/105 (41%), Positives = 44/105 (41%), Gaps = 7/105 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX-GGXGXXGXXXXXGGG--XGXGGGXGGGXGGGXGGXXXXGGG 810 GG G GG G GGG GG G G GG G GG GG G GG GG Sbjct: 54 GGMQGGFGGQSGFGGGSSQGGFGGFGQQGGFGGNSQGGFGGQQGGFSGNSPGGFEGQQGG 113 Query: 809 XXXXGGXXG-GGGXGXGGGXXGGGG---XGXGGXGXGXGXGGGGG 687 G G GG G GG GG G G GG G G GGG G Sbjct: 114 FGGFGQQVGFGGQGGFGGNSQGGFGGQQSGFGGQGQQSGFGGGFG 158 Score = 56.8 bits (131), Expect = 2e-08 Identities = 39/115 (33%), Positives = 39/115 (33%), Gaps = 4/115 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G GG G GGG G GG G GG G GG G Sbjct: 42 GQGQQVGSQQGFGGMQGGFGGQSGFGGGSSQGGFGGFGQQGGFGGNSQGGFGGQQGGFSG 101 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG----GXGXXGXGXXGGXXGG 615 G G G GG G G GG GG GG G G G G GG Sbjct: 102 NSPGGFEGQQGGFGGFGQQVGFGGQGGFGGNSQGGFGGQQSGFGGQGQQSGFGGG 156 Score = 45.2 bits (102), Expect = 7e-05 Identities = 44/128 (34%), Positives = 44/128 (34%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXG--GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGG 810 GG G G GG G G GG GG G GG GG G G GG GG Sbjct: 73 GGFGGFGQQGGFGGNSQGGFGGQQGGFSGNSPGGFEGQQGGFGGFGQQVGFGGQGGFGGN 132 Query: 809 XXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G GG G GG G G G G GG G G GG G G Sbjct: 133 SQ---GGFGGQQSGFGGQGQQSGFGGGFGGNSQN-GFPAQRPSQQSGFGGQGMQSGFGMN 188 Query: 632 G--GXXGG 615 G GG Sbjct: 189 SQQGDFGG 196 Score = 35.5 bits (78), Expect = 0.058 Identities = 36/120 (30%), Positives = 36/120 (30%), Gaps = 5/120 (4%) Frame = -1 Query: 967 GXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGGXG--GGXGXXGGGXXXXGXXGXGG 797 G G G G G G GGG G GG G GG G G G G Sbjct: 42 GQGQQVGSQQGFGGMQGGFGGQSGFGGGSSQGGFGGFGQQGGFGGNSQGGFGGQQGGFSG 101 Query: 796 XGXG--XGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXGG 623 G G G G GG GG GG G G G GG GG Sbjct: 102 NSPGGFEGQQGGFGGFGQQVGFGGQGGFGGNSQGGFGGQQSGFGGQG--QQSGFGGGFGG 159 Score = 34.7 bits (76), Expect = 0.10 Identities = 34/130 (26%), Positives = 34/130 (26%), Gaps = 6/130 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-----GGXGXXGGGXXX 821 G GG G GG G GG G G GGG G G GG Sbjct: 122 GFGGQGGFGGNSQGGFGGQQSGFGGQGQQSGFGGGFGGNSQNGFPAQRPSQQSGFGGQGM 181 Query: 820 XGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXG-XGXXXXXG 644 G GG G GG G GG G G Sbjct: 182 QSGFGMNSQQGDFGGQGQQSGFEGNTQGHSQGGFGGQSSSGFGGQQGGQGGQGGFGGSTR 241 Query: 643 XGGXXGGXXG 614 GG GG G Sbjct: 242 TGGMQGGQGG 251 >U67967-1|AAC47829.1| 413|Caenorhabditis elegans PTL-1B protein protein. Length = 413 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 92 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 93 EPEPEPVPEPEPEPEPEPEP 112 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 97 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 98 PVPEPEPEPEPEP 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 96 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 97 EPVPEPEPEP-EPEPEP 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 93 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 94 PEPEPVPEPEPEPEPEPEP 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 91 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 92 PEPEPEPVPEP-EPEPEPEPEP 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 115 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 116 KEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 109 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 110 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 79 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 80 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 94 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 95 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 147 >U67966-1|AAB97090.1| 453|Caenorhabditis elegans PTL-1A protein protein. Length = 453 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 92 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 93 EPEPEPVPEPEPEPEPEPEP 112 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 97 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 98 PVPEPEPEPEPEP 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 96 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 97 EPVPEPEPEP-EPEPEP 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 93 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 94 PEPEPVPEPEPEPEPEPEP 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 91 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 92 PEPEPEPVPEP-EPEPEPEPEP 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 115 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 116 KEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 109 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 110 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 79 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 80 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 94 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 95 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 147 >U38983-1|AAA80687.1| 436|Caenorhabditis elegans TAU-1b protein. Length = 436 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 70 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 71 EPEPEPVPEPEPEPEPEPEP 90 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 75 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 76 PVPEPEPEPEPEP 88 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 74 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 75 EPVPEPEPEP-EPEPEP 90 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 71 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 72 PEPEPVPEPEPEPEPEPEP 90 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 69 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 70 PEPEPEPVPEP-EPEPEPEPEP 90 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 34 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 93 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 94 KEEEVVVESPPREQEPEKSGKSKPSSPIP 122 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 28 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 87 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 88 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 122 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 57 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 58 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 90 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 72 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 73 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 125 >U38982-1|AAA80686.1| 431|Caenorhabditis elegans TAU-1a protein. Length = 431 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 70 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 71 EPEPEPVPEPEPEPEPEPEP 90 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 75 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 76 PVPEPEPEPEPEP 88 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 74 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 75 EPVPEPEPEP-EPEPEP 90 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 71 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 72 PEPEPVPEPEPEPEPEPEP 90 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 69 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 70 PEPEPEPVPEP-EPEPEPEPEP 90 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 34 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 93 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 94 KEEEVVVESPPREQEPEKSGKSKPSSPIP 122 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 28 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 87 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 88 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 122 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 10 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 57 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 58 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 90 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 16 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 72 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 73 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 125 >U00051-4|AAK70645.1| 453|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform a protein. Length = 453 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 92 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 93 EPEPEPVPEPEPEPEPEPEP 112 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 97 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 98 PVPEPEPEPEPEP 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 96 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 97 EPVPEPEPEP-EPEPEP 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 93 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 94 PEPEPVPEPEPEPEPEPEP 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 91 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 92 PEPEPEPVPEP-EPEPEPEPEP 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 115 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 116 KEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 109 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 110 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 79 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 80 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 94 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 95 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 147 >U00051-3|AAK70647.1| 413|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform c protein. Length = 413 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 92 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 93 EPEPEPVPEPEPEPEPEPEP 112 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 97 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 98 PVPEPEPEPEPEP 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 96 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 97 EPVPEPEPEP-EPEPEP 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 93 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 94 PEPEPVPEPEPEPEPEPEP 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 91 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 92 PEPEPEPVPEP-EPEPEPEPEP 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 115 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 116 KEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 109 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 110 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 79 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 80 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 94 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 95 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 147 >U00051-2|AAK70646.1| 458|Caenorhabditis elegans Protein with tau-like repeats protein1, isoform b protein. Length = 458 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPE---PEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQP--EPEPEPEVEP 92 Query: 832 PPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P Sbjct: 93 EPEPEPVPEPEPEPEPEPEP 112 Score = 56.0 bits (129), Expect = 4e-08 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +1 Query: 700 PXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPP 870 P P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPE 97 Query: 871 PXPXPPPXXXXXP 909 P P P P P Sbjct: 98 PVPEPEPEPEPEP 110 Score = 54.0 bits (124), Expect = 2e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP-EP 96 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 97 EPVPEPEPEP-EPEPEP 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPE-PEPEPEP---EPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPE 93 Query: 793 PPXXXXPPPXXXXPPXPPP 849 P P P P P P Sbjct: 94 PEPEPVPEPEPEPEPEPEP 112 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 P P P P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPEPEPEPEPEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVE 91 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P Sbjct: 92 PEPEPEPVPEP-EPEPEPEPEP 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPP-PXPXPXPXP-PXPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P P P Sbjct: 56 PEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEPVVE 115 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P Sbjct: 116 KEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPP-XPXPPPPXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P P P P P Sbjct: 50 PEPEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEPEPEPVPEPEPEPEPE 109 Query: 787 XXPPXXXXPPPXXXXPP--XPPPXPPPXPPPXPXP 885 P PP P P P P Sbjct: 110 PEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIP 144 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P P P P P P P P P P P Sbjct: 32 PEVAVEPEPEPE-PEPEPEPEPEPEPEPEPEPKPKPEVEPVPQP-----------EPEPE 79 Query: 872 XXXXPPPXPXXXPXPPPXPXXPXPPXPXPPXXP 970 P P P P P P P P P P P Sbjct: 80 YQPEPEPEPEVEPEPEPEPVPEPEPEPEPEPEP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 26/115 (22%), Positives = 26/115 (22%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P P P P P P P P P P P Sbjct: 38 PEPEPEPEPEPEPE---PEPEPEPEPEPKPKPEVEPVPQPEPEPEYQPEPEPEPEVEPEP 94 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P Sbjct: 95 EPEPVPE--PEPEPEPEPEPVVEKEEEVVVESPPREQEPEKSGKSKPSSPIPDAP 147 >AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical protein Y48G9A.4 protein. Length = 1115 Score = 63.7 bits (148), Expect = 2e-10 Identities = 36/94 (38%), Positives = 36/94 (38%), Gaps = 6/94 (6%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P PPP P P PP PPP PPP PP P P Sbjct: 508 PPTP----PPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPP--PPIAGLLAANGTNVPIP 561 Query: 844 PPXPPPXP------PPXPXPPPXXXXXPXXPXPP 927 PP PPP P PP P PPP P P PP Sbjct: 562 PPPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPP 595 Score = 61.3 bits (142), Expect = 1e-09 Identities = 35/100 (35%), Positives = 35/100 (35%), Gaps = 7/100 (7%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-------PXXPPPXPXPPPPX 789 P P P P P PP P P P P PPP P P PPPP Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPPPIAGLLAANGTNVPIPPPPPPP 567 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PP P PPP P PP P PPP P Sbjct: 568 LPQNLSGAPP-----PPPPPPPMLGGPPPPPPPPGGLMGP 602 Score = 57.6 bits (133), Expect = 1e-08 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 11/91 (12%) Frame = +1 Query: 688 PPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PP PP P P P PP P PP PPPP P P PPP Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPP--PIAGLLAANGTNVPIPPPPP 565 Query: 853 PP------PXPPPXPXPPPXXXXXPXXPXPP 927 PP PPP P PPP P P PP Sbjct: 566 PPLPQNLSGAPPPPPPPPPMLGGPPPPPPPP 596 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 21/95 (22%) Frame = +1 Query: 616 PPXXPPXXPXPXX----------PXPPPXPXXXXPPPPPXPX-------PXPXPPXPXPP 744 PP PP P P P P P P PPPPP P PP P PP Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPPPIAGLLAANGTNVPIPPPPPPP 567 Query: 745 PPXX----PPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P PPP P PPP P PPP P Sbjct: 568 LPQNLSGAPPPPPPPPPMLGGPPPPPPPPGGLMGP 602 Score = 52.0 bits (119), Expect = 6e-07 Identities = 28/76 (36%), Positives = 28/76 (36%), Gaps = 5/76 (6%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 P PPPP P PP P P P PPP P P PP PPP Sbjct: 509 PTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPPPIAGLLAANGTNVPIPPPPPPPL 568 Query: 946 P----XXPPPXPXXPP 981 P PPP P PP Sbjct: 569 PQNLSGAPPPPPPPPP 584 Score = 51.6 bits (118), Expect = 8e-07 Identities = 31/89 (34%), Positives = 31/89 (34%), Gaps = 21/89 (23%) Frame = +3 Query: 777 PPXPXPXPPXPXX---------PXXXXPPPXXPXPPPXP------------PXXPXPPPP 893 PP P P P P P PPP PPP P P P PPPP Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPPPIAGLLAANGTNVPIPPPPPPP 567 Query: 894 XPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PP P PPP Sbjct: 568 LPQNLSGAPPPPPPPPPMLGGPPPPPPPP 596 Score = 49.6 bits (113), Expect = 3e-06 Identities = 30/96 (31%), Positives = 30/96 (31%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPP P P P P Sbjct: 508 PPTPPPPAPGPHKEQRRSTSKDPPRPAPPPVSSIPPPPPIAGLLAANGTNV------PIP 561 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P P P PPP PP PPPP PP Sbjct: 562 PPPPPPLPQNLSGAP--PPPPPPPPMLGGPPPPPPP 595 >Z98866-8|CAB11562.2| 425|Caenorhabditis elegans Hypothetical protein Y49E10.10 protein. Length = 425 Score = 63.3 bits (147), Expect = 3e-10 Identities = 34/111 (30%), Positives = 34/111 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP PPP P P P P P P P P P Sbjct: 184 PPPTTKAPPPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTAPAPNP-PAPENTT 242 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P P P P P P P P PP P P Sbjct: 243 AKVETTKPTKAAPPAPTPVPNPVPSPPPPPANTTVTEEKTTVPPATDEPAP 293 Score = 60.9 bits (141), Expect = 1e-09 Identities = 36/122 (29%), Positives = 36/122 (29%), Gaps = 1/122 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PPPP P P PPPP P PP PP Sbjct: 151 PATAPVTPEPTVKNTTAAEPTTEAPPPPTTKAPPPPTTKAPPPP--TTKAPPPPTTKAPP 208 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXPPPXPXX 975 P P P P P P P P P PP P P P P Sbjct: 209 PPTTNKEVTTVAPVPKPAPVTAPAPNPPAPENTTAKVETTKPTKAAPPAPTPVPNPVPSP 268 Query: 976 PP 981 PP Sbjct: 269 PP 270 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/135 (27%), Positives = 37/135 (27%), Gaps = 13/135 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPX--------PXPXPXP---PXPXPPPPXXPP 762 PP P P PP P PPPP P P P P P P PP P Sbjct: 183 PPPPTTKAPPPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTAPAPNPPAPENTT 242 Query: 763 PX--PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P PP P PP PP PP P P Sbjct: 243 AKVETTKPTKAAPPAPTPVPNPVPSPPPPPANTTVTEEKTTVPPATDEPAPKTVATTENP 302 Query: 937 PPXPXXPPPXPXXPP 981 P P P PP Sbjct: 303 KPIDNSTPQKPPNPP 317 Score = 45.2 bits (102), Expect = 7e-05 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 5/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXP---PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P P P P P P P P PP Sbjct: 117 PPAGDPSKTKPQGGDPAKPKPQTGDPYATNSTVKPATAPVTPEPTVKNTTAAEPTTEAPP 176 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P PPP P PPP P PP PPP P P P Sbjct: 177 P---PTTKAPPPPTTKAP-PPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTAPA 232 Query: 961 PXPXXP 978 P P P Sbjct: 233 PNPPAP 238 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/121 (24%), Positives = 30/121 (24%), Gaps = 3/121 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP---PPXXPP 798 P P P P P P P P P P P P Sbjct: 111 PAGKPNPPAGDPSKTKPQGGDPAKPKPQTGDPYATNSTVKPATAPVTPEPTVKNTTAAEP 170 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PPP P PP P PP PPP P P P P P Sbjct: 171 TTEAPPPPTTKAPPPPTTKAPPPPTTKAPPPPTTKAPPPPTTNKEVTTVAPVPKPAPVTA 230 Query: 979 P 981 P Sbjct: 231 P 231 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/112 (25%), Positives = 29/112 (25%), Gaps = 5/112 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-----PXPXPPPPXXPPPXPXPP 780 PP P P P P P PP P P PP P P P P Sbjct: 208 PPPTTNKEVTTVAPVPKPAPVTAPAPNPPAPENTTAKVETTKPTKAAPPAPTPVPNPVPS 267 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP P PP P P P P P P P Sbjct: 268 PPPPPANTTVTEEKTTVPPATDEPAPKTVATTENPKPIDNSTPQKPPNPPVP 319 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXP-PXPX 791 P P P P P P PPP PP P P P Sbjct: 175 PPPPTTKAPPPPTTKAPPPPTTKAPPPPTTKAPPP--PTTNKEVTTVAPVPKPAPVTAPA 232 Query: 792 PXPPXP---XXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P PP P P P P P P P PP PP Sbjct: 233 PNPPAPENTTAKVETTKPTKAAPPAPTPVPNPVPSPPPPP 272 Score = 36.3 bits (80), Expect = 0.033 Identities = 26/108 (24%), Positives = 26/108 (24%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P Sbjct: 106 PRGGDPAGKPNPPAGDPSKTKPQGGDPAKPKPQTGDPYATNSTVKPATAPVTPEPTVKNT 165 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PP PPP P P PPP PPP Sbjct: 166 TAAEPTTEAPPPPTT----KAPPPPTTKAPPPPTTKAPPPPTTKAPPP 209 Score = 30.7 bits (66), Expect = 1.7 Identities = 32/133 (24%), Positives = 32/133 (24%), Gaps = 11/133 (8%) Frame = +1 Query: 616 PPXXPPXX--PXPXXPXPPPXPXXXXPPPPPXPXPXPXP----PXPXPPPPXXPPPXPXP 777 PP P P P P P P P P P P PP P P Sbjct: 68 PPAGDPTKLKPGGGGPAGKPGPNAGDTTKPNSQSGDPKPRGGDPAGKPNPPAGDPSKTKP 127 Query: 778 P--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP- 948 P P P P P P P P PP P Sbjct: 128 QGGDPAKPKPQTGDPYATNSTVKPATAPVTPEPTVKNTTAAEPTTEAPPPPTTKAPPPPT 187 Query: 949 --XXPPPXPXXPP 981 PPP PP Sbjct: 188 TKAPPPPTTKAPP 200 >Z81525-8|CAB04257.1| 208|Caenorhabditis elegans Hypothetical protein F33A8.3 protein. Length = 208 Score = 61.7 bits (143), Expect = 8e-10 Identities = 37/93 (39%), Positives = 37/93 (39%), Gaps = 2/93 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGX--GGGXGGXXXXGGGXXXXG 795 G GG G GG G G GG GGG GG GGG GG GG Sbjct: 112 GRGGRGRGRRGGRGGIRHDSGSRDAEEGGAPRGGGRGGSRRGGGGRGGGRTNSGGEETAR 171 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG G GGG GG G G G G G GG Sbjct: 172 DTDGGERGGRGGGRRGGRGRGGRGRGGRGGQGG 204 Score = 53.2 bits (122), Expect = 3e-07 Identities = 36/93 (38%), Positives = 36/93 (38%), Gaps = 6/93 (6%) Frame = -3 Query: 887 GGXGXGGGXGGGXGG---GXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGG 723 G G G G GG GG G GG GG G GG G GGG GG Sbjct: 112 GRGGRGRGRRGGRGGIRHDSGSRDAEEGGAPRGGGRGGSRRGGGGRGGGRTNSGGEETAR 171 Query: 722 XGXGXGXGGGGGXXXXGXG-GGXGXXGXGXXGG 627 G GG GG G G GG G G G GG Sbjct: 172 DTDGGERGGRGGGRRGGRGRGGRGRGGRGGQGG 204 Score = 35.9 bits (79), Expect = 0.044 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 5/74 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXGXX---GGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GG G G GG G G G GG GG GG GGG GG Sbjct: 114 GGRGRGRRGGRGGIRHDSGSRDAEEGGAPRGGGRGGSRRGGGGRGGGRTNSGGEETARDT 173 Query: 811 XG--XGGXGXGXGG 776 G GG G G G Sbjct: 174 DGGERGGRGGGRRG 187 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = -1 Query: 985 GGGGGXGXGGG---XXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG 845 G GGG GG GG G G GG G GG G GG GG G Sbjct: 156 GRGGGRTNSGGEETARDTDGGERGGRGGGRRGGRGRGGRG-RGGRGGQGG 204 Score = 32.3 bits (70), Expect = 0.54 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG GGG G G G GG G GG GG G GG G G Sbjct: 146 GRGGSRRGGGGRGG--GRTNSGGEETARDTDGGERGGRGGGRRGGRGR--GGRGRGGRGG 201 Query: 805 XGG 797 GG Sbjct: 202 QGG 204 Score = 30.3 bits (65), Expect = 2.2 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 9/79 (11%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG--------XGXXGG- 833 GG GG G G G GGGG G GG G GG Sbjct: 122 GGRGGIRHDSGSRDAEEGGAPRGGGRGGSRRGGGGRGGGRTNSGGEETARDTDGGERGGR 181 Query: 832 GXXXXGXXGXGGXGXGXGG 776 G G G GG G G G Sbjct: 182 GGGRRGGRGRGGRGRGGRG 200 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 61.7 bits (143), Expect = 8e-10 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 3/91 (3%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P P P P P P P PPP P PPP PP PPP P P PPP P P Sbjct: 31 PTPMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCP-PPPPPMP 89 Query: 886 PPXXXXXPXXP--XPPXXPP-PXPXXPPPXP 969 P P P P P P P P Sbjct: 90 RPSCPCMMQRPSFYPSYVPQYYQPMMPQPMP 120 Score = 61.3 bits (142), Expect = 1e-09 Identities = 34/91 (37%), Positives = 34/91 (37%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P PPPPP P PP PPPP P P P PPPP P Sbjct: 33 PMCQPRMPCAA-PMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPPM--P 89 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P Sbjct: 90 RPSCPCMMQRPSFYPSYVPQYYQPMMPQPMP 120 Score = 58.4 bits (135), Expect = 7e-09 Identities = 34/98 (34%), Positives = 34/98 (34%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P P P P P PP P PPP PPP P Sbjct: 31 PTPMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPP--------PPPPMPCP 82 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PPP P P P P P P P P Sbjct: 83 PPPPPMPRPSCPCMMQRPSFYPSYVPQYYQPMMPQPMP 120 Score = 51.6 bits (118), Expect = 8e-07 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = +3 Query: 780 PXPXPX-PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P PP P P PPP PPP PP PPPP P P P P Sbjct: 48 PMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPPMPRPSCPCMMQRPSFYPSYV 107 Query: 957 PPXPXPPPP 983 P P P Sbjct: 108 PQYYQPMMP 116 Score = 49.2 bits (112), Expect = 4e-06 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPX-PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P PPP P P P P PP PPP P PPP P Sbjct: 31 PTPMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPP--PPPMPCPPPPPPM 88 Query: 973 XPP 981 P Sbjct: 89 PRP 91 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PPPP P P P PP P P P P PP P Sbjct: 40 PCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPPPPMP 89 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P PPP P PPP PP P P P PP P Sbjct: 33 PMCQPRMPCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPCPPPP------P 86 Query: 960 PXPXPPPP 983 P P P P Sbjct: 87 PMPRPSCP 94 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP---XXPPPXPXPPPP 786 PP P P P PP PPPPP P P P PP P P P P P P Sbjct: 56 PPPPCPAQFCPPPPICPP------PPPPPMPCPPPPPPMPRPSCPCMMQRPSFYPSYVPQ 109 Query: 787 XXPPXXXXPPP 819 P P P Sbjct: 110 YYQPMMPQPMP 120 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P PP PP P PPP P P P P P P Sbjct: 44 PMPMPMPMPVCPPPPPCPAQFCPPPPICPP--PPPPPMPCPPPPPPMPRPSCPCMMQRPS 101 Query: 960 PXPXPPP 980 P P Sbjct: 102 FYPSYVP 108 Score = 33.5 bits (73), Expect = 0.24 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 2/94 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PPPP PP P P P P Sbjct: 40 PCAAPMPMPMPMPVCPPPPPCPAQFCPPPPICPPPPPPPMPC-------------PPPPP 86 Query: 795 XPPXPXXPXXXXPPPXXP--XPPPXPPXXPXPPP 890 P P P P P P P P P P Sbjct: 87 PMPRPSCPCMMQRPSFYPSYVPQYYQPMMPQPMP 120 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 61.3 bits (142), Expect = 1e-09 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 6/88 (6%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP------ 885 P PPPP PP P P PP P PPP P P P P P Sbjct: 436 PTRVAPPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKS 495 Query: 886 PPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P P PPP P PPP P Sbjct: 496 PPPPPPLPPIATPSSVPPPPPPPPPPPP 523 Score = 59.7 bits (138), Expect = 3e-09 Identities = 36/91 (39%), Positives = 36/91 (39%), Gaps = 15/91 (16%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPP------PPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PPPPP P P P PP P P P PPP P P P Sbjct: 433 PKTPTRVAPPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAP-PPPSRIPNPSPSPQPAE 491 Query: 826 XX--PPXPPPXPP-------PXPPPXPXPPP 891 PP PPP PP P PPP P PPP Sbjct: 492 VSKSPPPPPPLPPIATPSSVPPPPPPPPPPP 522 Score = 59.3 bits (137), Expect = 4e-09 Identities = 32/87 (36%), Positives = 32/87 (36%), Gaps = 4/87 (4%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP-XPPPXPPP---XPPPXPXPPPXXX 900 P P PPP P PP P P PP P P PPP P P P P P Sbjct: 433 PKTPTRVAPPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEV 492 Query: 901 XXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P PP P PP Sbjct: 493 SKSPPPPPPLPPIATPSSVPPPPPPPP 519 Score = 59.3 bits (137), Expect = 4e-09 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P P P P PPPP P P P P PPP Sbjct: 441 PPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAPPPPSRIP-NPSPSPQPAEVSKSPPPP 499 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PPP P PPP Sbjct: 500 PPLPPIATPSSVPPPPPPPPPPPP 523 Score = 58.4 bits (135), Expect = 7e-09 Identities = 31/92 (33%), Positives = 31/92 (33%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P P P P P P P P PPPP P Sbjct: 444 PPSAPPTIKFPISTGPSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLP 503 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP PPP PPP PP Sbjct: 504 PIAT--PSSVPPPPPPPPPPPPALEQEISGPP 533 Score = 58.0 bits (134), Expect = 1e-08 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 3/84 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX---PPPPX 789 P PP P P PP P P P PP P P P P PPPP Sbjct: 441 PPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPP- 499 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPP 861 PP P PP PPP PPP Sbjct: 500 -PPLPPIATPSSVPPPPPPPPPPP 522 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P PP P PP P P P Sbjct: 441 PPPPPSAPPTIKFPISTGPSYSSTTPPTTPKPAPP--PPSRIPNPSPSPQPAEVSKSPPP 498 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPP 869 PP P PP P PPP PP Sbjct: 499 PPPLPPIATPSSVPPPPPPPPPPPP 523 >L25598-2|AAV58887.1| 780|Caenorhabditis elegans Calpain family protein 1, isoform a protein. Length = 780 Score = 61.3 bits (142), Expect = 1e-09 Identities = 36/77 (46%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GGG GGG G GGG GG GG G GGGG GG GGGG G G Sbjct: 122 GGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGG---GGGGFGDILGGI 178 Query: 713 GXGXGGGGGXXXXGXGG 663 G GGGGG G GG Sbjct: 179 GSLIGGGGGGQYNGGGG 195 Score = 58.0 bits (134), Expect = 1e-08 Identities = 48/134 (35%), Positives = 48/134 (35%), Gaps = 16/134 (11%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXG-GGXGXGGGX------------GGGXGGGXGGX 828 G GGG G GGG GG G G GG G G GG Sbjct: 54 GGGGGGGGGGGGFGGGNGGFGGGSNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK 113 Query: 827 XXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGX 657 GG GGGG GGG GGGG GG G GGGGG G GGG Sbjct: 114 GKKEQDNYGGGGNYGGGGGNQGGG--GGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGF 171 Query: 656 GXXGXGXXGGXXGG 615 G G G GG Sbjct: 172 GDI-LGGIGSLIGG 184 Score = 56.8 bits (131), Expect = 2e-08 Identities = 35/89 (39%), Positives = 35/89 (39%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GGG GGG GGG G G GG GGG G G G Sbjct: 122 GGGGNYG-----GGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILG 176 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GG G G GGGG GG Sbjct: 177 GIGSLIGGGGGGQYNGGGGNVNPNNLNGG 205 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/75 (44%), Positives = 33/75 (44%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G GGG G GG G GG GG GGG G GG Sbjct: 124 GGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFG--DILGGIGSL 181 Query: 800 XGGXXGGGGXGXGGG 756 GG GGGG GGG Sbjct: 182 IGG--GGGGQYNGGG 194 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 6/76 (7%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGX----GGGGXG--XXGGXGGGXGXXGGGXX 824 GGGG G GGG G GG G G GG GGGG G GG GGG G GG Sbjct: 122 GGGGNYGGGGGNQG--GGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIG 179 Query: 823 XXGXXGXGGXGXGXGG 776 G GG G GG Sbjct: 180 SLIGGGGGGQYNGGGG 195 Score = 50.8 bits (116), Expect = 1e-06 Identities = 33/81 (40%), Positives = 33/81 (40%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GGG GGG GG G GGG G GGG GG GG Sbjct: 122 GGGGNYGGGGGNQGGGGGGGFNFNDIGGLI-NSMGGGGGGGQRQGGGGGGFGDILGG--- 177 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 G GGGG GG GGGG Sbjct: 178 IGSLIGGGG---GGQYNGGGG 195 Score = 50.4 bits (115), Expect = 2e-06 Identities = 44/135 (32%), Positives = 44/135 (32%), Gaps = 14/135 (10%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX---GGXGXXGXXXXXG--------GGXGXGGGXGGGX---GG 843 GG G GGG G GGG GG G G GG G Sbjct: 61 GGGGGFGGGNGGFGGGSNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRKGKKEQDN 120 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG GGG GG GG GG G G GG G GGG G G G Sbjct: 121 YGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGS 180 Query: 662 GXGXXGXGXXGGXXG 618 G G G G G Sbjct: 181 LIGGGGGGQYNGGGG 195 Score = 48.4 bits (110), Expect = 8e-06 Identities = 40/130 (30%), Positives = 40/130 (30%), Gaps = 6/130 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG---GGXGXXGGGXXXXG 815 GG GG GG GG G G G GG GGG G GG GG G G Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGGSNYDQGGNGNSGDQQKRKR 95 Query: 814 XXG---XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXG 644 GG G G GG GGGGG G G Sbjct: 96 DMAKDLIGGIFDNVVNRKGKKEQDNYGGGGNYGGGGGNQGGGGGGGFNFNDIGGLINSMG 155 Query: 643 XGGXXGGXXG 614 GG G G Sbjct: 156 GGGGGGQRQG 165 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GG G GG GGGG G GGG GG G GG G G G Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGGSNYDQGGNGNSG 88 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG GGGG G GG G G G GGG G G G Sbjct: 52 GGGGGGGGGGGGGGFGGGNGGFGGGSNYDQGGNGNSG 88 Score = 42.7 bits (96), Expect = 4e-04 Identities = 39/122 (31%), Positives = 39/122 (31%), Gaps = 10/122 (8%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXG-----GXGXXGXXXXXGGGXGXG---GGXGGGXGGGXGGXX 825 GG G GGG G G G G GGG G G GG G GGG GG Sbjct: 131 GGNQGGGGGGGFNFNDIGGLINSMGGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQY 190 Query: 824 XXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG--XGGGGGXXXXGXGGGXGX 651 GGG GG G G G G G G G G GG Sbjct: 191 NGGGGNVNPNN-LNGGMVNVIGNLIGEAAHRFLGVDPGTGRIIGAVAGNVIMGLGGKDNS 249 Query: 650 XG 645 G Sbjct: 250 LG 251 Score = 34.7 bits (76), Expect = 0.10 Identities = 35/109 (32%), Positives = 35/109 (32%), Gaps = 3/109 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGG--GXGGGXGGXXXXGGG 810 GG GG G GGG G G G GG G GGG GG GGG GG Sbjct: 148 GGLINSMGG--GGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 205 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G G G G G GG G G Sbjct: 206 MVNVIGNLIGEAAHRFLGVDPGTGRIIGAVAGNVIMGLGGKDNSLGNIG 254 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 761 GGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G GG G G G GGGGG G GGG G G G Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGG--GGGFGGGNGGFGGG 76 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGGG G G G G G GG GGG GG GG Sbjct: 155 GGGGGGGQRQGGGGGGFGDILGGIGSLIGGGGGGQYNGGGGNVNPNNLNGG 205 >Z81094-7|CAB03153.2| 960|Caenorhabditis elegans Hypothetical protein F58G11.2 protein. Length = 960 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/65 (47%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXG--XGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG GG GG G G GGG GGGG G GG G G GGGG G GGG G Sbjct: 809 GGYGGRGGGFGGTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGSGGGGGFGGVKP 868 Query: 641 GXXGG 627 GG Sbjct: 869 SGFGG 873 Score = 57.6 bits (133), Expect = 1e-08 Identities = 37/87 (42%), Positives = 37/87 (42%), Gaps = 2/87 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-GGXXGGGGXGXGGXGXGXGXGG 696 G G GG GG GG G G GG GGGG G GG GG G GG G G GG Sbjct: 804 GFGQRGGYGGRGGG--FGGTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGSGGGG 861 Query: 695 G-GGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G GG GG G Sbjct: 862 GFGGVKPSGFGGSRNNAEPTSSGGGFG 888 Score = 56.0 bits (129), Expect = 4e-08 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 1/80 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGX 714 GG G GGG GG G GG GG GG GG G GG G GGG G GG Sbjct: 809 GGYGGRGGGFGGTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGSGGGGGFGGVKP 868 Query: 713 GXGXGGGGGXXXXGXGGGXG 654 G GGG G Sbjct: 869 SGFGGSRNNAEPTSSGGGFG 888 Score = 52.0 bits (119), Expect = 6e-07 Identities = 35/109 (32%), Positives = 35/109 (32%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G G GG G GG G G GG GGG G GGG Sbjct: 809 GGYGGRGGGFGGTGRGRGGGVFGGGGR---GGDFGGSGNFGGSGGGGSFGGSGGGGGFGG 865 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GGG G G GG G Sbjct: 866 VKPSGFGGSRNNAEPTSSGGGFGAPKAPTGFPSDNNDASEDAPAAGGFG 914 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 1/98 (1%) Frame = -3 Query: 977 GXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G GG GG G G GG GGG GG GG G GGG Sbjct: 798 GKSGTSGFGQRGGYGGRGGGFGGTGRGR---GGGVFGGGGRGGDFGGSGNFGGSGGG--- 851 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G GG G GG G G GGG G Sbjct: 852 -GSFGGSGGGGGFGGVKPSGFGGSRNNAEPTSSGGGFG 888 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGG-XGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G GG G GG G G G GG GGGG G G G G GGG G G Sbjct: 801 GTSGFGQRGGYGGRGGGFG-GTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGSGG 859 Query: 805 XGGXG 791 GG G Sbjct: 860 GGGFG 864 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/60 (45%), Positives = 27/60 (45%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GG GG G G GG G G G G GG G GG G G GG GG Sbjct: 798 GKSGTSGFGQRGGY-GGRGGGFGGTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGG 856 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG--GGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GGG G G G G G GG GG GG G GG GGG G GG G G Sbjct: 809 GGYGGRGGGFGGT--GRGRGGGVFGGGGRGGDFGGSGNFGGSGGG-GSFGGSGGGGGFGG 865 Query: 805 XGGXGXG 785 G G Sbjct: 866 VKPSGFG 872 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/68 (41%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGGGXGXXGXG 639 G G G GG G G GG G G GG G G GG GG G GG G G Sbjct: 801 GTSGFGQRGGYGGRGGG---FGGTGRGRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGS 857 Query: 638 XXGGXXGG 615 GG GG Sbjct: 858 GGGGGFGG 865 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GGG GGG G GG G G G GG G G GG GG GG Sbjct: 824 GRGGGVFGGGGRGGDFGGSGNFGGSGGGGSFGGSGGG--GGFGGVKPSGFGGSRNNAEPT 881 Query: 805 XGGXGXG 785 G G G Sbjct: 882 SSGGGFG 888 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/67 (43%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPP---PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PPPP P P P PPP PPP PPP PP PP PP P PP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPP 83 Query: 859 PXPPPXP 879 P P P P Sbjct: 84 PPPEPEP 90 Score = 58.8 bits (136), Expect = 5e-09 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = +1 Query: 664 PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P P PPP PPP PPPP P PP PP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPP 83 Query: 841 PPPXPPP 861 PPP P P Sbjct: 84 PPPEPEP 90 Score = 57.2 bits (132), Expect = 2e-08 Identities = 30/72 (41%), Positives = 30/72 (41%), Gaps = 7/72 (9%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPP-----XXPPPXPXPPPPXXPPXXXXPPPXXXXPP--XPPPX 852 PPP P P P PPP PPP PPP PP PP PP PPP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPP 83 Query: 853 PPPXPPPXPXPP 888 PPP P P P Sbjct: 84 PPPEPEPQQDQP 95 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 4/76 (5%) Frame = +1 Query: 655 PXPP----PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P PP P P PPPP PP PPP PPP PP P PPP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPP- 82 Query: 823 XXXPPXPPPXPPPXPP 870 PP P P P P Sbjct: 83 ---PPPPEPEPQQDQP 95 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 2/76 (2%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXX- 933 PPP P P P PPP PPP PP PP PPP P PP Sbjct: 25 PPPDWFFPGPLRP---WGPPPPWHRNRGPPPFGPP--PPWDRPPPPWRRPPWHRRPPWGL 79 Query: 934 -PPPXPXXPPPXPXXP 978 PPP P P P P Sbjct: 80 PPPPPPPEPEPQQDQP 95 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 8/65 (12%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXX--PPP--PPXPXPXPXPPXPXPP----PPXXPPPXP 771 PP P P P PP P PPP PP P P PP PP PP PP P Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPP 83 Query: 772 XPPPP 786 PP P Sbjct: 84 PPPEP 88 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 2/77 (2%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXX--PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 PPPP P P P PP PPP PP P PP PP PP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPW-----G 78 Query: 913 XPXPPXXPPPXPXXPPP 963 P PP P P P P Sbjct: 79 LPPPPPPPEPEPQQDQP 95 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP-XXPPPXPXXP 957 PP PP P P P PP PPP PPP P PP PP P Sbjct: 24 PP--PPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPP 81 Query: 958 PPXPXXP 978 PP P P Sbjct: 82 PPPPPEP 88 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPPXP-PXXPXPPP--PXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P PP P PPP P PP P P PP P P PP Sbjct: 24 PPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPP 83 Query: 978 PP 983 PP Sbjct: 84 PP 85 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P PPP P PP P PP PP P P P Sbjct: 24 PPPPDWFFPGPLRPWGP-PPPWHRNRGP-PPFGPPPPWDRPPPPWRRPPWHRRPPWGLPP 81 Query: 957 PPXPXPPPP 983 PP P P P Sbjct: 82 PPPPPEPEP 90 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXPPPPPXPXPXPXPPX--PXPPPPXXPPPXPXPP 780 P PP P P PP P PPP P PP P PPPP P P P Sbjct: 37 PWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPPWGLPPPPPPPEPEPQQDQP 95 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 814 PPXXXXPPXPP-PXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P P P PP P P PP PP P PP PP Sbjct: 18 PDFFERPPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRPPWHRRPP 76 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP P P P P PP P PPP PPPP Sbjct: 18 PDFFERPPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGP--PPPWDRPPPP 65 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 8/61 (13%) Frame = +2 Query: 668 PXXXXXXPPPP--------PXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PPP P P P PPP PPP PP P P P P Sbjct: 18 PDFFERPPPPDWFFPGPLRPWGPPPPWHRNRGPPPFGPPPPWDRPPPPWRRP--PWHRRP 75 Query: 824 P 826 P Sbjct: 76 P 76 >AF039052-9|AAF98625.1| 302|Caenorhabditis elegans Hypothetical protein T22D1.2 protein. Length = 302 Score = 60.1 bits (139), Expect = 2e-09 Identities = 34/111 (30%), Positives = 34/111 (30%), Gaps = 4/111 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXP----PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 PPP PPPPP P PPPP P PPP P Sbjct: 97 PPPPKGTGTPPPPPTGEPQDLSGEGNASRRPPPPPKGTGSPPPPPTGEPQDLSGEGNASR 156 Query: 829 XPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP P P PP PPP P P Sbjct: 157 RPPPPPKGTGSPPPPPTGEPQDLSTEGNASRRPPPPPKGTGTPPPPPTGEP 207 Score = 59.7 bits (138), Expect = 3e-09 Identities = 34/112 (30%), Positives = 34/112 (30%), Gaps = 5/112 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPX-----PPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 PPP PPPPP P PPPP P PPP P Sbjct: 65 PPPPKGTGTPPPPPTGEPQDLSAEEGNASRRPPPPPKGTGTPPPPPTGEPQDLSGEGNAS 124 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP P P PP PPP P P Sbjct: 125 RRPPPPPKGTGSPPPPPTGEPQDLSGEGNASRRPPPPPKGTGSPPPPPTGEP 176 Score = 58.4 bits (135), Expect = 7e-09 Identities = 35/112 (31%), Positives = 35/112 (31%), Gaps = 5/112 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXP----PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 PPP PPPPP P PPPP P PPP P Sbjct: 34 PPPPKGTGTPPPPPTGEPQDLSGEGNASRRPPPPPKGTGTPPPPPTGEPQDLSAEEGNAS 93 Query: 829 XPPXPPPXPPPXPPPXP-XPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PPP PPP P P P PP PPP P P Sbjct: 94 RRPPPPPKGTGTPPPPPTGEPQDLSGEGNASRRPPPPPKGTGSPPPPPTGEP 145 Score = 58.0 bits (134), Expect = 1e-08 Identities = 35/111 (31%), Positives = 35/111 (31%), Gaps = 4/111 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPX----PPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 PPP PPPPP P PPPP P PPP P Sbjct: 190 PPPPKGTGTPPPPPTGEPQDLSAEGYASRRPPPPPKGTGSPTPPPTGEPQDLSGEGNASR 249 Query: 829 XPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PPP PPP P P PPP PP P P Sbjct: 250 RPP-PPPKGTGSPPPPPTGEPQDLSGEGNASRRPPPPPKGTGTPPPPTGEP 299 Score = 57.6 bits (133), Expect = 1e-08 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 5/112 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPX----PPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 PPP PPPPP P PPPP P PPP P Sbjct: 159 PPPPKGTGSPPPPPTGEPQDLSTEGNASRRPPPPPKGTGTPPPPPTGEPQDLSAEGYASR 218 Query: 829 XPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP P PPP P PP PP PPP P P Sbjct: 219 RPPPPPKGTGSPTPPPTGEPQDLSGEGNASRRPP-PPPKGTGSPPPPPTGEP 269 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/111 (29%), Positives = 33/111 (29%), Gaps = 4/111 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXP----PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 PPP PPPPP P PPPP P PPP P Sbjct: 128 PPPPKGTGSPPPPPTGEPQDLSGEGNASRRPPPPPKGTGSPPPPPTGEPQDLSTEGNASR 187 Query: 829 XPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP P P PP P P P P Sbjct: 188 RPPPPPKGTGTPPPPPTGEPQDLSAEGYASRRPPPPPKGTGSPTPPPTGEP 238 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXX 915 PPPP P PPP P PP PP P PPP P Sbjct: 33 PPPPPKGTGTPPPPPTGEPQDLSGEGNASRRPPPPPKGTGTPPPPPTGEPQDLSAEEGNA 92 Query: 916 PXPPXXPPPXPXXPPPXPXXPP 981 P PP PPP P P Sbjct: 93 SRRPPPPPKGTGTPPPPPTGEP 114 >Z68106-4|CAA92128.1| 112|Caenorhabditis elegans Hypothetical protein F41E7.5 protein. Length = 112 Score = 59.7 bits (138), Expect = 3e-09 Identities = 33/69 (47%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG-XGXGGXGX 714 GGG G GGG G GG GG G GG G GG G GG GG G GG G Sbjct: 32 GGGGGFGGGPGQFGRGGFGGGPGSNYG-PGRGGFGGNGGFGGNGGFGGGPSYGGRGGFGG 90 Query: 713 GXGXGGGGG 687 G G GG GG Sbjct: 91 GPGFGGRGG 99 Score = 55.2 bits (127), Expect = 7e-08 Identities = 33/70 (47%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = -3 Query: 866 GXGGGXGGGXG--GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G GGG GGG G G GGG G G GG G GG G GG G GG G G G Sbjct: 32 GGGGGFGGGPGQFGRGGFGGGPGSNYG-PGRGGFGGNGGFGGNGGFG-GGPSYGGRGGFG 89 Query: 692 GGXXXXGXGG 663 GG G GG Sbjct: 90 GGPGFGGRGG 99 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/65 (46%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G GGG GG G G GG G G G GG G GG GG GGG G GGG Sbjct: 32 GGGGGFGGGPGQFGRGGFGGGPGSNYGPGRGGFGGNGGFGGNGGFGGGPSYGGRGGFGGG 91 Query: 773 XGXGG 759 G GG Sbjct: 92 PGFGG 96 Score = 52.8 bits (121), Expect = 4e-07 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GG G G GGG G G GG G G GG GG GG G G G Sbjct: 32 GGGGGFGGGPGQFGRGGFGGGPGSNYGPGRGGFGGNGGFGGNGGFGGGPSYGGRGGFGGG 91 Query: 638 XXGGXXGG 615 G GG Sbjct: 92 PGFGGRGG 99 Score = 52.4 bits (120), Expect = 5e-07 Identities = 32/69 (46%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG----GGXGXXGGXGGGXGXXGGGXXXX 818 GGGGG G G G G GG G G G G GG GG G GG GGG GG Sbjct: 32 GGGGGFGGGPGQFGR-GGFGGGPGSNYGPGRGGFGGNGGFGGNGGFGGGPS-YGGRGGFG 89 Query: 817 GXXGXGGXG 791 G G GG G Sbjct: 90 GGPGFGGRG 98 Score = 49.6 bits (113), Expect = 3e-06 Identities = 33/76 (43%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXX 804 GG G GGG G G GG G G G G GG GG G GG GG GG Sbjct: 32 GGGGGFGGGPGQFGRGGFGG----GPGSNYGPGRGGFGGNGGFGGNGGFGGGPSYGG--- 84 Query: 803 XXGGXXGGGGXGXGGG 756 GG GG G G GG Sbjct: 85 -RGGFGGGPGFGGRGG 99 Score = 49.6 bits (113), Expect = 3e-06 Identities = 35/78 (44%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGX--GXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 G GGG GG G G GG GG G G G G GG G G GG G G GGG Sbjct: 32 GGGGGFGG----GPGQFGRGGFGGGPGSNYGPGRGGFGGNG-GFGGNG-----GFGGGPS 81 Query: 680 XXGXGGGXGXXGXGXXGG 627 G GG G G G GG Sbjct: 82 YGGRGGFGGGPGFGGRGG 99 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/74 (41%), Positives = 31/74 (41%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GGG GG G GG GG G G GG GG G GG G G GG G Sbjct: 33 GGGGFGGGPGQFGRGG---FGGGPGSNYGPGRGGFGGNGGFGGNGGFGGGPSYGGRG--- 86 Query: 680 XXGXGGGXGXXGXG 639 G GGG G G G Sbjct: 87 --GFGGGPGFGGRG 98 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG-GXGXXGG 863 G GG G GG GG G G GG GGG G G GG Sbjct: 63 GFGGNGGFGGN-----GGFGGGPSYGGRGGFGGGPGFGGRGG 99 >AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical protein Y53C10A.10 protein. Length = 1582 Score = 59.3 bits (137), Expect = 4e-09 Identities = 34/108 (31%), Positives = 34/108 (31%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P P P P P P P P P P P P Sbjct: 928 PIPVPNPI---PKPNPGPGPGPPSPNGPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNG 984 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P Sbjct: 985 PSDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGP 1032 Score = 56.4 bits (130), Expect = 3e-08 Identities = 35/116 (30%), Positives = 35/116 (30%), Gaps = 2/116 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P Sbjct: 936 PKPNPGPGPGPPSPNGPSDPNKPSPNGPSPNGPN-GPSDPNKPGPSGPNGPSDPNKPSPN 994 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P P P P P Sbjct: 995 GPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGP 1050 Score = 55.6 bits (128), Expect = 5e-08 Identities = 37/122 (30%), Positives = 37/122 (30%), Gaps = 2/122 (1%) Frame = +1 Query: 619 PXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P P P Sbjct: 927 PPIPVPNPIPKPNPGPGPGPPSPNGPSDPN-KPSPNGPSPNGPNGPSDPNKPGPSGPNGP 985 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 P P P P P P P P P P P P P P P P Sbjct: 986 SDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPN 1045 Query: 973 XP 978 P Sbjct: 1046 GP 1047 Score = 55.2 bits (127), Expect = 7e-08 Identities = 38/126 (30%), Positives = 38/126 (30%), Gaps = 5/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP--PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPP 783 P P P P P P P P P P P P P P P P P P P Sbjct: 1029 PNGPTPNWPSPNGPSPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNG 1088 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P P Sbjct: 1089 PNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGP 1148 Query: 961 PXPXXP 978 P P Sbjct: 1149 SDPNKP 1154 Score = 54.4 bits (125), Expect = 1e-07 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP-PPXPXXXXP--PPPPXPXPXPXPPXPXPPPPXXP--PPXPXPP 780 P P P P P P P P P P P P P P P P P P P P Sbjct: 1014 PNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGPNGPNGPSDPNKPGPN 1073 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P P P P P Sbjct: 1074 GPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNE 1133 Query: 958 PPXPXXP 978 P P P Sbjct: 1134 PSDPNKP 1140 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/128 (30%), Positives = 39/128 (30%), Gaps = 7/128 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPP-- 780 P P P P P P P P P P P P P P P P P P P P Sbjct: 999 PVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGP 1058 Query: 781 -PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXX 954 P P P P P P P P P P P P P P P P Sbjct: 1059 NGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPN 1118 Query: 955 PPPXPXXP 978 P P P Sbjct: 1119 GPSDPNKP 1126 Score = 52.4 bits (120), Expect = 5e-07 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1249 PNKPGPNGPNEPSDPNRPGPNGPNGPLD-PNKPGPNGPNGPSDPNKPGPNGPNGPSDPNK 1307 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1308 PGPNGPNEPSDPNKPGPNGPNGPSDP--NKPGPNGPNGPSDPNKPGPNGPNEPSDPNKP 1364 Score = 52.0 bits (119), Expect = 6e-07 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 9/125 (7%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPX------PXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P Sbjct: 974 PNKPGPSGPNGPSDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPT 1033 Query: 793 P--PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P P P P P P Sbjct: 1034 PNWPSPNGPSPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPS 1093 Query: 964 XPXXP 978 P P Sbjct: 1094 DPNKP 1098 Score = 51.6 bits (118), Expect = 8e-07 Identities = 39/131 (29%), Positives = 39/131 (29%), Gaps = 15/131 (11%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPPPXXP 795 P P P P P P P PP P P P P P P P P P P P P Sbjct: 927 PPIPVPN-PIPKPNPGPGPGPPSPNGPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNGP 985 Query: 796 PXXXXPPPXXXX------PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP----PXXPPPX 945 P P P P P P P P P P P P P P P Sbjct: 986 SDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPN 1045 Query: 946 PXXPPPXPXXP 978 P P P Sbjct: 1046 GPNGPSDPNKP 1056 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1053 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNKPGPNGPNGPSDPNKPGPNGPNEPSDPNK 1111 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1112 PGPNGPNGPSDPNKPGPNGPNEPSDP--NKPGPNGPNGPSDPNKPGPNGPNGPSDPNKP 1168 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1235 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNRPGPNGPNGPLDPNKPGPNGPNGPSDPNK 1293 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1294 PGPNGPNGPSDPNKPGPNGPNEPSDP--NKPGPNGPNGPSDPNKPGPNGPNGPSDPNKP 1350 Score = 50.4 bits (115), Expect = 2e-06 Identities = 40/133 (30%), Positives = 40/133 (30%), Gaps = 12/133 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX----PXPX-PPXPXPPPPXXPPPX---P 771 P P P P P P P P P P P P P P P P P P P Sbjct: 955 PNKPSPNGPSPNGPNGPSDPNKPGPSGPNGPSDPNKPSPNGPSDPVKPSPSGPSPNGPSP 1014 Query: 772 XPPPPXXP----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P P P P P Sbjct: 1015 NGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGP---NGPNGPSDPNKPG 1071 Query: 940 PXPXXPPPXPXXP 978 P P P P Sbjct: 1072 PNGPNEPSDPNKP 1084 Score = 50.0 bits (114), Expect = 3e-06 Identities = 34/119 (28%), Positives = 34/119 (28%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P P Sbjct: 1078 PSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDP 1137 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P P Sbjct: 1138 NKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNESSDPNKPGPNGPNEPSDPNKP 1196 Score = 49.2 bits (112), Expect = 4e-06 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P Sbjct: 1179 PNKPGPNGPNEPSDPNKPGPNGPNGPSD-PNKPGPNGPNEPSDPNKPGPNGSNGPSDPNK 1237 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1238 PGPNGPNGPSDPNKPGPNGPNEPSDP--NRPGPNGPNGPLDPNKPGPNGPNGPSDPNKP 1294 Score = 48.8 bits (111), Expect = 6e-06 Identities = 40/131 (30%), Positives = 40/131 (30%), Gaps = 11/131 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXPPXPX-PPPPXXPPP-XPXPP 780 P P P P P P P P P P P P P P P P P P P Sbjct: 940 PGPGPGPPSPNGPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNGPSDPNKPSPNGPSDP 999 Query: 781 --PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPX 951 P P P P P P P P P P P P P P P P P Sbjct: 1000 VKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGPN 1059 Query: 952 XP--PPXPXXP 978 P P P P Sbjct: 1060 GPNGPSDPNKP 1070 Score = 48.8 bits (111), Expect = 6e-06 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1109 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNKPGPNGPNGPSDPNKPGPNGPNGPSDPNK 1167 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P Sbjct: 1168 PGPNGPNESSDPNKPGPNGPNEPSDP--NKPGPNGPNGPSDPNKPGPNGPNEPSDPNKP 1224 Score = 48.8 bits (111), Expect = 6e-06 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P Sbjct: 1193 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNKPGPNGSNGPSDPNKPGPNGPNGPSDPNK 1251 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1252 PGPNGPNEPSDPNRPGPNGPNGPLDP--NKPGPNGPNGPSDPNKPGPNGPNGPSDPNKP 1308 Score = 48.8 bits (111), Expect = 6e-06 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPP 783 P P P P P P P P P P P P P P P P P Sbjct: 1198 PNGPNGPSDPNKPGPN-GPNEPSDPNKPGPNGSNGPSDPNKPGPNGPNGPSDPNKPGPNG 1256 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P P Sbjct: 1257 PNEPSDPNRPGPNGPNGPLDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEP 1316 Query: 961 PXPXXP 978 P P Sbjct: 1317 SDPNKP 1322 Score = 48.4 bits (110), Expect = 8e-06 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P Sbjct: 1221 PNKPGPNGSNGPSDPNKPGPNGPNGPSD-PNKPGPNGPNEPSDPNRPGPNGPNGPLDPNK 1279 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1280 PGPNGPNGPSDPNKPGPNGPNGPSDP--NKPGPNGPNEPSDPNKPGPNGPNGPSDPNKP 1336 Score = 48.4 bits (110), Expect = 8e-06 Identities = 32/117 (27%), Positives = 32/117 (27%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1305 PNKPGPNGPNEPSDPNKPGPNGPNGPSD-PNKPGPNGPNGPSDPNKPGPNGPNEPSDPNK 1363 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P P P Sbjct: 1364 PGPNGPNGSSDPNKPGPNGPSNPSVPESSTGGGPSPGPSPNEPSNPSILGPSTGGDP 1420 Score = 48.0 bits (109), Expect = 1e-05 Identities = 36/119 (30%), Positives = 36/119 (30%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P Sbjct: 1165 PNKPGPNGPNESSDPNKPGPNGPNEPSD-PNKPGPNGPNGPSDPNKPGPNGPNEPSDPNK 1223 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXXP 978 P P P P P P P P P P P P P P P P P P P Sbjct: 1224 PGPNGSNGPSDPNKPGPNGPNGPSDP--NKPGPNGPNEPSDPNRPGPNGPNGPLDPNKP 1280 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 5/121 (4%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P P Sbjct: 1148 PSDPNKPGPNGPNGPSDPNKPGPNGPNESSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDP 1207 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP--PPXPXX 975 P P P P P P P P P P P P P P P P P Sbjct: 1208 NKPGPNGPNEPSDPNKPGPNGSNGPSDP--NKPGPNGPNGPSDPNKPGPNGPNEPSDPNR 1265 Query: 976 P 978 P Sbjct: 1266 P 1266 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 3/116 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P P Sbjct: 1274 PLDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDP 1333 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P Sbjct: 1334 NKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGSSDPNKPGPNGPSNPSVP 1389 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 3/119 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP--PPPXXPPPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P Sbjct: 1134 PSDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNESSDPNKPGPNGPNEPSDP 1193 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P P Sbjct: 1194 NKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGSNGPSDPNKPGPNGPNGPSDPNKP 1252 Score = 46.0 bits (104), Expect = 4e-05 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPP 783 P P P P P P P P P P P P P P P P P Sbjct: 1058 PNGPNGPSDPNKPGPN-GPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNG 1116 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P Sbjct: 1117 PNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNES 1176 Query: 961 PXPXXP 978 P P Sbjct: 1177 SDPNKP 1182 Score = 46.0 bits (104), Expect = 4e-05 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P Sbjct: 1114 PNGPNGPSDPNKPGPN-GPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNG 1172 Query: 793 P---PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P Sbjct: 1173 PNESSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGSNGP 1232 Query: 961 PXPXXP 978 P P Sbjct: 1233 SDPNKP 1238 Score = 45.2 bits (102), Expect = 7e-05 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPP 783 P P P P P P P P P P P P P P P P P Sbjct: 1086 PNGPNGPSDPNKPGPN-GPNEPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNG 1144 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P Sbjct: 1145 PNGPSDPNKPGPNGPNGPSDPNKPGPNGPNESSDPNKPGPNGPNEPSDPNKPGPNGPNGP 1204 Query: 961 PXPXXP 978 P P Sbjct: 1205 SDPNKP 1210 Score = 45.2 bits (102), Expect = 7e-05 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPP 783 P P P P P P P P P P P P P P P P P Sbjct: 1254 PNGPNEPSDPNRPGPN-GPNGPLDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNG 1312 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P Sbjct: 1313 PNEPSDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGS 1372 Query: 961 PXPXXP 978 P P Sbjct: 1373 SDPNKP 1378 Score = 44.8 bits (101), Expect = 1e-04 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 4/124 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P Sbjct: 1310 PNGPNEPSDPNKPGPN-GPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNG 1368 Query: 793 PPXXXXP-PPXXXXPPXPP-PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P P Sbjct: 1369 PNGSSDPNKPGPNGPSNPSVPESSTGGGPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNE 1428 Query: 967 PXXP 978 P P Sbjct: 1429 PSNP 1432 Score = 43.6 bits (98), Expect = 2e-04 Identities = 35/119 (29%), Positives = 35/119 (29%), Gaps = 8/119 (6%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1081 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNKPGPNGPNGPSDPNKPGPNGPNEPSDPNK 1139 Query: 811 PPPXXXXPPXPPPXPPPX------PPPXPXP-PPXXXXXPXXPXP-PXXPPPXPXXPPP 963 P P P P P P P P P P P P P P P P P Sbjct: 1140 PGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNESSDPNKPGPNGPNEPSDPNKPGP 1198 Score = 41.5 bits (93), Expect = 9e-04 Identities = 32/120 (26%), Positives = 32/120 (26%), Gaps = 4/120 (3%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P Sbjct: 1294 PGPNGPNGPSDPNKPGPNGPNEP----SDPNKPGPNGPNGPSDPNKPGPNGPNGPSDPNK 1349 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P P P Sbjct: 1350 PGPNGPNEPSDPNKPGPNGPNGSSDPNKPGPNGPSNPSVPESSTGGGPSPGPSPNEPSNP 1409 Score = 41.1 bits (92), Expect = 0.001 Identities = 33/120 (27%), Positives = 33/120 (27%), Gaps = 4/120 (3%) Frame = +3 Query: 636 PPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXX 815 PP P P P PP P P P P P P Sbjct: 927 PPIPVPNPIPKPNPGPGPGPPSPNG--PSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNG 984 Query: 816 PXXXXPP-PXXPXPPPXP-PXXPXP--PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P P P P P P P P P Sbjct: 985 PSDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSP 1044 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/126 (26%), Positives = 34/126 (26%), Gaps = 9/126 (7%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P P Sbjct: 1352 PNGPNEPSDPNKPGPN-GPNGSSDPNKPGPNGPSNPSVPESSTGGGPSPGPSPNEPSN-P 1409 Query: 799 XXXXPPPXXXXPPXPPPXPPPXP---------PPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P P P P P P P P P P P P P Sbjct: 1410 SILGPSTGGDPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNGPSNPSVPESSTGGGPSP- 1468 Query: 952 XPPPXP 969 P P P Sbjct: 1469 GPAPDP 1474 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 5/72 (6%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP----XPXPXPPXX 944 P P P P P P P P P P P P P P P P P P P Sbjct: 1004 PSGPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGPNGPNG 1063 Query: 945 PXXP-PPXPXPP 977 P P P P P Sbjct: 1064 PSDPNKPGPNGP 1075 Score = 39.9 bits (89), Expect = 0.003 Identities = 35/129 (27%), Positives = 35/129 (27%), Gaps = 13/129 (10%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P P P P P Sbjct: 1333 PNKPGPNGPNGPSDPNKPGPNGPNEPSD-PNKPGPNGPNGSSDPNKPGPNGPSNPSV--- 1388 Query: 811 PPPXXXXPPXPPPXPPPXPP-------------PXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P P P P P P P P P P P P P Sbjct: 1389 --PESSTGGGPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNEPSNPSILGPSTGGDPSPG 1446 Query: 952 XPPPXPXXP 978 P P P Sbjct: 1447 PSPNGPSNP 1455 Score = 37.9 bits (84), Expect = 0.011 Identities = 31/116 (26%), Positives = 31/116 (26%), Gaps = 3/116 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXX---PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 P P P P P P P P P P P P P P P P P P Sbjct: 1375 PNKPGPNGPSNPSVPESSTGGGPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNEPSNPSI 1434 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P Sbjct: 1435 LGPSTGGD-----PSPGPSPNGPSNPSVPESSTGG--GPSPGPAPDPGTSDPNKDP 1483 Score = 33.1 bits (72), Expect = 0.31 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 4/102 (3%) Frame = +2 Query: 689 PPPP--PXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXPPXXXXXXXXXXX 859 PP P P P P P P P P P P P P P P Sbjct: 946 PPSPNGPSDPNKPSPNGPSPNGPNGPSDPNKPGPSGPNGPSDPNKPSPNGPSDPVKPSPS 1005 Query: 860 XXXXXXXXPPPXPXXXPXPP-PXPXXPXPPXPXPPXXPPXPP 982 P P P P P P P P P P P Sbjct: 1006 GPSPNGPSPNGPSPNGPSPNGPSPNGPTPNWPSPNGPSPNGP 1047 Score = 31.9 bits (69), Expect = 0.72 Identities = 33/134 (24%), Positives = 33/134 (24%), Gaps = 11/134 (8%) Frame = +3 Query: 615 PXXP-PXXPPXPXXXXXPXPXXXXXXPPP-PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P P P P P P Sbjct: 1319 PNKPGPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGSSDPNKP 1378 Query: 789 XPX-PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX---- 953 P P P P P P P P P P P P P P P Sbjct: 1379 GPNGPSNPSVPESSTGGGPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNEPSNPSILGPS 1438 Query: 954 ----PPPXPXPPPP 983 P P P P P Sbjct: 1439 TGGDPSPGPSPNGP 1452 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 11/78 (14%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXX---PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 P P P P P P P P P P P P P P P P P P Sbjct: 1397 PSPGPSPNEPSNPSILGPSTGGDPSPGPSPNEPSNPSILGPSTGGDPSPGPSPNGPSNPS 1456 Query: 951 XPP--------PXPXPPP 980 P P P P P Sbjct: 1457 VPESSTGGGPSPGPAPDP 1474 Score = 31.5 bits (68), Expect = 0.95 Identities = 33/130 (25%), Positives = 33/130 (25%), Gaps = 9/130 (6%) Frame = +3 Query: 615 PXXP-PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P P P P P P P P P P P P P Sbjct: 974 PNKPGPSGPNGPSDPNKPSPNGPSDPVKPSPSGPSPNGPSPNGPSPNGPSPNGPSPNGPT 1033 Query: 792 P---XP--PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP--XPXPXPPXXPX 950 P P P P P P P P P P P P P P P P Sbjct: 1034 PNWPSPNGPSPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPS 1093 Query: 951 XP-PPXPXPP 977 P P P P Sbjct: 1094 DPNKPGPNGP 1103 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P P P P P P P P Sbjct: 1420 PSPGPSPNEPSNPSILGPSTGGDPSPGPSPNGPSNPS-VPESSTGGGPSPGPAPDPGTSD 1478 Query: 960 PXPXP 974 P P Sbjct: 1479 PNKDP 1483 Score = 29.1 bits (62), Expect = 5.1 Identities = 29/124 (23%), Positives = 29/124 (23%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX- 791 P P P P P P P P P P P Sbjct: 1024 PNGPSPNGPTPNWPSPNGPSPNGPNGPSDPNKPGPNGPNGPSDPNKPGPNGPNEPSDPNK 1083 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P P P P P P P P P P P Sbjct: 1084 PGPNGPNGPSDPNKPGPNGPNEPSDPNKPGPNGPNGPSDPNK-PGPNGPNEPSDP----N 1138 Query: 972 PPPP 983 P P Sbjct: 1139 KPGP 1142 >AC006696-4|AAF39985.1| 215|Caenorhabditis elegans Hypothetical protein W08E12.6 protein. Length = 215 Score = 59.3 bits (137), Expect = 4e-09 Identities = 44/125 (35%), Positives = 44/125 (35%), Gaps = 15/125 (12%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPP------XPXPP-PPXXPPP--XPXPPPPXX 792 P P PPP P PPPPP P PP P P PPP P PPP Sbjct: 41 PPPCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPACVPLAPIIVNGPPPCFGPACPPPCF 100 Query: 793 PPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPP--XPXX 954 P P P P P P PPP P P P P P PPP P Sbjct: 101 GPACAPPAPIIVNGPPPCFGPACPPPCFGPACAPSAPIIVNGPPPCFGPACPPPCFGPAC 160 Query: 955 PPPXP 969 PP P Sbjct: 161 APPPP 165 Score = 56.0 bits (129), Expect = 4e-08 Identities = 44/130 (33%), Positives = 44/130 (33%), Gaps = 12/130 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP----XPPP---PXXPPPXPX 774 PP P P PPP P PPP P P P PPP P PPP Sbjct: 42 PPCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPACVPLAPIIVNGPPPCFGPACPPPCFG 101 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPP-XPPPXPPPXP----XPPPXXXXXPXXPXPPXXPP 939 P P PP P PPP P P P PPP P P P P Sbjct: 102 PACAPPAPIIVNGPPPCFGPACPPPCFGPACAPSAPIIVNGPPP--CFGPACPPPCFGPA 159 Query: 940 PXPXXPPPXP 969 P PPP P Sbjct: 160 CAP--PPPAP 167 Score = 48.4 bits (110), Expect = 8e-06 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 5/127 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PPP P P PP P PPP P Sbjct: 24 PPCFGIGCNQPPIVIAGPPPCFDCPPPAPIFVAPPPPPCFG---PACPPPCFGPACVPLA 80 Query: 796 PXXXXPPPXXXXPPXPPP-XPPPXPPPXP----XPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PP P PPP P PP P PPP P P P P P P Sbjct: 81 PIIVNGPPPCFGPACPPPCFGPACAPPAPIIVNGPPP--CFGPACPPPCFGPACAPSAPI 138 Query: 961 PXPXXPP 981 PP Sbjct: 139 IVNGPPP 145 Score = 46.4 bits (105), Expect = 3e-05 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 2/105 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PP PP P P P P P PP P P PP P P Sbjct: 22 PPPPCFGIGCNQPPIVIAGPPPCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPACVPLAP 81 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP--XPXXPPP 963 PP P P P P P PPP P PPP Sbjct: 82 IIVNGPPPCFGPACPPPCFGPACAPPAPIIVNGPPPCFGPACPPP 126 Score = 41.9 bits (94), Expect = 7e-04 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 11/124 (8%) Frame = +3 Query: 645 PXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX---PXPPXPXX 815 P P P PPPPP P P P P PP Sbjct: 42 PPCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPACVPLAPIIVNGPPPCFGPACPPPCFG 101 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPX----PXPPXXPXXPPPX--P--X 971 P P P PP PPP P P P P P PPP P Sbjct: 102 PACAPPAPIIVNGPPPCFGPACPPPCFGPACAPSAPIIVNGPPPCFGPACPPPCFGPACA 161 Query: 972 PPPP 983 PPPP Sbjct: 162 PPPP 165 Score = 39.1 bits (87), Expect = 0.005 Identities = 33/94 (35%), Positives = 33/94 (35%), Gaps = 13/94 (13%) Frame = +1 Query: 727 PXPXPPPPXX-----PPPXPXPPPPXXPPXXXXPP-PXXXXPPXPPPXPPPXPPP--XPX 882 P PPPP PP PP P PP P PP PP P PPP P Sbjct: 18 PFFLPPPPCFGIGCNQPPIVIAGPP--PCFDCPPPAPIFVAPPPPPCFGPACPPPCFGPA 75 Query: 883 PPPXXXXXPXXPXP---PXXPPP--XPXXPPPXP 969 P P P P PPP P PP P Sbjct: 76 CVPLAPIIVNGPPPCFGPACPPPCFGPACAPPAP 109 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PPPP PP PP PPP P PPP P P P P Sbjct: 18 PFFLPPPPCFGIGCNQPPIVIAGPPPCFDCPPPAPI-FVAPPPPPCFGPACPPPCFGPAC 76 Query: 943 XPXXPPPXPXXPP 981 P P PP Sbjct: 77 VPLAPIIVNGPPP 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP PP P P PPP P P PPP P P P P Sbjct: 41 PPPCFDCPP---------PAPIFVAPPPPPCFGPACPPP----CFGPACVPLAPIIVNGP 87 Query: 957 PP--XPXPPPP 983 PP P PPP Sbjct: 88 PPCFGPACPPP 98 >Z66500-14|CAA91313.2| 1169|Caenorhabditis elegans Hypothetical protein T05C12.10 protein. Length = 1169 Score = 58.8 bits (136), Expect = 5e-09 Identities = 39/115 (33%), Positives = 39/115 (33%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---GGGXXXXGG 792 GG G G G G G G G G G G G G G G G G G Sbjct: 603 GGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGN 662 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GG GG G G G G G G G G G G G G G G Sbjct: 663 GKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNG----GTGDGKDKNGKGSGSG 713 Score = 58.4 bits (135), Expect = 7e-09 Identities = 39/112 (34%), Positives = 39/112 (34%), Gaps = 3/112 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGX 807 GG G G G G G G G G G G G G G G G G G Sbjct: 603 GGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGN 662 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXG 654 G GG G GG G G G G G G GG G G G G G G Sbjct: 663 GKEGDGNKSGGSGKGGAGNGKSGDG-SGDGKNNGNGGTGDGKDKNGKGSGSG 713 Score = 57.6 bits (133), Expect = 1e-08 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 3/123 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXX 804 G G GG G G G G G G G G G G G G G G G G G Sbjct: 524 GPNGKGGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNG 583 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G GG G G G G G G G G G G G G G Sbjct: 584 DGSDKNSGAGAGTKPENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSG 643 Query: 626 XXG 618 G Sbjct: 644 TPG 646 Score = 57.2 bits (132), Expect = 2e-08 Identities = 36/121 (29%), Positives = 36/121 (29%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G GG G GG G G G G G G Sbjct: 643 GTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGS-GKGGAGNGKSGDGSGDGKNNGNGGTGD 701 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G G G G G G G G G G G G Sbjct: 702 GKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSES 761 Query: 617 G 615 G Sbjct: 762 G 762 Score = 56.8 bits (131), Expect = 2e-08 Identities = 39/126 (30%), Positives = 39/126 (30%), Gaps = 6/126 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG---- 810 G G G G G G G G G G G G G G G G G Sbjct: 538 GDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTK 597 Query: 809 -XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGX 636 GG G G G G G G G G G G G G G G G G G G Sbjct: 598 PENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGS 657 Query: 635 XGGXXG 618 G G Sbjct: 658 NGSGNG 663 Score = 54.8 bits (126), Expect = 9e-08 Identities = 39/120 (32%), Positives = 39/120 (32%), Gaps = 6/120 (5%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GG G G G G G G G G G G G G G G Sbjct: 524 GPNGKGGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTG---DGNGTGDGDNNESGN 580 Query: 776 GXGXGGGXXGGGGXG------XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GG G G G G G G G G G G G G G Sbjct: 581 GNGDGSDKNSGAGAGTKPENREGGDGNGNGTGDGNG---DGNDNGNGSKGLGTGSGDGKG 637 Score = 54.8 bits (126), Expect = 9e-08 Identities = 37/118 (31%), Positives = 37/118 (31%), Gaps = 4/118 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXX 804 G G G G G G G G G GG G GG G G G G Sbjct: 635 GKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNN 694 Query: 803 XXGGXXGG---GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G G G G G G G G G G G G G G G G Sbjct: 695 GNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGG 752 Score = 53.6 bits (123), Expect = 2e-07 Identities = 38/123 (30%), Positives = 38/123 (30%), Gaps = 2/123 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G G G GG Sbjct: 618 GNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAG-SNGSGNGKEGDGNKSGGSGK 676 Query: 800 XGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G GG G G G G G G G G G G G Sbjct: 677 GGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNG 736 Query: 626 XXG 618 G Sbjct: 737 NDG 739 Score = 47.6 bits (108), Expect = 1e-05 Identities = 41/136 (30%), Positives = 41/136 (30%), Gaps = 15/136 (11%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXG-------GGXGGGXGGXX 825 G G G G G G G G G G G G G GG G G G Sbjct: 554 GDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTKPENREGGDGNGNGTGD 613 Query: 824 XXGGGXXXXGGXXG---GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG----GXXXXGXG 666 G G G G G G G G G G G G G G G G G Sbjct: 614 GNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGG 673 Query: 665 GGXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 674 SGKGGAGNGKSGDGSG 689 Score = 47.6 bits (108), Expect = 1e-05 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXG-GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G GG G G Sbjct: 624 GSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGK 683 Query: 800 XGGXXGGGGXGXGGGXXGG---GGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G G GG G G G G G G G G G G G G G Sbjct: 684 SGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSG 743 Query: 632 GGXXGG 615 G G Sbjct: 744 SGDGSG 749 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/119 (26%), Positives = 32/119 (26%), Gaps = 1/119 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGG 792 G G G GG G G G G G G G G G G G G Sbjct: 668 GNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGN 727 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G G G G G GG Sbjct: 728 AEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGG 786 Score = 45.6 bits (103), Expect = 5e-05 Identities = 36/124 (29%), Positives = 36/124 (29%), Gaps = 6/124 (4%) Frame = -3 Query: 968 GXGGGXXGX-GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG--GXXXXGGGXXXX 798 G G G G G G G G G G G G G G G G Sbjct: 579 GNGNGDGSDKNSGAGAGTKPENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGE 638 Query: 797 GGXXGGGGXGXG---GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G G G G G GG G G G GG Sbjct: 639 GNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNGG 698 Query: 626 XXGG 615 G Sbjct: 699 TGDG 702 Score = 45.6 bits (103), Expect = 5e-05 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 3/124 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXG-GGXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G G GG G G G G G G G Sbjct: 668 GNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGN 727 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G G G G G G G G G Sbjct: 728 AEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGGA 787 Query: 626 XXGG 615 GG Sbjct: 788 NKGG 791 Score = 41.9 bits (94), Expect = 7e-04 Identities = 32/102 (31%), Positives = 32/102 (31%), Gaps = 5/102 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG GG G G G Sbjct: 403 GDSGDSGNNKNKDNGKGKGKGKNDEEDEEDNGDEDGNGKGGN-GGNPKGEWDDGDGDEDD 461 Query: 797 GGXXGG----GGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGG 687 G GG G G G G G G G G G G G G G Sbjct: 462 DGTDGGSKESGNNGKGKGKGSGDGDGNRNGNGDGNGRPKGDG 503 Score = 41.9 bits (94), Expect = 7e-04 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 3/123 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G G G G G G G G G Sbjct: 672 GGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGN 731 Query: 797 GGXXGGGGXGXGGGXX-GGGGXGXGGXG-XGXGXGGGGGXXXXGXGG-GXGXXGXGXXGG 627 G G G G G G G GG G G G G G GG G GG Sbjct: 732 GKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGGANKGG 791 Query: 626 XXG 618 G Sbjct: 792 SDG 794 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/124 (23%), Positives = 29/124 (23%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G GG G G G G Sbjct: 629 GTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGS 688 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G G G G G Sbjct: 689 GDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGS 748 Query: 625 GXXG 614 G G Sbjct: 749 GAGG 752 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG---XXGGXGGGXGXXGGGXXXXG 815 G G G G G G G G G G G G G G G G G G G G Sbjct: 614 GNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDG-NKSG 672 Query: 814 XXGXGGXGXGXGG 776 G GG G G G Sbjct: 673 GSGKGGAGNGKSG 685 Score = 38.3 bits (85), Expect = 0.008 Identities = 33/129 (25%), Positives = 33/129 (25%), Gaps = 5/129 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG----GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 G G G G G G G G G G G G G G G G G G G Sbjct: 606 GNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKE 665 Query: 817 GXXG-XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G GG G G G G G G G G Sbjct: 666 GDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGK 725 Query: 640 GGXXGGXXG 614 G G G Sbjct: 726 GNAEGNGKG 734 Score = 36.7 bits (81), Expect = 0.025 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 1/107 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G G G G G G G G G G Sbjct: 689 GDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGS 748 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG G G G G G G G GG G G Sbjct: 749 GAGGKGDKSDSESGNEADGKDGKKNEGAG-GEAAAGSGGANKGGSDG 794 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G G G G G G G G G G G G G G Sbjct: 529 GGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDK 588 Query: 805 XGGXGXG 785 G G G Sbjct: 589 NSGAGAG 595 Score = 35.5 bits (78), Expect = 0.058 Identities = 29/110 (26%), Positives = 29/110 (26%), Gaps = 1/110 (0%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G G G G G G G G G G GG GG Sbjct: 314 GGKGGAGADGAAGSGAGAGAGAGTNGNINITVHTDGKSGGNAVAVANANVTVNGAGGVST 373 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG G G G G G G G G Sbjct: 374 TGTGAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKG 423 Score = 35.1 bits (77), Expect = 0.077 Identities = 37/134 (27%), Positives = 37/134 (27%), Gaps = 10/134 (7%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG-GXG-------GGXGXXGGG 830 G G G G G G G G G G G G G G G G GG G G Sbjct: 552 GDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTKPENREGGDGNGNGT 611 Query: 829 XXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXG-XX 656 G G G G G G G G G G G G Sbjct: 612 GDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKS 671 Query: 655 XXXGXGGXXGGXXG 614 G GG G G Sbjct: 672 GGSGKGGAGNGKSG 685 Score = 34.3 bits (75), Expect = 0.14 Identities = 27/121 (22%), Positives = 27/121 (22%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G Sbjct: 377 GAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKGKNDEEDEEDNGDE 436 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GG G G G G G G G G G G G Sbjct: 437 DGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGNRNGNGDGN 496 Query: 620 G 618 G Sbjct: 497 G 497 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G G G G G G G G Sbjct: 550 GDGDGDGNGNGNGLTGDGNGTGDGDNNESG-NGNGDGSDKNSGAGAGTKPENREGGDGNG 608 Query: 805 XG-GXGXGXG 779 G G G G G Sbjct: 609 NGTGDGNGDG 618 Score = 32.7 bits (71), Expect = 0.41 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 19/123 (15%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXG----GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX-- 765 GG G G G GG G GG GG G G G G G Sbjct: 369 GGVSTTGTGAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKGKNDEE 428 Query: 764 ---------GGGXXGGGGXGXG----GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G G G GG G G G G GG G G G G G Sbjct: 429 DEEDNGDEDGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGN 488 Query: 623 XGG 615 G Sbjct: 489 RNG 491 Score = 31.1 bits (67), Expect = 1.3 Identities = 30/125 (24%), Positives = 30/125 (24%), Gaps = 1/125 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG-XGXXGGXGGGXGXXGGGXXXXGXX 809 G G G GG G G G G GG G G G G G G Sbjct: 434 GDEDGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGNRNGNG 493 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 G G G G GG G G G G G Sbjct: 494 DGNGRPKGDGNIKINIHSPDDNDLLEKDENGPNGKGGAGN----GNGDGDKDNNGKGNGT 549 Query: 628 GGXXG 614 G G Sbjct: 550 GDGDG 554 Score = 29.9 bits (64), Expect = 2.9 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 3/102 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG---GXXXXGGGXXXXGGXXGGGGX 771 G G G G G G G G G G G GG Sbjct: 307 GSSEAGAGGKGGAGADGAAGSGAGAGAGAGTNGNINITVHTDGKSGGNAVAVANANVTVN 366 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G G G G G G G GG G G Sbjct: 367 GAGGVSTTGTGAQTGNES-GLG-GSAGTDKAGGKKGGHGDSG 406 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G G G G G G Sbjct: 711 GSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDG 770 Query: 805 XGGXGXG 785 G G Sbjct: 771 KKNEGAG 777 >Z49968-13|CAA90265.2| 1169|Caenorhabditis elegans Hypothetical protein T05C12.10 protein. Length = 1169 Score = 58.8 bits (136), Expect = 5e-09 Identities = 39/115 (33%), Positives = 39/115 (33%), Gaps = 3/115 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---GGGXXXXGG 792 GG G G G G G G G G G G G G G G G G G Sbjct: 603 GGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGN 662 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GG GG G G G G G G G G G G G G G G Sbjct: 663 GKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNG----GTGDGKDKNGKGSGSG 713 Score = 58.4 bits (135), Expect = 7e-09 Identities = 39/112 (34%), Positives = 39/112 (34%), Gaps = 3/112 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGX 807 GG G G G G G G G G G G G G G G G G G Sbjct: 603 GGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGN 662 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXG 654 G GG G GG G G G G G G GG G G G G G G Sbjct: 663 GKEGDGNKSGGSGKGGAGNGKSGDG-SGDGKNNGNGGTGDGKDKNGKGSGSG 713 Score = 57.6 bits (133), Expect = 1e-08 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 3/123 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXX 804 G G GG G G G G G G G G G G G G G G G G G Sbjct: 524 GPNGKGGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNG 583 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G GG G G G G G G G G G G G G G Sbjct: 584 DGSDKNSGAGAGTKPENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSG 643 Query: 626 XXG 618 G Sbjct: 644 TPG 646 Score = 57.2 bits (132), Expect = 2e-08 Identities = 36/121 (29%), Positives = 36/121 (29%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G GG G GG G G G G G G Sbjct: 643 GTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGS-GKGGAGNGKSGDGSGDGKNNGNGGTGD 701 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G G G G G G G G G G G G Sbjct: 702 GKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSES 761 Query: 617 G 615 G Sbjct: 762 G 762 Score = 56.8 bits (131), Expect = 2e-08 Identities = 39/126 (30%), Positives = 39/126 (30%), Gaps = 6/126 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG---- 810 G G G G G G G G G G G G G G G G G Sbjct: 538 GDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTK 597 Query: 809 -XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGX 636 GG G G G G G G G G G G G G G G G G G G Sbjct: 598 PENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGS 657 Query: 635 XGGXXG 618 G G Sbjct: 658 NGSGNG 663 Score = 54.8 bits (126), Expect = 9e-08 Identities = 39/120 (32%), Positives = 39/120 (32%), Gaps = 6/120 (5%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G GG G G G G G G G G G G G G G G Sbjct: 524 GPNGKGGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTG---DGNGTGDGDNNESGN 580 Query: 776 GXGXGGGXXGGGGXG------XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GG G G G G G G G G G G G G G Sbjct: 581 GNGDGSDKNSGAGAGTKPENREGGDGNGNGTGDGNG---DGNDNGNGSKGLGTGSGDGKG 637 Score = 54.8 bits (126), Expect = 9e-08 Identities = 37/118 (31%), Positives = 37/118 (31%), Gaps = 4/118 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXX 804 G G G G G G G G G GG G GG G G G G Sbjct: 635 GKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNN 694 Query: 803 XXGGXXGG---GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G G G G G G G G G G G G G G G G Sbjct: 695 GNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGG 752 Score = 53.6 bits (123), Expect = 2e-07 Identities = 38/123 (30%), Positives = 38/123 (30%), Gaps = 2/123 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G G G GG Sbjct: 618 GNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAG-SNGSGNGKEGDGNKSGGSGK 676 Query: 800 XGGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG-XXGXGXXGG 627 G G G G G G G GG G G G G G G G G G G G Sbjct: 677 GGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNG 736 Query: 626 XXG 618 G Sbjct: 737 NDG 739 Score = 47.6 bits (108), Expect = 1e-05 Identities = 41/136 (30%), Positives = 41/136 (30%), Gaps = 15/136 (11%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX-GXXXXXGGGXGXGGGXG-------GGXGGGXGGXX 825 G G G G G G G G G G G G G GG G G G Sbjct: 554 GDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTKPENREGGDGNGNGTGD 613 Query: 824 XXGGGXXXXGGXXG---GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG----GXXXXGXG 666 G G G G G G G G G G G G G G G G G Sbjct: 614 GNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGG 673 Query: 665 GGXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 674 SGKGGAGNGKSGDGSG 689 Score = 47.6 bits (108), Expect = 1e-05 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 5/126 (3%) Frame = -3 Query: 977 GXXGXG-GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G G GG G G Sbjct: 624 GSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGK 683 Query: 800 XGGXXGGGGXGXGGGXXGG---GGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G G GG G G G G G G G G G G G G G Sbjct: 684 SGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSG 743 Query: 632 GGXXGG 615 G G Sbjct: 744 SGDGSG 749 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/119 (26%), Positives = 32/119 (26%), Gaps = 1/119 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGG 792 G G G GG G G G G G G G G G G G G Sbjct: 668 GNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGN 727 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G G G G G G GG Sbjct: 728 AEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGG 786 Score = 45.6 bits (103), Expect = 5e-05 Identities = 36/124 (29%), Positives = 36/124 (29%), Gaps = 6/124 (4%) Frame = -3 Query: 968 GXGGGXXGX-GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG--GXXXXGGGXXXX 798 G G G G G G G G G G G G G G G G Sbjct: 579 GNGNGDGSDKNSGAGAGTKPENREGGDGNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGE 638 Query: 797 GGXXGGGGXGXG---GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G G G G G GG G G G GG Sbjct: 639 GNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNGG 698 Query: 626 XXGG 615 G Sbjct: 699 TGDG 702 Score = 45.6 bits (103), Expect = 5e-05 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 3/124 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXG-GGXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G G GG G G G G G G G Sbjct: 668 GNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGN 727 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGGGXGXXGXGXXGG 627 G G G G G G G G G G G G G G G G Sbjct: 728 AEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGGA 787 Query: 626 XXGG 615 GG Sbjct: 788 NKGG 791 Score = 41.9 bits (94), Expect = 7e-04 Identities = 32/102 (31%), Positives = 32/102 (31%), Gaps = 5/102 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G G G G GG GG G G G Sbjct: 403 GDSGDSGNNKNKDNGKGKGKGKNDEEDEEDNGDEDGNGKGGN-GGNPKGEWDDGDGDEDD 461 Query: 797 GGXXGG----GGXGXGGGXXGGGGXG-XGGXGXGXGXGGGGG 687 G GG G G G G G G G G G G G G G Sbjct: 462 DGTDGGSKESGNNGKGKGKGSGDGDGNRNGNGDGNGRPKGDG 503 Score = 41.9 bits (94), Expect = 7e-04 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 3/123 (2%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G G G G G G G G G Sbjct: 672 GGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGN 731 Query: 797 GGXXGGGGXGXGGGXX-GGGGXGXGGXG-XGXGXGGGGGXXXXGXGG-GXGXXGXGXXGG 627 G G G G G G G GG G G G G G GG G GG Sbjct: 732 GKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDGKKNEGAGGEAAAGSGGANKGG 791 Query: 626 XXG 618 G Sbjct: 792 SDG 794 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/124 (23%), Positives = 29/124 (23%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G GG G G G G Sbjct: 629 GTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKSGGSGKGGAGNGKSGDGS 688 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G G G G G Sbjct: 689 GDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGS 748 Query: 625 GXXG 614 G G Sbjct: 749 GAGG 752 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG---XXGGXGGGXGXXGGGXXXXG 815 G G G G G G G G G G G G G G G G G G G G Sbjct: 614 GNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDG-NKSG 672 Query: 814 XXGXGGXGXGXGG 776 G GG G G G Sbjct: 673 GSGKGGAGNGKSG 685 Score = 38.3 bits (85), Expect = 0.008 Identities = 33/129 (25%), Positives = 33/129 (25%), Gaps = 5/129 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG----GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 G G G G G G G G G G G G G G G G G G G Sbjct: 606 GNGNGTGDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKE 665 Query: 817 GXXG-XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGX 641 G GG G G G G G G G G Sbjct: 666 GDGNKSGGSGKGGAGNGKSGDGSGDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGK 725 Query: 640 GGXXGGXXG 614 G G G Sbjct: 726 GNAEGNGKG 734 Score = 36.7 bits (81), Expect = 0.025 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 1/107 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G G G G G G G G G G G G G G G G Sbjct: 689 GDGKNNGNGGTGDGKDKNGKGSGSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGS 748 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG G G G G G G G GG G G Sbjct: 749 GAGGKGDKSDSESGNEADGKDGKKNEGAG-GEAAAGSGGANKGGSDG 794 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G G G G G G G G G G G G G G Sbjct: 529 GGAGNGNGDGDKDNNGKGNGTGDGDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDK 588 Query: 805 XGGXGXG 785 G G G Sbjct: 589 NSGAGAG 595 Score = 35.5 bits (78), Expect = 0.058 Identities = 29/110 (26%), Positives = 29/110 (26%), Gaps = 1/110 (0%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G G G G G G G G G G GG GG Sbjct: 314 GGKGGAGADGAAGSGAGAGAGAGTNGNINITVHTDGKSGGNAVAVANANVTVNGAGGVST 373 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG G G G G G G G G Sbjct: 374 TGTGAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKG 423 Score = 35.1 bits (77), Expect = 0.077 Identities = 37/134 (27%), Positives = 37/134 (27%), Gaps = 10/134 (7%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG-GXG-------GGXGXXGGG 830 G G G G G G G G G G G G G G G G GG G G Sbjct: 552 GDGDGNGNGNGLTGDGNGTGDGDNNESGNGNGDGSDKNSGAGAGTKPENREGGDGNGNGT 611 Query: 829 XXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXG-GGGGXXXXXXGXG-XX 656 G G G G G G G G G G G G Sbjct: 612 GDGNGDGNDNGNGSKGLGTGSGDGKGEGNKSGTPGKSDGKEDGAGSNGSGNGKEGDGNKS 671 Query: 655 XXXGXGGXXGGXXG 614 G GG G G Sbjct: 672 GGSGKGGAGNGKSG 685 Score = 34.3 bits (75), Expect = 0.14 Identities = 27/121 (22%), Positives = 27/121 (22%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G G G G G G G G G Sbjct: 377 GAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKGKNDEEDEEDNGDE 436 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GG G G G G G G G G G G G Sbjct: 437 DGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGNRNGNGDGN 496 Query: 620 G 618 G Sbjct: 497 G 497 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G G G G G G G G Sbjct: 550 GDGDGDGNGNGNGLTGDGNGTGDGDNNESG-NGNGDGSDKNSGAGAGTKPENREGGDGNG 608 Query: 805 XG-GXGXGXG 779 G G G G G Sbjct: 609 NGTGDGNGDG 618 Score = 32.7 bits (71), Expect = 0.41 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 19/123 (15%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXG----GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGX-- 765 GG G G G GG G GG GG G G G G G Sbjct: 369 GGVSTTGTGAQTGNESGLGGSAGTDKAGGKKGGHGDSGDSGNNKNKDNGKGKGKGKNDEE 428 Query: 764 ---------GGGXXGGGGXGXG----GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGX 624 G G G GG G G G G GG G G G G G Sbjct: 429 DEEDNGDEDGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGN 488 Query: 623 XGG 615 G Sbjct: 489 RNG 491 Score = 31.1 bits (67), Expect = 1.3 Identities = 30/125 (24%), Positives = 30/125 (24%), Gaps = 1/125 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG-XGXXGGXGGGXGXXGGGXXXXGXX 809 G G G GG G G G G GG G G G G G G Sbjct: 434 GDEDGNGKGGNGGNPKGEWDDGDGDEDDDGTDGGSKESGNNGKGKGKGSGDGDGNRNGNG 493 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXX 629 G G G G GG G G G G G Sbjct: 494 DGNGRPKGDGNIKINIHSPDDNDLLEKDENGPNGKGGAGN----GNGDGDKDNNGKGNGT 549 Query: 628 GGXXG 614 G G Sbjct: 550 GDGDG 554 Score = 29.9 bits (64), Expect = 2.9 Identities = 28/102 (27%), Positives = 28/102 (27%), Gaps = 3/102 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG---GXXXXGGGXXXXGGXXGGGGX 771 G G G G G G G G G G G GG Sbjct: 307 GSSEAGAGGKGGAGADGAAGSGAGAGAGAGTNGNINITVHTDGKSGGNAVAVANANVTVN 366 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G G G G G G G GG G G Sbjct: 367 GAGGVSTTGTGAQTGNES-GLG-GSAGTDKAGGKKGGHGDSG 406 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G G G G G G G G G G G G G G G Sbjct: 711 GSGDNDKSGTRAAGKGNAEGNGKGNGNDGKGSGSGDGSGAGGKGDKSDSESGNEADGKDG 770 Query: 805 XGGXGXG 785 G G Sbjct: 771 KKNEGAG 777 >AF125462-1|AAD12858.2| 244|Caenorhabditis elegans Hypothetical protein Y66H1A.4 protein. Length = 244 Score = 58.8 bits (136), Expect = 5e-09 Identities = 38/92 (41%), Positives = 38/92 (41%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G GG GG GG G GG GG GGG G GG GG G G GG G Sbjct: 150 GGGRGRGGRGRGGDRGGRGSDR---GGR---GGFGRGGGGGFRGGDRGGFGGGRGGFRGG 203 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG G G G GG GG Sbjct: 204 DRGGFRGGRGGDFGGRGRGDFKRSYDGGSFGG 235 Score = 54.4 bits (125), Expect = 1e-07 Identities = 36/90 (40%), Positives = 36/90 (40%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 GGG G G G G G GG G GGG GG GG GG GGG G Sbjct: 150 GGGRGRGGRGRGGDRGGRGSDRGGRGGFGRGGG-GGFRGGDRGGF---GGGRGGFRGGDR 205 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G GG GG G G G GG Sbjct: 206 GGFRGGRGGDFGGRGRGDFKRSYDGGSFGG 235 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 GG G GGG GG GGG GG G G GG GG G G GGG GG G Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRG-GFGGGGRGGYDQG 55 Score = 52.4 bits (120), Expect = 5e-07 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 3/86 (3%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG--XXXXGGG 810 GG G GG G G GG G G GGG G GG GG GGG GG GG Sbjct: 150 GGGRGRGGRGRGGDRGGRGSDRGGRGGFGRGGGG-GFRGGDRGGFGGGRGGFRGGDRGGF 208 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXG 732 GG GG G G GG G Sbjct: 209 RGGRGGDFGGRGRGDFKRSYDGGSFG 234 Score = 50.0 bits (114), Expect = 3e-06 Identities = 31/72 (43%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG---XGXXGGXGGGXGXXGGGXXXXG 815 GGG G G G G G GG G G G GGGG G GG GGG G GG Sbjct: 150 GGGRGRG-GRGRGGDRGGRGSDRGGRGGFGRGGGGGFRGGDRGGFGGGRGGFRGGDRGGF 208 Query: 814 XXGXGGXGXGXG 779 G GG G G Sbjct: 209 RGGRGGDFGGRG 220 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G GGG GG GG GGG GG G G G GG G GG G GG G Sbjct: 6 GRGGGGGFRGGRGG----GGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGGYDQG 55 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG GG GGGG G GG G G G G G G GG GG Sbjct: 8 GGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGG 51 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/48 (52%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXG 717 GG GGG G GGG GG GG G GGG GG GG G GG G Sbjct: 5 GGRGGGGGFRGGRGGG--GGGGFRGGRGGDRGGGFRGGRGGFGGGGRG 50 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGG 687 GG GG GG G G GGG GG GG GG G G GGGG Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGG 48 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 GG G GG G GGG GG G G GG G GG GG GGG GG Sbjct: 5 GGRGGGGGFRGGRGGG--GGGGFRGGRGGDRGG-GFRGGRGGFGGGGRGG 51 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G GGGG GG GGGG GG G G G GG G GG G Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGG 51 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG-XGXXGGXGGG 851 GG G GGG G GG G G GG GGG G GG GGG Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGG 47 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGG--XGXGGXGXGXGXGGGGGXXXXGXGG 663 GG GGGG G G GGGG G GG G GG GG G GG Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGG 51 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GG GG G G G GGG GGG GG GG GGG G GGGG G Sbjct: 5 GGRGGGGGFRG---------GRGGGGGGGFRGGRGG--DRGGGFRGGRGGFGGGGRG 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGX--GXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 G G GGG GG G G GGG G GG GGG GG GG G G G Sbjct: 5 GGRGGGGGFRGGRGGGG-----GGGFRGGRGGDRGGGFRGGRGGFGGGGRGGYDQG 55 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GG GG GGG G GG GGG G G G G GG Sbjct: 5 GGRGGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGG 51 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GGG GG G G GG G G GG G G GG G GG GG Sbjct: 5 GGRGGGGGFRGGRGGGGGG-GFRGGRGGDRGGGFRGGRGGFG-------GGGRGG 51 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -1 Query: 985 GGGGGX--G-XGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGGGG G GGG G GG G G GG GG G G GG G Sbjct: 8 GGGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGGYDQG 55 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 GG GG G GGG GG G GG G GGG GG G Sbjct: 9 GGGGFRGGRGGGGGGGFRGGRGGDRGGGFRGGRGGFGGGGRGGYDQG 55 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 58.8 bits (136), Expect = 5e-09 Identities = 29/67 (43%), Positives = 29/67 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P PPPPP P PP P PPP P P P PP P P Sbjct: 1336 PSPPPPPP---PPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPPPLF--SPSMILP 1390 Query: 835 PXPPPXP 855 P PPP P Sbjct: 1391 PPPPPLP 1397 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPPP P P P PPP PPP P P PPP PP PPP P Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPPPLFSPSMILPPPPPPLP 1397 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP-PXPPPXPPPXPPPXPXPP 888 P P PP P PPPP P PPPP PP P P P PPP P P PP Sbjct: 1336 PSPPPPPP-PPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPPPLFSPSMILPPPPP 1394 Query: 889 PXXXXXPXXPXP 924 P P P Sbjct: 1395 PLPSEEKKNPLP 1406 Score = 54.8 bits (126), Expect = 9e-08 Identities = 28/71 (39%), Positives = 28/71 (39%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PPP P PPPP PPP PP P P P P PPP P PP P Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPP---PPPPPTMSKAPTGVPLPVPPPPPLFSPSMILPP-PP 1393 Query: 937 PPXPXXPPPXP 969 PP P P Sbjct: 1394 PPLPSEEKKNP 1404 Score = 54.4 bits (125), Expect = 1e-07 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P PPP PPPP P PP P P P P PPPP P Sbjct: 1336 PSPPPPPPPPPPPSDDLTPVPPPP-----PPPPTMSKAPTGVPLPVP-PPPPLFSPSMIL 1389 Query: 811 PPPXXXXPPXPPPXPPP 861 PPP P P P Sbjct: 1390 PPPPPPLPSEEKKNPLP 1406 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P PP P P PPP P PP P PPPP P P PP P P Sbjct: 1336 PSPPPPPPP----PPPPSDDLTPVPP--PPPPPPTMSKAPTGVPLPVPPPPPLFSPSMIL 1389 Query: 972 PPPP 983 PPPP Sbjct: 1390 PPPP 1393 Score = 48.4 bits (110), Expect = 8e-06 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 4/73 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPP----XPPXXPXPPPPXPPXXXXPXPXPXPPXX 944 PP P P PP P PPP P PPP P P P PP PP P PP Sbjct: 1338 PPPPPPPPPPPSDDLTPVPPP--PPPPPTMSKAPTGVPLPVPPPPPLFSPSMILPPPP-- 1393 Query: 945 PXXPPPXPXPPPP 983 P P P P Sbjct: 1394 PPLPSEEKKNPLP 1406 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/89 (33%), Positives = 31/89 (34%), Gaps = 6/89 (6%) Frame = +1 Query: 571 HVDRXDXAXXXXXXXPPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP---PXPXP 741 H D + P PP P P P P PPPPP P P P P P Sbjct: 1322 HEDSDSFSTSRSSSPSPPPPPPPPPPPSDDLTPVP----PPPPPPPTMSKAPTGVPLPVP 1377 Query: 742 PPPXXPPP---XPXPPPPXXPPXXXXPPP 819 PPP P P PPPP P P Sbjct: 1378 PPPPLFSPSMILPPPPPPLPSEEKKNPLP 1406 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPX-------PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPX 882 P PP PPP PPPP PPP PP PPP PPP Sbjct: 1549 PQNRGPPMGGLPPPHGGMNGWRGGPPPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNG 1608 Query: 883 PPP 891 PP Sbjct: 1609 GPP 1611 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PP PPP P PP PPP PPP PPPP Sbjct: 1573 PPPPRGGSHCQGPPPLMGGP---PPRLGMPPPGPPPPNGGPPPP 1613 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PPP PP PPP PP PP P PPP Sbjct: 1574 PPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNGGPPP 1612 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPX 921 P PP PPP PP PP PP PPP P P Sbjct: 1549 PQNRGPPMGGLPPPHGGMNGWRGGPP----PPRGGSHCQGPPPLMGGPPPRLGMPPPGPP 1604 Query: 922 PPXXPPPXP 948 PP PP P Sbjct: 1605 PPNGGPPPP 1613 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 PPP PP PPP P P PPPP P PPP Sbjct: 1574 PPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNGGP----PPP 1613 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 739 PPPPXXPPPXPXPPP--PXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPPP PPP PP PPP PP P PPP Sbjct: 1573 PPPPRGGSHCQGPPPLMGGPPPRLGMPPP---GPPPPNGGPPP 1612 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX-PXPPPXXXXXPXXPXPPXXPPPXPXX 954 P PP PPP PPP PPP P P PP P Sbjct: 1549 PQNRGPPMGGLPPPHGGMNGWRGGPPPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNG 1608 Query: 955 PPPXP 969 PP P Sbjct: 1609 GPPPP 1613 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPXPPXPXPPPP 750 P P P P PPP P P P PP PPPP Sbjct: 1573 PPPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNGGPPPP 1613 Score = 31.5 bits (68), Expect = 0.95 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 11/61 (18%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPX---PPPPX--------PPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PP PPP PPPP PP P P P P PPP PPP Sbjct: 1554 PPMGGLPPPHGGMNGWRGGPPPPRGGSHCQGPPPLMGGPPPRLGMPP-PGPPPPNGGPPP 1612 Query: 981 P 983 P Sbjct: 1613 P 1613 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPP 783 P P P P PPP P PPP Sbjct: 1116 PVPVPTPFTIPPPVPPPPP 1134 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPP 891 P P P P PPP P PPP Sbjct: 1116 PVPVPTPFTIPPPVPPPPP 1134 Score = 30.3 bits (65), Expect = 2.2 Identities = 37/139 (26%), Positives = 37/139 (26%), Gaps = 19/139 (13%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPX-----PXXXXPP----PPPXPXPXPXPPXPXPPPPXXPP--- 762 P P P PPP P PP PP P P P P Sbjct: 1468 PPPPRGMNSPMRGMPPPMRGGGPPMRGGPPMRGGPPMFRGGPPGPGRGMPSPMMRGSSMR 1527 Query: 763 ---PXPXPPPPXXPPXXXXPPPXXXXPPX---PPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 P P P P PP PPP PPP P P Sbjct: 1528 GGFPQRGGGPGMGPSQYYHDSPQNRGPPMGGLPPPHGGMNGWRGGPPPPRGGSHCQGPPP 1587 Query: 925 -PXXPPPXPXXPPPXPXXP 978 PPP PPP P P Sbjct: 1588 LMGGPPPRLGMPPPGPPPP 1606 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P PP PP PPP P PPP PP Sbjct: 1573 PPPPRGGSHCQGPPPLMGGPPPRLGMPPPGPPPPNGGPPP 1612 >U53333-2|AAA96155.1| 299|Caenorhabditis elegans Collagen protein 34 protein. Length = 299 Score = 58.4 bits (135), Expect = 7e-09 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 10/130 (7%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P PP P P P PP P PP Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSG 166 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXP--PXXPPP----XP 948 P P P P P PP PP P P P P P P P P P Sbjct: 167 EPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGP 226 Query: 949 XXPPPXPXXP 978 PP P P Sbjct: 227 QGPPGSPGQP 236 Score = 54.0 bits (124), Expect = 2e-07 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P P PP P PPP P PP P P P Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 871 PXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P P P PP P P Sbjct: 162 PGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAP 198 Score = 54.0 bits (124), Expect = 2e-07 Identities = 39/131 (29%), Positives = 39/131 (29%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXP--XXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PP 786 PP P P P PP P P P P P P P P PP P P P Sbjct: 142 PPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTP 201 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXP- 957 P P P PP P PP P P P P P P P Sbjct: 202 GEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADG 261 Query: 958 ---PPXPXXPP 981 P P PP Sbjct: 262 NPGAPGPAGPP 272 Score = 52.8 bits (121), Expect = 4e-07 Identities = 39/129 (30%), Positives = 39/129 (30%), Gaps = 12/129 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P P Sbjct: 129 PGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGP 188 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPP-----PXPP--PXPXPPPXXXXXPXXPXPPXXP-PP 942 PP P P P P P PP P PP P P P P Sbjct: 189 PGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPK 248 Query: 943 XPXXPPPXP 969 P P P Sbjct: 249 GPNGPDGQP 257 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/102 (33%), Positives = 34/102 (33%), Gaps = 6/102 (5%) Frame = +1 Query: 691 PPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPP--PXXXXPPXPP-PXPP 858 P PP P P P P P P P PP PP P PP PP P P Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 859 PXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P PP P P P P Sbjct: 162 PGDSGEPGSPGLPGQDAAPGEPGPKG--PPGPPGAPGAPGTP 201 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P P P P PP P P PPP P P P PP P Sbjct: 104 PPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGP---PGPPGPPG 160 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 161 PPGDSGEPGSP 171 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX----PXPPP 783 P PP P P P P P P P P P P P PP P P P Sbjct: 188 PPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGP-PGEAGPQGPPGSPGQPGADGSPGQPG 246 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P PP P Sbjct: 247 PKGPNGPDGQPGADGNPGAPGPAGPPGSP 275 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/127 (25%), Positives = 33/127 (25%), Gaps = 4/127 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P PP P P P Sbjct: 126 PGNPGRPPQQPCEPITPPPCKPCPQGPPGP-PGPPGPPGDSGEPGSPGLPGQDAAPG-EP 183 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXP--XPPPPXPPXXXXPXPXPXPPXXP--XXPPP 962 P P P P P P P P P PP P P P P P Sbjct: 184 GPKGPPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPG 243 Query: 963 XPXPPPP 983 P P P Sbjct: 244 QPGPKGP 250 Score = 35.5 bits (78), Expect = 0.058 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 2/98 (2%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXP--PPXXPXPPPX 863 P PP P P P P P P P PP P PP Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P P P PP P P Sbjct: 162 PGDSGEPGSPGLP-GQDAAPGEPGPKGPPGPPGAPGAP 198 Score = 35.1 bits (77), Expect = 0.077 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 5/73 (6%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXP-PPXPPXXPXPP-PPXPPXXXXPXPXPXPP---XX 944 P P P P P P P P P P PP PP PP P P Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAA 179 Query: 945 PXXPPPXPXPPPP 983 P P P P PP Sbjct: 180 PGEPGPKGPPGPP 192 Score = 33.9 bits (74), Expect = 0.18 Identities = 28/123 (22%), Positives = 28/123 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P PP P P P Sbjct: 155 PPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTPGEPGV--PAQSEP 212 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P P P P P P Sbjct: 213 LIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADGNPGAPGPAGPP 272 Query: 975 PPP 983 P Sbjct: 273 GSP 275 >AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical protein Y63D3A.5 protein. Length = 486 Score = 58.4 bits (135), Expect = 7e-09 Identities = 44/135 (32%), Positives = 44/135 (32%), Gaps = 13/135 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP------PPPXPXPXPXPPX-PXPPPPXXPPPXPX 774 PP P P PP P PP PPP P P PPPP P Sbjct: 321 PP--PQGAPQQGFGAPPQGPPQGGPPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNF 378 Query: 775 PPPPX-XPPXXXXPPPXXXXPPXPPPXPPP-XPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPP PP PPP P P P PPP P P P PP P Sbjct: 379 APPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGPPPP 438 Query: 949 XXP----PPXPXXPP 981 P PP PP Sbjct: 439 GGPGAYGPPPTGFPP 453 Score = 51.2 bits (117), Expect = 1e-06 Identities = 38/126 (30%), Positives = 38/126 (30%), Gaps = 4/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPX--PXPPXPXPPPPXXPPPXP--XPPP 783 PP P P P PPPP P PP PP PPP P Sbjct: 343 PPQGSFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQG 402 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P PPP P PP P PPP P P PP PPP Sbjct: 403 PGGPGGYGPPPPGGPGAPG-SYGPPQGGPGGFGPPPPGGPGAYGPPPTGFPP--VGAPPP 459 Query: 964 XPXXPP 981 P Sbjct: 460 GAAGAP 465 Score = 50.8 bits (116), Expect = 1e-06 Identities = 39/131 (29%), Positives = 39/131 (29%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP--XPPP-- 783 PP PP P PPP P P P PP PP PPP Sbjct: 297 PPSGPPSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAP-PQGPPQGGPPQGSFGAPPPQQ 355 Query: 784 ---PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP--XXPPPXP 948 P PPP P P P PP PPP P P P PPP Sbjct: 356 FHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPG 415 Query: 949 XXPPPXPXXPP 981 P PP Sbjct: 416 GPGAPGSYGPP 426 Score = 45.2 bits (102), Expect = 7e-05 Identities = 32/119 (26%), Positives = 32/119 (26%), Gaps = 2/119 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P PP PP PP P P P PP PP Sbjct: 289 PPQQFGGPPPSGPPSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAP-PQGPPQGGPPQGS 347 Query: 808 X--PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PPP P P P PP P P PPP P P P Sbjct: 348 FGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGP 406 Score = 43.6 bits (98), Expect = 2e-04 Identities = 37/120 (30%), Positives = 37/120 (30%), Gaps = 12/120 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXP----PPPPXPXPXPXPPXP---XPPPPXXPPPXPX 774 PP P P PP P P PPP P P P P P Sbjct: 351 PPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPPPSAFGAPQGPGGPGGYG 410 Query: 775 PPPPXXP--PXXXXPP---PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPPP P P PP P PP PP P PP PP P P P Sbjct: 411 PPPPGGPGAPGSYGPPQGGPGGFGPP-PPGGPGAYGPPPTGFPPVGAPPPGAAGAPGGNP 469 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 4/107 (3%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPP P P PP PPP P PP PP Sbjct: 290 PQQFGGPPPSGP---PSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAPPQGPPQGGPPQG 346 Query: 853 ----PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P P P P P P PP PP Sbjct: 347 SFGAPPPQQFHAPSPQSFGGPPPPVSSAPGNFAPPPQSGPPGAFAPP 393 Score = 34.3 bits (75), Expect = 0.14 Identities = 30/118 (25%), Positives = 30/118 (25%), Gaps = 6/118 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP PPP P P P PPP PPPP Sbjct: 219 PPPPIEQFGAIPPPNATIPSFPTSNAASP-PVQEFAPPPPQQQQQQFQAPPPPMASHSSI 277 Query: 808 XPPP---XXXXPPXPPPXPPPXPPPXP---XPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP PPP PP PP PP P PP Sbjct: 278 SSTPVQQQGFAPPQQFGGPPPSGPPSEYGGYAPPQQQQQQFGAPPPQGAPQQGFGAPP 335 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/101 (26%), Positives = 27/101 (26%), Gaps = 3/101 (2%) Frame = +3 Query: 690 PPP---PPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPP 860 PPP PP P PP P P P P P PPP Sbjct: 380 PPPQSGPPGAFAPPPSAFGAPQGPGGPGGYGPPPPGGPGAPGSYGPPQGGPGGFGP-PPP 438 Query: 861 XPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP P P PP P P P Sbjct: 439 GGPGAYGPPPTGFPPVGAP-----PPGAAGAPGGNPFARGP 474 Score = 29.1 bits (62), Expect = 5.1 Identities = 25/102 (24%), Positives = 25/102 (24%), Gaps = 5/102 (4%) Frame = +1 Query: 691 PPPPXPXPXPX-PPXPXPPPPXXPPPXPXPPP----PXXPPXXXXPPPXXXXPPXPPPXP 855 PPP P PPP PPP P P PP P PP Sbjct: 201 PPPHQQIPDDLNTSFSSQPPPPIEQFGAIPPPNATIPSFPTSNAASPPVQEFAPPPPQQQ 260 Query: 856 PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P PP Sbjct: 261 QQQFQAPPPPMASHSSISSTPVQQQGFAPPQQFGGPPPSGPP 302 >AF410845-1|AAL76233.1| 299|Caenorhabditis elegans cuticular collagen RAM-4 protein. Length = 299 Score = 58.4 bits (135), Expect = 7e-09 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 10/130 (7%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P PP P P P PP P PP Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSG 166 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXP--PXXPPP----XP 948 P P P P P PP PP P P P P P P P P P Sbjct: 167 EPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGP 226 Query: 949 XXPPPXPXXP 978 PP P P Sbjct: 227 QGPPGSPGQP 236 Score = 54.0 bits (124), Expect = 2e-07 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P P PP P PPP P PP P P P Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 871 PXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P P P PP P P Sbjct: 162 PGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAP 198 Score = 54.0 bits (124), Expect = 2e-07 Identities = 39/131 (29%), Positives = 39/131 (29%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXP--XXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PP 786 PP P P P PP P P P P P P P P PP P P P Sbjct: 142 PPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTP 201 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXP- 957 P P P PP P PP P P P P P P P Sbjct: 202 GEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADG 261 Query: 958 ---PPXPXXPP 981 P P PP Sbjct: 262 NPGAPGPAGPP 272 Score = 52.8 bits (121), Expect = 4e-07 Identities = 39/129 (30%), Positives = 39/129 (30%), Gaps = 12/129 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P P Sbjct: 129 PGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGP 188 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPP-----PXPP--PXPXPPPXXXXXPXXPXPPXXP-PP 942 PP P P P P P PP P PP P P P P Sbjct: 189 PGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPK 248 Query: 943 XPXXPPPXP 969 P P P Sbjct: 249 GPNGPDGQP 257 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/102 (33%), Positives = 34/102 (33%), Gaps = 6/102 (5%) Frame = +1 Query: 691 PPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPP--PXXXXPPXPP-PXPP 858 P PP P P P P P P P PP PP P PP PP P P Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 859 PXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P PP P P P P Sbjct: 162 PGDSGEPGSPGLPGQDAAPGEPGPKG--PPGPPGAPGAPGTP 201 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P P P P PP P P PPP P P P PP P Sbjct: 104 PPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGP---PGPPGPPG 160 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 161 PPGDSGEPGSP 171 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX----PXPPP 783 P PP P P P P P P P P P P P PP P P P Sbjct: 188 PPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGP-PGEAGPQGPPGSPGQPGADGSPGQPG 246 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P PP P Sbjct: 247 PKGPNGPDGQPGADGNPGAPGPAGPPGSP 275 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/127 (25%), Positives = 33/127 (25%), Gaps = 4/127 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P PP P P P Sbjct: 126 PGNPGRPPQQPCEPITPPPCKPCPQGPPGP-PGPPGPPGDSGEPGSPGLPGQDAAPG-EP 183 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXP--XPPPPXPPXXXXPXPXPXPPXXP--XXPPP 962 P P P P P P P P P PP P P P P P Sbjct: 184 GPKGPPGPPGAPGAPGTPGEPGVPAQSEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPG 243 Query: 963 XPXPPPP 983 P P P Sbjct: 244 QPGPKGP 250 Score = 35.5 bits (78), Expect = 0.058 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 2/98 (2%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXP--PPXXPXPPPX 863 P PP P P P P P P P PP P PP Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGP 161 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P P P PP P P Sbjct: 162 PGDSGEPGSPGLP-GQDAAPGEPGPKGPPGPPGAPGAP 198 Score = 35.1 bits (77), Expect = 0.077 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 5/73 (6%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXP-PPXPPXXPXPP-PPXPPXXXXPXPXPXPP---XX 944 P P P P P P P P P P PP PP PP P P Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAA 179 Query: 945 PXXPPPXPXPPPP 983 P P P P PP Sbjct: 180 PGEPGPKGPPGPP 192 Score = 33.9 bits (74), Expect = 0.18 Identities = 28/123 (22%), Positives = 28/123 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P PP P P P Sbjct: 155 PPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPPGPPGAPGAPGTPGEPGV--PAQSEP 212 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P P P P P P Sbjct: 213 LIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADGNPGAPGPAGPP 272 Query: 975 PPP 983 P Sbjct: 273 GSP 275 >U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific family, class qprotein 4 protein. Length = 373 Score = 57.6 bits (133), Expect = 1e-08 Identities = 42/111 (37%), Positives = 42/111 (37%), Gaps = 4/111 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX--GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG GG GGG G GG G G G G G Sbjct: 258 GGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGG-GGATSAYFGVGSGAMGGGGAGA 316 Query: 806 XXXGGXXGGGGXGXGGG--XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 GGG G GGG GGGG G G G GGGGG G GGG Sbjct: 317 QSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGG---GGGGGG 364 Score = 54.8 bits (126), Expect = 9e-08 Identities = 39/111 (35%), Positives = 39/111 (35%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG G GG G G GGG G G G GGGG G Sbjct: 259 GAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFG---VGSGAMGGGGAG 315 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GG G G GGGGG G G G G GG GG Sbjct: 316 AQSAYFGVGGGPVGGGGGGAKSGGGGG----GIPGQSVYMGAGGGGGGGGG 362 Score = 53.2 bits (122), Expect = 3e-07 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 1/95 (1%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX-GXGGGXX 750 GG G G GGG GGG G G G GG G GGG Sbjct: 272 GGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGV---GSGAMGGGGAGAQSAYFGVGGGPV 328 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GGGG G G G G G G GGG G G Sbjct: 329 GGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGGGG 363 Score = 51.6 bits (118), Expect = 8e-07 Identities = 35/122 (28%), Positives = 35/122 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG GG G GG GG GG Sbjct: 218 GAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRGASTMTAVGGAPGGASTMTAMGGGPSAF 277 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G G GGG GG G G G GGG G G G G G G G Sbjct: 278 GGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKS 337 Query: 620 GG 615 GG Sbjct: 338 GG 339 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG--- 815 GGGGG G G G G G G G G GG GGG GGG G Sbjct: 290 GGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSV 349 Query: 814 XXGXGGXGXGXGG 776 G GG G G GG Sbjct: 350 YMGAGGGGGGGGG 362 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GGG GG GG GGG G G G GG G G G G GGGGG Sbjct: 22 GVGGGPAGGGGGNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAYFGVGGGPVGGGGGGG 81 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX-GXGXGXXXXGGXGGG--GXGXXGGXGGGXGXXGGG 830 GGGG G G GG G G G GG GGG G G GGG G GGG Sbjct: 310 GGGGAGAQSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGGGG 363 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/75 (33%), Positives = 25/75 (33%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G GG GG G GG G G GG G Sbjct: 7 GVAGGGNAGAQSAYFGVGGGPAGGGGGNKSAGGGGAPPPGVS-CYLGAGAGGAASGSQSA 65 Query: 755 XXGGGGXGXGGXGXG 711 G GG GG G G Sbjct: 66 YFGVGGGPVGGGGGG 80 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/103 (30%), Positives = 31/103 (30%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG-XGXXGGXGGGXGXXGGGXXXXGXX 809 GG GG GG GG GGGG G G G GG Sbjct: 262 GGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYF 321 Query: 808 GXGG---XGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G G G G GG GGGGG Sbjct: 322 GVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGGGGG 364 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG GG G G G G G G G G GG GG Sbjct: 24 GGGPAGGGGGNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAYFGVGGGPVGGGGGG 80 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 2/73 (2%) Frame = -3 Query: 872 GGGXGGGXGG--GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 GGG G G GG GGG G GGG G G G G G Sbjct: 10 GGGNAGAQSAYFGVGGGPAGGGGGNKSAG--GGGAPPPGVSCYLGAGAGGAASGSQSAYF 67 Query: 698 GGGGXXXXGXGGG 660 G GG G GGG Sbjct: 68 GVGGGPVGGGGGG 80 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG G G G G G GG G GGG GG Sbjct: 22 GVGGGPAGGGGGNKSAGG--GGAPPPGVSCYLGAGAGGAASGSQSAYFGVGGG--PVGGG 77 Query: 788 XGGG 777 GGG Sbjct: 78 GGGG 81 Score = 37.1 bits (82), Expect = 0.019 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 3/125 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGX---GXGGGXGGGXGGGXGGXXXXGGG 810 GG G G GGG GG G G GGG G G G GG G G Sbjct: 11 GGNAGAQSAYFGVGGGPAGGGG--GNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAYFG 68 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GGG G G G GG G G G G Sbjct: 69 V---GGGPVGGGGGGGAPPAASNDAGYFATPPAAPAGGSSTMTAVG-GAPRGASTMTAVG 124 Query: 629 GXXGG 615 G G Sbjct: 125 GAPVG 129 Score = 35.9 bits (79), Expect = 0.044 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G GGG G GGG GG GGG GGG G G G G G Sbjct: 7 GVAGGGNAGAQSAYFGVGGGPA--GG--GGGNKSAGGGGAPPPGVSC-YLGAGAG-GAAS 60 Query: 689 GXXXXGXGGGXGXXGXGXXGG 627 G G G G G G GG Sbjct: 61 GSQSAYFGVGGGPVGGGGGGG 81 Score = 35.9 bits (79), Expect = 0.044 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG---GXGXXGGXGGGXGXXGGGXXXXGX 812 GGG G G GG G G G GG G G G G G G Sbjct: 10 GGGNAGAQSAYFGVGGGPAGGGGGNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAYFGV 69 Query: 811 XGXGGXGXGXGG 776 G G G GG Sbjct: 70 GGGPVGGGGGGG 81 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 10/70 (14%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG-----XXXXGXGGGXGXXG----- 645 G GGG G G GG GG G GGGG G G G G Sbjct: 7 GVAGGGNAGAQSAYFGVGGGPAGGGGGNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAY 66 Query: 644 XGXXGGXXGG 615 G GG GG Sbjct: 67 FGVGGGPVGG 76 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG GG G G G G G GG G GGG Sbjct: 29 GGGGGNKSAGGGGAPPPGVSCYLGAGAGGAASGSQSAYFGVGGGPVGGGGGG 80 Score = 30.3 bits (65), Expect = 2.2 Identities = 28/122 (22%), Positives = 28/122 (22%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG GG GG GG Sbjct: 191 GGAPSGASTMTAIGGAPRGASTMTAVGGAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRG 250 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G GGG G G Sbjct: 251 ASTMTAVGGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGG-GGGGGATSAYFGVGSGAM 309 Query: 620 GG 615 GG Sbjct: 310 GG 311 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/74 (25%), Positives = 19/74 (25%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G GGG GG G G G GG GG Sbjct: 57 GAASGSQSAYFGVGGGPVGGGGGGGAPPAASNDAGYFATPPAAPAGGSSTMTAVGGAPRG 116 Query: 800 XGGXXGGGGXGXGG 759 GG GG Sbjct: 117 ASTMTAVGGAPVGG 130 >AF098500-3|ABD94103.1| 774|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform b protein. Length = 774 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 2/86 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXX 792 P P P P P P PPPPP P P PP P PPP P P P Sbjct: 69 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRP-PPIPASPPPRPPASEPVGIPLYSEK 127 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP PP PP PP Sbjct: 128 QHQQQLRPTTAVSPPKPPSFAPPVPP 153 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 1/87 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP-PXPXPP 888 P PP P PP P PP PPP P PPP P PPP PP P P Sbjct: 69 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPP---IPASPPPRPPASEPVGIPLYS 125 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P PP P Sbjct: 126 EKQHQQQLRPTTAVSPPKPPSFAPPVP 152 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 856 PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P PP P P PP PP PPP P PP Sbjct: 69 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPP 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PP P PPPP P P PP P PPP P P Sbjct: 69 PTESPPLPPPPLPLSNPPAKPTPPPPPPK------PTIRPPPIPASPPPRPPASEP 118 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P PPP PP P P P PP P P Sbjct: 76 PPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPPPRPPASEPVGIPLYSEKQHQQQLRP 135 Query: 957 PPXPXPPPP 983 PP P Sbjct: 136 TTAVSPPKP 144 Score = 33.5 bits (73), Expect = 0.24 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 2/98 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P PPP P PP P PP P Sbjct: 69 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIP-------------ASPPPRPPA 115 Query: 795 XPP--XPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P PP P PP PP Sbjct: 116 SEPVGIPLYSEKQHQQQLRPTTAVSPPKPPSFAPPVPP 153 >AF098500-2|AAC67399.2| 996|Caenorhabditis elegans Temporarily assigned gene nameprotein 343, isoform a protein. Length = 996 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 2/86 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXX 792 P P P P P P PPPPP P P PP P PPP P P P Sbjct: 291 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRP-PPIPASPPPRPPASEPVGIPLYSEK 349 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP PP PP PP Sbjct: 350 QHQQQLRPTTAVSPPKPPSFAPPVPP 375 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 1/87 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP-PXPXPP 888 P PP P PP P PP PPP P PPP P PPP PP P P Sbjct: 291 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPP---IPASPPPRPPASEPVGIPLYS 347 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P PP P Sbjct: 348 EKQHQQQLRPTTAVSPPKPPSFAPPVP 374 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 856 PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P PP P P PP PP PPP P PP Sbjct: 291 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPP 332 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PP P PPPP P P PP P PPP P P Sbjct: 291 PTESPPLPPPPLPLSNPPAKPTPPPPPPK------PTIRPPPIPASPPPRPPASEP 340 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P PPP PP P P P PP P P Sbjct: 298 PPPPLPLSNPPAKPTPPPPPPKPTIRPPPIPASPPPRPPASEPVGIPLYSEKQHQQQLRP 357 Query: 957 PPXPXPPPP 983 PP P Sbjct: 358 TTAVSPPKP 366 Score = 33.5 bits (73), Expect = 0.24 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 2/98 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P PP P P PPP P PP P PP P Sbjct: 291 PTESPPLPPPPLPLSNPPAKPTPPPPPPKPTIRPPPIP-------------ASPPPRPPA 337 Query: 795 XPP--XPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P PP P PP PP Sbjct: 338 SEPVGIPLYSEKQHQQQLRPTTAVSPPKPPSFAPPVPP 375 >AL137227-1|CAB70238.2| 611|Caenorhabditis elegans Hypothetical protein F58D5.1 protein. Length = 611 Score = 57.2 bits (132), Expect = 2e-08 Identities = 39/109 (35%), Positives = 39/109 (35%), Gaps = 1/109 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G G G G G GG G GG G GGG G Sbjct: 459 GRGFGGAGGGAGNHGQRGGQRGGGQWGGNAGPGGYYPNHFNNGYDMPMPWGGGYGGDMGY 518 Query: 788 XGGGGXGXGGGXXGGGGXGX-GGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG G GGG G G G G G G GG G G GGG G G Sbjct: 519 GAYGG-GYGGGYGGPGAYGDFGAYGGGGFRGGMRGSPRGGMGGGGGFRG 566 Score = 54.8 bits (126), Expect = 9e-08 Identities = 42/124 (33%), Positives = 42/124 (33%), Gaps = 4/124 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGG----GXGXGGGXGGGXGGGXGGXXXXGGG 810 G G G G G GG GG G G GG G GGG GG G Sbjct: 463 GGAGGGAGNHGQRGGQRGG-GQWGGNAGPGGYYPNHFNNGYDMPMPWGGGYGGDMGYGAY 521 Query: 809 XXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG GG G G GGGG G G G GGGG G G G G Sbjct: 522 GGGYGGGYGGPGAYGDFGAYGGGGFRGGMRGSPRGGMGGGGGFRGGPPGRGGMANRRGRG 581 Query: 629 GXXG 618 G Sbjct: 582 KRPG 585 Score = 52.4 bits (120), Expect = 5e-07 Identities = 41/114 (35%), Positives = 41/114 (35%), Gaps = 7/114 (6%) Frame = -3 Query: 980 GGXXGXG--GGXXGXGGGXXGGXGXX-GXXXXXGGGXGXG---GGXGGGXGGGXGGXXXX 819 GG G G GG G GG GGG G G GGG GGG GG Sbjct: 476 GGQRGGGQWGGNAGPGGYYPNHFNNGYDMPMPWGGGYGGDMGYGAYGGGYGGGYGGPGAY 535 Query: 818 GG-GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GG GG GG GGGG G G G G G G G Sbjct: 536 GDFGAYGGGGFRGGMRGSPRGGMGGGGGFRGGPPGRGGMANRRGRGKRPGDGRG 589 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/84 (36%), Positives = 31/84 (36%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G G GGG G G G G GG GG G GGGG G Sbjct: 509 GGGYGGDMGYGAYGGGYGGGYGGPGAY--GDFGAYGGGGFRGGMRGSPRGGMGGGGGFRG 566 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG 690 G GG G G G G GG Sbjct: 567 GPPGRGGMANRRGRGKRPGDGRGG 590 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 4/71 (5%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG--GGXGXXGGXGGGX-G-XXGGGXXXXGX 812 GGG G G GG G G G G G GG G GG G G GGG G Sbjct: 509 GGGYGGDMGYGAYGGGYGGGYGGPGAYGDFGAYGGGGFRGGMRGSPRGGMGGGGGFRGGP 568 Query: 811 XGXGGXGXGXG 779 G GG G Sbjct: 569 PGRGGMANRRG 579 >U97196-12|AAB52456.2| 564|Caenorhabditis elegans Hypothetical protein B0207.1 protein. Length = 564 Score = 56.4 bits (130), Expect = 3e-08 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 9/115 (7%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPX------PPXPXPPPPXXPPPXPXP---PPPXX 792 P P P P P P P P PP PP P P P PP Sbjct: 42 PNQIPPAPRPIVNQIQYPKPTNPVQNPNKLSTGLPPMTMMLPPTVQEPLPTPVKTPPLPR 101 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP P P P P PPP P PP P P P PPP P P Sbjct: 102 PPGNLNPVQQPQIPVQRTPPQCP-PPPVPHPPQITQMAPILPTSPAPPPPIPHPP 155 Score = 54.4 bits (125), Expect = 1e-07 Identities = 37/121 (30%), Positives = 37/121 (30%), Gaps = 1/121 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P PP P P P P PP P PP P P P P Sbjct: 61 PTNPVQNPNKLSTGLPPMTMMLPPTVQEPLPTPVKTPPLPRPPGNLNPVQQPQIPVQRTP 120 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P PPP PP P P P PPP P P P P P P Sbjct: 121 PQC--PPPPVPHPPQITQMAPILPTS-PAPPPPIPHPPQRAQMNCLPLPQTFQPLPHPPV 177 Query: 976 P 978 P Sbjct: 178 P 178 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/104 (30%), Positives = 32/104 (30%), Gaps = 8/104 (7%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXP-------PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P P P PP P P P P P P PP PP P P Sbjct: 36 PVQNPNPNQIPPAPRPIVNQIQYPKPTNPVQNPNKLSTGLPPMTMMLPPTVQEPLPTPVK 95 Query: 853 PPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PP P P PP PPP PP P Sbjct: 96 TPPLPRPPGNLNPVQQPQIPVQRTPPQCPPPPVPHPPQITQMAP 139 Score = 46.8 bits (106), Expect = 2e-05 Identities = 31/104 (29%), Positives = 31/104 (29%), Gaps = 1/104 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P PP P P P P PP P P PP Sbjct: 76 PPMTMMLPPTVQEPLPTPVKTPPLPRPPGNLNPVQQPQIPVQRTPPQCPPPPVPHPPQIT 135 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXP 924 P PP P P PP P P P P P Sbjct: 136 QMAPI-LPTSPAPPPPIPHPPQRAQMNCLPLPQTFQPLPHPPVP 178 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPX-PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P P P PP P PP P PP P P P Sbjct: 91 PTPVKTPPLPRPPGNLNPVQQPQIPVQRTPPQCPPPPVPHPPQITQ-----MAPILPTSP 145 Query: 957 -PPXPXPPPP 983 PP P P PP Sbjct: 146 APPPPIPHPP 155 Score = 36.7 bits (81), Expect = 0.025 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 11/131 (8%) Frame = +3 Query: 624 PPXXPPXPXXXXXPX--PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPX 797 P P P P P P P P P PP Sbjct: 23 PNLANPFPNVNSVPVQNPNPNQIPPAPRPIVNQIQYPKPTNPVQNPNKLSTGLPPMTMML 82 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXX--PXPPPPXP----PXXXXPXPXPXPPXXPXXP- 956 PP P P P P P PP P P P P P P P PP Sbjct: 83 PPTVQEPL---PTPVKTPPLPRPPGNLNPVQQPQIPVQRTPPQCPPPPVPHPPQITQMAP 139 Query: 957 --PPXPXPPPP 983 P P PPPP Sbjct: 140 ILPTSPAPPPP 150 Score = 29.1 bits (62), Expect = 5.1 Identities = 26/110 (23%), Positives = 26/110 (23%), Gaps = 2/110 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPPP PP PP P Sbjct: 121 PQCPPPPVPHPPQITQMAPILPTSPAPPPPIPHPPQRAQMNCLPLPQTFQPLPHPPVPQQ 180 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP--PPXPPXXXXPXPXPXPP 938 P P P P P PP P P PP Sbjct: 181 LNQRGSGQAMCV-PVAAPLPAIINPITQHNPVQPPLIPSSDPFGPTVVPP 229 >Z83219-3|CAD57687.1| 965|Caenorhabditis elegans Hypothetical protein C31C9.6 protein. Length = 965 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 4/87 (4%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP-XPPPXPPP---XPPPXPXPPPXXX 900 P P PPP P PP P PP P P PPP P P P P P Sbjct: 426 PKTPTRVAPPPPPSAPPTIKFPISTGTSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEV 485 Query: 901 XXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P PP P PP Sbjct: 486 SKSPPPPPPLPPIATPSSVPPPPPPPP 512 Score = 52.0 bits (119), Expect = 6e-07 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPP 798 P P P P P P P P P P P PPPP P P PPPP PP Sbjct: 460 PTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPPIATPSSVPPPPPPPP 512 Score = 51.6 bits (118), Expect = 8e-07 Identities = 33/92 (35%), Positives = 33/92 (35%), Gaps = 16/92 (17%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPX----------------PXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P PPPPP P P P P PPPP P P P P Sbjct: 426 PKTPTRVAPPPPPSAPPTIKFPISTGTSYSSTTPPTTPKPAPPPPSR-IPNPSPSPQPAE 484 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPP PP PP P PP P PPP Sbjct: 485 VSKSPPPP----PPLPPIATPSSVPPPPPPPP 512 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPXPXPPPPXXPPX 801 PP P P P P P P P P PP P PP P PP P PPPP Sbjct: 459 PPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPPLPPIATPSSVPP-PPPPPPALEQE 517 Query: 802 XXXPP 816 PP Sbjct: 518 ISGPP 522 Score = 47.2 bits (107), Expect = 2e-05 Identities = 28/91 (30%), Positives = 28/91 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PP P P P PP P P P P P PP Sbjct: 434 PPPPPSAPPTIKFPISTGTSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPP 493 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP PPP PPP PP Sbjct: 494 PL--PPIATPSSVPPPPPPPPALEQEISGPP 522 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P PP P P P P P P P P PPP P Sbjct: 437 PPSAPPTIKFPISTGTSYSSTT--PPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPP--P 492 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P PP PPP P Sbjct: 493 P----PLPPIATPSSVPPPPPPPP 512 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/95 (28%), Positives = 27/95 (28%) Frame = +3 Query: 693 PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPX 872 PPPP PP P P P PP P P P Sbjct: 434 PPPPPSAPPTIKFPISTGTSYSSTTPPTTPKPAPPPPS------RIPNPSPSPQPAEVSK 487 Query: 873 XPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P PPPP PP P PP P PP Sbjct: 488 SPPPPPPLPPIATPSSVPPPPPPPPALEQEISGPP 522 Score = 30.3 bits (65), Expect = 2.2 Identities = 23/88 (26%), Positives = 23/88 (26%), Gaps = 7/88 (7%) Frame = +2 Query: 740 PPPPXXPPPXXXPPXPXXX------PXXPXXPXPPXXXXXXXXXXXXXXXXXXXPPPXPX 901 PPPP PP P P P PP PPP P Sbjct: 435 PPPPSAPPTIKFPISTGTSYSSTTPPTTPKPAPPPPSRIPNPSPSPQPAEVSKSPPPPPP 494 Query: 902 XXPXPPPXPX-XPXPPXPXPPXXPPXPP 982 P P P PP P PP Sbjct: 495 LPPIATPSSVPPPPPPPPALEQEISGPP 522 >U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical protein C01G8.9a protein. Length = 1724 Score = 56.0 bits (129), Expect = 4e-08 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 4/90 (4%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP-P--PPXXPPX 801 P P P P P PPP P P P PP P P P P P P PP Sbjct: 681 PGEPTSSTPSDTPAPSTSVPPPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPG 740 Query: 802 XXXPPPXXXXPPXPP-PXPPPXPPPXPXPP 888 PP PP P PP PPP P Sbjct: 741 AMRPPAGFAPPPGAPYGYPPGAPPPAGFHP 770 Score = 51.6 bits (118), Expect = 8e-07 Identities = 38/120 (31%), Positives = 38/120 (31%), Gaps = 6/120 (5%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXP--PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P P P P PPP P P P P PP PPP P Sbjct: 32 PAPDASMPTPQQQQQQPNLPPPQQPYEHPAQQHP-PQHHSVPPNSFAPPPGQHHPQHPGM 90 Query: 814 PPXXXXPPXP----PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PP P PP PP P P PP P PP PP Sbjct: 91 PPMEWRPPGAEYQMPPGYPAGYPPYGMPPRHHPGYP-HPAYGYPPPGAPYGYPPQMMRPP 149 Score = 48.4 bits (110), Expect = 8e-06 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 P P P P PP PP P PP PP P P P P PP Sbjct: 681 PGEPTSSTPSDTPAPSTSVPPPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPG 740 Query: 877 PXPPPXXXXXPXXP---XPPXXPPPXPXXP 957 PP P PP PPP P Sbjct: 741 AMRPPAGFAPPPGAPYGYPPGAPPPAGFHP 770 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P PPP PP P PP P P P P P P P PP Sbjct: 689 PSDTPAPSTSVPPPTSV----QPPQPQQPPQGPPGP-PGPQQHPGPYPG-YPGYGPPGAM 742 Query: 808 XPPPXXXXPPXPPPXPPPXPPP 873 PP PP P PP PP Sbjct: 743 RPPAGFAPPPGAPYGYPPGAPP 764 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P P P P P PP PP P PP P P P P P P Sbjct: 681 PGEPTSSTPSDTPAPSTSVPPPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPG 740 Query: 913 XPXPPXXPPPXPXXPPPXPXXPP 981 PP P P P P P Sbjct: 741 AMRPPAGFAPPPGAPYGYPPGAP 763 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXX-PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPX 894 P P P P PPP PP PP PP P P P P PP Sbjct: 681 PGEPTSSTPSDTPAPSTSVPPPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPG 740 Query: 895 XXXXPXXPXPPXXPP--PXPXXPPPXPXXP 978 P PP P P PPP P Sbjct: 741 AMRPPAGFAPPPGAPYGYPPGAPPPAGFHP 770 Score = 44.8 bits (101), Expect = 1e-04 Identities = 38/139 (27%), Positives = 38/139 (27%), Gaps = 25/139 (17%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P PP P P P P P P PP PP PPP Sbjct: 701 PPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPGAMRPPAGFAPPPGAPYGYPP 760 Query: 808 XPPPXXXXPPXPPPXP-----------------------PPXPPPXPXPPPXXXXXPXXP 918 PP P P P P P PP P P Sbjct: 761 GAPPPAGFHPSHPQHPQHAQYLAWQQQRYHQQQQHQQQQQQGAPGGPRPPYPYPGGPVPP 820 Query: 919 XPP--XXPPPXPXXPPPXP 969 PP PPP P P P Sbjct: 821 GPPQNRMPPPPPAQGAPSP 839 Score = 43.6 bits (98), Expect = 2e-04 Identities = 35/115 (30%), Positives = 35/115 (30%), Gaps = 11/115 (9%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXP--PPPXXP---PPXPXPPP-PXXPPXXXXPPPXXX 828 P PP P P P P PPP P P PP PP PPP Sbjct: 24 PKKDDQVPPAPDASMPTPQQQQQQPNLPPPQQPYEHPAQQHPPQHHSVPPNSFAPPPGQH 83 Query: 829 XPPXPPPXPPPXPPP---XPXPPPXXXXXPXXPXPPXXPP--PXPXXPPPXPXXP 978 P P P PP PP P PP P P P P P P Sbjct: 84 HPQHPGMPPMEWRPPGAEYQMPPGYPAGYPPYGMPPRHHPGYPHPAYGYPPPGAP 138 Score = 40.3 bits (90), Expect = 0.002 Identities = 35/134 (26%), Positives = 35/134 (26%), Gaps = 12/134 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP---PPXPXPXPX---PPXPXPPP---PXXPPPX 768 PP P P P PPP PP PP P PP P P Sbjct: 118 PPRHHPGYPHPAYGYPPPGAPYGYPPQMMRPPMMAPGDMVRMPPGPTPTEWAAQQQAQAA 177 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP---PXXPP 939 PP P P P P P P P P P P P Sbjct: 178 SRSVPPKEGPNGNPATPSSSSQPIPSPSASSIAEESLDDKPSGTKMPAQPPPQQHPPPPQ 237 Query: 940 PXPXXPPPXPXXPP 981 P P P PP Sbjct: 238 PQQIMSPMPPQAPP 251 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/116 (27%), Positives = 32/116 (27%), Gaps = 5/116 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX-PPXPXPPP-PXXPPPXPXPPPPX 789 P PP P P PP P P P P PP PP PP Sbjct: 48 PNLPPPQQPYEHPAQQHPPQHHSVPPNSFAPPPGQHHPQHPGMPPMEWRPPGAEYQMPPG 107 Query: 790 XP---PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PP P P PP P PP P PP P Sbjct: 108 YPAGYPPYGMPPRHHPGYPHPAYGYPPPGAPYGYPPQMMRPPMMAPGDMVRMPPGP 163 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/96 (27%), Positives = 26/96 (27%), Gaps = 1/96 (1%) Frame = +2 Query: 698 PPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXXX 877 PP P P P P PP PP P P P Sbjct: 738 PPGAMRPPAGFAPPPGAPYGYPPGAPPPA-GFHPSHPQHPQHAQYLAWQQQRYHQQQQHQ 796 Query: 878 XXPPPXPXXXPXPP-PXPXXPXPPXPXPPXXPPXPP 982 P PP P P P PP P PP PP Sbjct: 797 QQQQQGAPGGPRPPYPYPGGPVPPGPPQNRMPPPPP 832 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +1 Query: 691 PPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P PP P P P PP P PPP P P P P P P P Sbjct: 807 PRPPYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPAPPSRASAPTP 866 Query: 868 PPXPXPPP 891 P P Sbjct: 867 QPLSSTMP 874 Score = 37.1 bits (82), Expect = 0.019 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +1 Query: 646 PXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P PP P P PP PP P PP P P P P PP Sbjct: 804 PGGPRPPYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPA----PPS 859 Query: 823 XXXPPXPPPXPPPXPPPXP 879 P P P P P Sbjct: 860 RASAPTPQPLSSTMPVVAP 878 Score = 35.5 bits (78), Expect = 0.058 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = +1 Query: 619 PXXP-PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXX 792 P P P P P P PP P PPPPP P P P P PP Sbjct: 804 PGGPRPPYPYPGGPVPPGPPQNRMPPPPPAQG-APSPSGAAGSNGKQPRYGTPAPPSRAS 862 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P P P P P P Sbjct: 863 AP---TPQPLSSTMPVVAPSTSTQPTP 886 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP-XPXPXPPXXPXX 953 P P P P P P PP PPP P P P P PP Sbjct: 804 PGGPRPPYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPAPPSRASA 863 Query: 954 PPPXP 968 P P P Sbjct: 864 PTPQP 868 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P PP P P PP P P P PP Sbjct: 804 PGGPRP-PYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPAPPSR-A 861 Query: 871 PXPXPPPXXXXXP-XXPXPPXXPPP 942 P P P P P P P Sbjct: 862 SAPTPQPLSSTMPVVAPSTSTQPTP 886 Score = 33.5 bits (73), Expect = 0.24 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P PP P P PP Sbjct: 447 PPGPPGAYPGNGAPGGPPGGPPQFPGHPGMDPNYHYYQQHGMMPPH--PGHPGYPPQHMN 504 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP P PPP P P P Sbjct: 505 AFSPGQYPGHQRPPGGPGGPPPGPQAMRAPMP 536 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP PPPP P P P PP P Sbjct: 218 PSGTKMPAQPPPQQHPPPPQPQQIMSPMPPQAPPSQQATP 257 Score = 32.7 bits (71), Expect = 0.41 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 P PPP P P P PP PP P P P PP P Sbjct: 440 PGGSGAPPPGPPGAYPGNGAPG-GPPGGPPQFPG--HPGMDPNYHYYQQHGMMPPHPGHP 496 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P PPP P Sbjct: 497 GYPPQHMNAFSPGQYPGHQRPPGGPGGPPPGP 528 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P P P P P PP P P P P P P P Sbjct: 446 PPPGPPGAYPGNGAPGGPPGGPPQFPGHPGMDPNYHYYQQHGMMPPHPGHPGYP-PQHMN 504 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P PPP P Sbjct: 505 AFSPGQYPGHQRPPGGPGGPPPGP 528 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXX 975 P P P PP PP P PPP P P P P P Sbjct: 807 PRPPYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPAPPSRASAPTP 866 Query: 976 PP 981 P Sbjct: 867 QP 868 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PP PPP P P PP PP P P P Sbjct: 227 PPPQQHPPPPQPQQIMSPMPPQAPPSQQATPSSSAASVAAPDTP 270 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 4/60 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXP----XPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P PPP P P P P P P P P P Sbjct: 809 PPYPYPGGPVPPGPPQNRMPPPPPAQGAPSPSGAAGSNGKQPRYGTPAPPSRASAPTPQP 868 Score = 29.5 bits (63), Expect = 3.8 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 4/93 (4%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPP-PXXP---XPP 857 P P P P P P PP P P P P P P Sbjct: 681 PGEPTSSTPSDTPAPSTSVPPPTSVQPPQPQQPPQGPPGPPGPQQHPGPYPGYPGYGPPG 740 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P PPP P P P P P Sbjct: 741 AMRPPAGFAPPPGAPYGYPPGAPPPAGFHPSHP 773 >U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform b protein. Length = 781 Score = 56.0 bits (129), Expect = 4e-08 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 10/98 (10%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P PPP P P P P P P PPP PPPP PP P Sbjct: 571 PARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPP---PPPP--PPQSFGMAPI 625 Query: 823 XXXPPXPPPXPPP---------XPPPXPXPPPXXXXXP 909 P PPP PPP PPP P PPP P Sbjct: 626 SSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGP 663 Score = 54.4 bits (125), Expect = 1e-07 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 2/100 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPP P PPPP P P P PPP PPP P Sbjct: 558 PPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPP 617 Query: 868 PPXPXPPPXXXXXPXXPXPP--XXPPPXPXXPPPXPXXPP 981 P P P PP P PPP P PP Sbjct: 618 QSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPP 657 Score = 53.6 bits (123), Expect = 2e-07 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 8/88 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXPPXPXPPPPXX----PPPXPX 774 P PP P P P P P P P PP P PPPP P Sbjct: 571 PARPPPPP-PSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAA 629 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PPPP PP P PP PPP PP Sbjct: 630 PPPPPPPPPMGLPAVGAGAPPPPPPPPP 657 Score = 50.0 bits (114), Expect = 3e-06 Identities = 36/115 (31%), Positives = 36/115 (31%), Gaps = 5/115 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPX---PXPPXPXPPPPXXPP--PXPXPPPPXX 792 P P P PPPPP P P P P P P PPPP Sbjct: 555 PAAPPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPP 614 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP P P PPP PPP P P P PP PP P Sbjct: 615 PP----PQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAP--PPPPPPPPSGAGGP 663 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/97 (29%), Positives = 29/97 (29%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPPPP P P PP P PPP P Sbjct: 575 PPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPP-------PPPQSFGMAPISS 627 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPPP PP P PPP P PPP Sbjct: 628 AAPPPPPPPPPMG-------LPAVGAGAPPPPPPPPP 657 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P P PP P PP PPPP PP P Sbjct: 609 PPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLA 668 Query: 835 PXPP 846 PP Sbjct: 669 KLPP 672 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 11/68 (16%) Frame = +1 Query: 616 PPXXPPXXPX-----PXXPXPPPXPXXXXPPPPPXPXPX------PXPPXPXPPPPXXPP 762 PP PP P P PP P PPPPP P P PP P P P Sbjct: 609 PPPPPPPPPQSFGMAPISSAAPPPP----PPPPPMGLPAVGAGAPPPPPPPPPSGAGGPA 664 Query: 763 PXPXPPPP 786 PP Sbjct: 665 SVLAKLPP 672 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP PP P P PPPPP P P PP P P PP Sbjct: 609 PPPPPPPPPQSFGMAPISSAA-PPPPPPPPPMGLP----------AVGAGAPPPPPPPPP 657 >U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform a protein. Length = 607 Score = 56.0 bits (129), Expect = 4e-08 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 10/98 (10%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P PPP P P P P P P PPP PPPP PP P Sbjct: 397 PARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPP---PPPP--PPQSFGMAPI 451 Query: 823 XXXPPXPPPXPPP---------XPPPXPXPPPXXXXXP 909 P PPP PPP PPP P PPP P Sbjct: 452 SSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGP 489 Score = 54.4 bits (125), Expect = 1e-07 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 2/100 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPP P PPPP P P P PPP PPP P Sbjct: 384 PPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPP 443 Query: 868 PPXPXPPPXXXXXPXXPXPP--XXPPPXPXXPPPXPXXPP 981 P P P PP P PPP P PP Sbjct: 444 QSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPP 483 Score = 53.6 bits (123), Expect = 2e-07 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 8/88 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXPPXPXPPPPXX----PPPXPX 774 P PP P P P P P P P PP P PPPP P Sbjct: 397 PARPPPPP-PSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPPPPPQSFGMAPISSAA 455 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPP 858 PPPP PP P PP PPP PP Sbjct: 456 PPPPPPPPPMGLPAVGAGAPPPPPPPPP 483 Score = 50.0 bits (114), Expect = 3e-06 Identities = 36/115 (31%), Positives = 36/115 (31%), Gaps = 5/115 (4%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPX---PXPPXPXPPPPXXPP--PXPXPPPPXX 792 P P P PPPPP P P P P P P PPPP Sbjct: 381 PAAPPPPTRVESHGLAPARPPPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPP 440 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP P P PPP PPP P P P PP PP P Sbjct: 441 PP----PQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAP--PPPPPPPPSGAGGP 489 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/97 (29%), Positives = 29/97 (29%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPPPP P P PP P PPP P Sbjct: 401 PPPPPSSGTRGIAPSRPLPQAPNYGTPENRPHAVPPPPPP-------PPPQSFGMAPISS 453 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPPP PP P PPP P PPP Sbjct: 454 AAPPPPPPPPPMG-------LPAVGAGAPPPPPPPPP 483 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P P PP P PP PPPP PP P Sbjct: 435 PPPPPPPPPQSFGMAPISSAAPPPPPPPPPMGLPAVGAGAPPPPPPPPPSGAGGPASVLA 494 Query: 835 PXPP 846 PP Sbjct: 495 KLPP 498 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 11/68 (16%) Frame = +1 Query: 616 PPXXPPXXPX-----PXXPXPPPXPXXXXPPPPPXPXPX------PXPPXPXPPPPXXPP 762 PP PP P P PP P PPPPP P P PP P P P Sbjct: 435 PPPPPPPPPQSFGMAPISSAAPPPP----PPPPPMGLPAVGAGAPPPPPPPPPSGAGGPA 490 Query: 763 PXPXPPPP 786 PP Sbjct: 491 SVLAKLPP 498 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPP 803 PP PP P P PPPPP P P PP P P PP Sbjct: 435 PPPPPPPPPQSFGMAPISSAA-PPPPPPPPPMGLP----------AVGAGAPPPPPPPPP 483 >Z95559-1|CAB08999.1| 289|Caenorhabditis elegans Hypothetical protein Y41E3.2 protein. Length = 289 Score = 55.6 bits (128), Expect = 5e-08 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 2/119 (1%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXP-XXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P P P P P P PP P P Sbjct: 97 PQGTPGKPGKPGKPGAPGQPGTPGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGIPGDNG 156 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P P P P P P P PP P P P P PP P Sbjct: 157 PPGEQGP----KGPDAAPGEPGPKGPIGPPGPPGQAGAPGEPGSPAKSEPAVPGPPGPP 211 Score = 54.0 bits (124), Expect = 2e-07 Identities = 37/124 (29%), Positives = 37/124 (29%), Gaps = 7/124 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P PP P P P P P P PP P P PP Sbjct: 101 PGKPGKPGKPGAPGQPGTPGR--PPQQPCEPTTPPPCQPCPQGPPGPPGQPGIPGDNGPP 158 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPX-------PPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P PP P P P P PP P Sbjct: 159 GEQGPKGPDAAPGEPGPKGPIGPPGPPGQAGAPGEPGSPAKSEPAVPGPPGPPGQAGQQG 218 Query: 958 PPXP 969 PP P Sbjct: 219 PPGP 222 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 6/109 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX----PPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P Sbjct: 119 PGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGEPGPKGP 178 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP--PPXXXXXPXXPXPP 927 PP PP P P P P P P PP P PP Sbjct: 179 IGPPG----PPGQAGAPGEPGSPAKSEPAVPGPPGPPGQAGQQGPPGPP 223 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/113 (29%), Positives = 33/113 (29%), Gaps = 6/113 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPP----XPXXXXPPPPPXP-XPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P PP P P P P P P PP P Sbjct: 129 PTTPPPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGEPGPKGPIGPPGPPGQA 188 Query: 781 -PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P P PP PP PP P P P P Sbjct: 189 GAPGEPGSPAKSEPAVPGPPGPPGQAGQQGPPGPPGSNGIDGAPGAPGAKGEP 241 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/93 (27%), Positives = 26/93 (27%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P PP P PPP P PP P Sbjct: 92 PGPQGPQGTPGKPGKPGKPGAPGQPGTPGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGI 151 Query: 871 PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P PP P Sbjct: 152 PGDNGPPGEQGPKGPDAAPGEPGPKGPIGPPGP 184 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXP 947 P P P P P PPP P P PP PP P P PP P P P Sbjct: 116 PGTPGRPPQQPCEPTT--PPPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGEP 173 Query: 948 XXPPPXPXPPPP 983 P P PP Sbjct: 174 GPKGPIGPPGPP 185 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPP--PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P PP P P P P P PP P Sbjct: 92 PGPQGPQGTPGKPGKPGKPGAPGQPGTPGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGI 151 Query: 975 P 977 P Sbjct: 152 P 152 Score = 35.1 bits (77), Expect = 0.077 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 1/109 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 116 PGTPGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGEPGP 175 Query: 795 XPP-XPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P P P P P PP PP P PP Sbjct: 176 KGPIGPPGPPGQAGAPGEPG-SPAKSEPAVPGPPGPPGQAGQQGPPGPP 223 Score = 34.7 bits (76), Expect = 0.10 Identities = 31/122 (25%), Positives = 31/122 (25%), Gaps = 3/122 (2%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPX 806 P P P P P P PP P P P Sbjct: 104 PGKPGKPGAPGQPGTPGRPPQQPCEPTTPPPCQPCPQGPPGPPGQPGIPGDNGP-PGEQG 162 Query: 807 PXXPXXXX--PPPXXPXPPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P P P PP PP P P P P P PP P P Sbjct: 163 PKGPDAAPGEPGPKGPIGPPGPPGQAGAPGEPGSPAKSEP-AVPGPPGPPGQAGQQGPPG 221 Query: 978 PP 983 PP Sbjct: 222 PP 223 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXP-PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 P P P P P P P P PP P P PP P P P P P Sbjct: 92 PGPQGPQGTPGKPGKPGKPGAPGQPGTPGRPPQQPCEPTTPP-----PCQPCPQGPPGPP 146 Query: 946 PXXPPPXPXXPP 981 P PP Sbjct: 147 GQPGIPGDNGPP 158 Score = 31.1 bits (67), Expect = 1.3 Identities = 27/115 (23%), Positives = 27/115 (23%), Gaps = 1/115 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXX-PPXPX 791 P PP P P P PP P P PP Sbjct: 129 PTTPPPCQPCPQGPPGPPGQPGIPGDNGPPGEQGPKGPDAAPGEPGPKGPIGPPGPPGQA 188 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P PP P PP PP P P P Sbjct: 189 GAPGEPGSPAKSEPA--VPGPPGPPGQAGQQGPPGPPGSNGIDGAPGAPGAKGEP 241 Score = 31.1 bits (67), Expect = 1.3 Identities = 26/106 (24%), Positives = 26/106 (24%), Gaps = 2/106 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PP PP P P P P P PP P Sbjct: 157 PPGEQGPKGPDAAPGEPGPKGPIGPPGPPGQAGAPGEPG---SPAKSEPAVPGPPGPPGQ 213 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP P P P P P P P Sbjct: 214 AGQQGPPGPPGSNGIDGAPGAPGAKGEPGTPGEPGKDGEPGKPGTP 259 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPX-PXPPPP 983 P P P P P P P P P P P P PPP P P P Sbjct: 92 PGPQGPQGTPGKPGKPGKPGA-PGQPGTPGRPPQQPCEPTTPPPCQPCPQGP 142 >Z83227-3|CAB05726.2| 241|Caenorhabditis elegans Hypothetical protein F45B8.3 protein. Length = 241 Score = 55.6 bits (128), Expect = 5e-08 Identities = 36/102 (35%), Positives = 36/102 (35%), Gaps = 7/102 (6%) Frame = +1 Query: 694 PPPXPXPXPX-PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P PP P PPPP PP P P P PPP P PPP PPP P Sbjct: 74 PRPSPSCCPYVPPAPLPPPP--PPASPCCGPSPVPAPCCPPPPAPAAPCCPPP-PPPTPS 130 Query: 871 P------XPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P PP P P P P Sbjct: 131 PLVCCKQAPVPENPCCQIVAAAMPPPPSAPACCVAAPVPTNP 172 Score = 54.4 bits (125), Expect = 1e-07 Identities = 35/112 (31%), Positives = 35/112 (31%), Gaps = 4/112 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP----PPXPXPPP 783 P P P P P PPP P PPPP P P P P P P PPP Sbjct: 98 PCCGPSPVPAPCCP-PPPAPAAPCCPPPPPPTPSPLVCCKQAPVPENPCCQIVAAAMPPP 156 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P Sbjct: 157 PSAPACCVAAPVPTNPCCQPAPRPAPCVCSAPRPVPCRCGAPPMECPNCDMP 208 Score = 54.0 bits (124), Expect = 2e-07 Identities = 35/98 (35%), Positives = 35/98 (35%), Gaps = 6/98 (6%) Frame = +1 Query: 688 PPPPPXPXPX-PXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P P P P P P P PPPP P P P P P PP P PP PPP P P Sbjct: 74 PRPSPSCCPYVPPAPLPPPPPPASPCCGPSPVPAPCCPP--PPAPAAPCCPPPPPPTPSP 131 Query: 862 ----XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P PP P P P Sbjct: 132 LVCCKQAPVPENPCCQIVAAAMPPPPSAPACCVAAPVP 169 Score = 54.0 bits (124), Expect = 2e-07 Identities = 35/111 (31%), Positives = 35/111 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P PPP P P P P PP P P P PP PPPP Sbjct: 78 PSCCPYVPPAPLPPPPPPASPCCGPSPVPAPC---CPPPPAPAAPCCPP----PPPPTPS 130 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P PPP P P P P P P P Sbjct: 131 PLVCCKQAPVPENPCCQIVAAAMPPP-PSAPACCVAAPVPTNPCCQPAPRP 180 Score = 53.2 bits (122), Expect = 3e-07 Identities = 38/120 (31%), Positives = 38/120 (31%), Gaps = 6/120 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX--PPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P P P P P PPPP P P PP P P P P P P Sbjct: 85 PPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPTPSPLVCCKQAPVPENP 144 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 PP P P P P P P P P P P P P P Sbjct: 145 CCQIVAAAMPPPPSAPACCVAAPVPTNPCCQPAPRPAPCVCSAP-RPVPCRCGAPPMECP 203 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/93 (27%), Positives = 26/93 (27%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPPPP P P P P P PP P P P Sbjct: 90 PPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPTPSPLVCCKQAPVPENPCCQIV 149 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 PPPP P P P P P P P Sbjct: 150 AAAMPPPPSAPACCVAAPVPTNPCCQPAPRPAP 182 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PP P PPP PP P P P P P P P PPP P P Sbjct: 74 PRPSPSCCPYVPPA-PLPPPPPPASPCCGPSPVPAPCCPPPPA--PAAPCCPPPPPPTPS 130 Query: 981 P 983 P Sbjct: 131 P 131 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PP P P P P P P PP P P PP PP Sbjct: 94 PPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPP 126 Score = 37.5 bits (83), Expect = 0.014 Identities = 31/125 (24%), Positives = 31/125 (24%), Gaps = 2/125 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPP--PXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P PP P P P P PP P P PP P P Sbjct: 88 PLPPPPPPASPCCGPSPVPAPCCPPPPAPAAPCCPPPPPPTPSPLVCCKQAPVPENPCCQ 147 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P Sbjct: 148 IVAAAMP--PPPSAPACCVAAPVPTNPCCQPAPRPAPCVCSAPRPVPCRCGAPPMECPNC 205 Query: 969 XPPPP 983 P P Sbjct: 206 DMPAP 210 >Z73102-2|CAB63428.1| 341|Caenorhabditis elegans Hypothetical protein B0035.1b protein. Length = 341 Score = 55.6 bits (128), Expect = 5e-08 Identities = 34/97 (35%), Positives = 34/97 (35%), Gaps = 7/97 (7%) Frame = +1 Query: 619 PXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPX 789 P P P P P P P PPPP P P PP P P P PP Sbjct: 109 PPMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPA 168 Query: 790 XPPXXXXPPPXXXXPPXPPPXP----PPXPPPXPXPP 888 P PPP PP P PP PP P PP Sbjct: 169 PAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMPGPP 205 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/110 (33%), Positives = 37/110 (33%), Gaps = 6/110 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP----PPPXXP 795 P P P P PPP PP P P P PPP PP P P PPP P Sbjct: 124 PGMPPMPSGP-PPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY-PPAPAPGVYMPPPGMP 181 Query: 796 PXXXXP-PPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P PP PP P PP P P P PP Sbjct: 182 GAYPPPRMPIGHGPPGGPPMPGPPQRSRFDQPDGGDRWGPPMRGVPRTPP 231 Score = 49.6 bits (113), Expect = 3e-06 Identities = 31/95 (32%), Positives = 31/95 (32%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P P P P P P PP P PPP P P PP P P P Sbjct: 109 PPMPTPMPFPQH-FPFPGM--PPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY 165 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PPP P PP Sbjct: 166 PPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPP 200 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/98 (32%), Positives = 32/98 (32%), Gaps = 1/98 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P PP P PPP P PP PP PP P Sbjct: 110 PMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAP 169 Query: 868 PPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P PP P PP P P PP P P Sbjct: 170 APGVYMPP--PGMPGAYPPPRMPIGHGPPGGPPMPGPP 205 Score = 48.0 bits (109), Expect = 1e-05 Identities = 38/103 (36%), Positives = 38/103 (36%), Gaps = 8/103 (7%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPX-PPXPXPPPPXXPPPXPXPPPPXXPPXXXXP---PPXXXX 831 PP P P P P P P PP P PPP P P P P PP Sbjct: 109 PPMPT---PMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY 165 Query: 832 PPXPPPX---PPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXP 948 PP P P PPP P PPP P PP PP P P Sbjct: 166 PPAPAPGVYMPPPGMP-GAYPPP---RMPIGHGPPGGPPMPGP 204 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPP--PXXPPPXPXPPPP 786 PP P P P P P P P P P P PPP P P PP P Sbjct: 143 PPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMP 202 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P PP P PP Sbjct: 203 GPPQRSRFDQPDGGDRWGPPMRGVPRTPP 231 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 5/97 (5%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXP 800 PP P P P P PPPP P PP P Sbjct: 109 PPMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPA 168 Query: 801 PXPXXPXXXXPPPXXP--XPPPXPPXXPXPP--PPXP 899 P P PPP P PPP P PP PP P Sbjct: 169 P---APGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMP 202 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 4/73 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPX----PPXXXXPXPXPXPPXX 944 PP P P P PP P P P P P P PP P P P Sbjct: 133 PPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIG 192 Query: 945 PXXPPPXPXPPPP 983 P P P PP Sbjct: 193 HGPPGGPPMPGPP 205 >Z73102-1|CAA97419.1| 298|Caenorhabditis elegans Hypothetical protein B0035.1a protein. Length = 298 Score = 55.6 bits (128), Expect = 5e-08 Identities = 34/97 (35%), Positives = 34/97 (35%), Gaps = 7/97 (7%) Frame = +1 Query: 619 PXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPX 789 P P P P P P P PPPP P P PP P P P PP Sbjct: 109 PPMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPA 168 Query: 790 XPPXXXXPPPXXXXPPXPPPXP----PPXPPPXPXPP 888 P PPP PP P PP PP P PP Sbjct: 169 PAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMPGPP 205 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/110 (33%), Positives = 37/110 (33%), Gaps = 6/110 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP----PPPXXP 795 P P P P PPP PP P P P PPP PP P P PPP P Sbjct: 124 PGMPPMPSGP-PPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY-PPAPAPGVYMPPPGMP 181 Query: 796 PXXXXP-PPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P PP PP P PP P P P PP Sbjct: 182 GAYPPPRMPIGHGPPGGPPMPGPPQRSRFDQPDGGDRWGPPMRGVPRTPP 231 Score = 49.6 bits (113), Expect = 3e-06 Identities = 31/95 (32%), Positives = 31/95 (32%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P P P P P P PP P PPP P P PP P P P Sbjct: 109 PPMPTPMPFPQH-FPFPGM--PPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY 165 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PPP P PP Sbjct: 166 PPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPP 200 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/98 (32%), Positives = 32/98 (32%), Gaps = 1/98 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P PP P PPP P PP PP PP P Sbjct: 110 PMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAP 169 Query: 868 PPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P PP P PP P P PP P P Sbjct: 170 APGVYMPP--PGMPGAYPPPRMPIGHGPPGGPPMPGPP 205 Score = 48.0 bits (109), Expect = 1e-05 Identities = 38/103 (36%), Positives = 38/103 (36%), Gaps = 8/103 (7%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPX-PPXPXPPPPXXPPPXPXPPPPXXPPXXXXP---PPXXXX 831 PP P P P P P P PP P PPP P P P P PP Sbjct: 109 PPMPT---PMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGY 165 Query: 832 PPXPPPX---PPPXPPPXPXPPPXXXXXPXXPXPPXXPP-PXP 948 PP P P PPP P PPP P PP PP P P Sbjct: 166 PPAPAPGVYMPPPGMP-GAYPPP---RMPIGHGPPGGPPMPGP 204 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPP--PXXPPPXPXPPPP 786 PP P P P P P P P P P P PPP P P PP P Sbjct: 143 PPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMP 202 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P PP P PP Sbjct: 203 GPPQRSRFDQPDGGDRWGPPMRGVPRTPP 231 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 5/97 (5%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXP 800 PP P P P P PPPP P PP P Sbjct: 109 PPMPTPMPFPQHFPFPGMPPMPSGPPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPA 168 Query: 801 PXPXXPXXXXPPPXXP--XPPPXPPXXPXPP--PPXP 899 P P PPP P PPP P PP PP P Sbjct: 169 P---APGVYMPPPGMPGAYPPPRMPIGHGPPGGPPMP 202 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 4/73 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPX----PPXXXXPXPXPXPPXX 944 PP P P P PP P P P P P P PP P P P Sbjct: 133 PPPPSMAYGMPPMPSGMMPPRGMPGAYPPPRGYPPAPAPGVYMPPPGMPGAYPPPRMPIG 192 Query: 945 PXXPPPXPXPPPP 983 P P P PP Sbjct: 193 HGPPGGPPMPGPP 205 >Z70284-9|CAA94280.1| 290|Caenorhabditis elegans Hypothetical protein K07F5.11 protein. Length = 290 Score = 55.6 bits (128), Expect = 5e-08 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 3/115 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXX 804 GG G GG G GG G G GG GG G Sbjct: 166 GGAPGEASTMTAVGGAPRGASTMTAVGAPGGGASALGAAPPAGSMSGGGGGGGATSGYFG 225 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG--GGXXXXGXGGGXGXXG 645 G GGGG G GG GG G G GGG G G GGG G G Sbjct: 226 VGQGVMGGGGAVGQSAYFGVGGGAAGGAKSGGGGGGGIPGQSMYMGAGGGGGAGG 280 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/93 (36%), Positives = 34/93 (36%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G GG G G G GGG G G G GGG G G G G Sbjct: 192 GAPGGGASALGAAPPAGSMSGGGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAG 251 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G GGG G G G G GGG G GGG Sbjct: 252 GAKSGGGGGGGIPGQSMYMGAGGG---GGAGGG 281 Score = 46.0 bits (104), Expect = 4e-05 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 3/70 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG---GXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GGGGG G G G G G G G GGG G GGG G G G Sbjct: 212 GGGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGAKSGGGGGGGIPGQSMYMG 271 Query: 814 XXGXGGXGXG 785 G GG G G Sbjct: 272 AGGGGGAGGG 281 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/79 (37%), Positives = 30/79 (37%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G GG G G G G G GG G GGG GG Sbjct: 214 GGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGAKSGGGGG--------GGIPG 265 Query: 800 XGGXXGGGGXGXGGGXXGG 744 G GG GGG GG Sbjct: 266 QSMYMGAGG---GGGAGGG 281 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 5/96 (5%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G GG GG G G G G GGGG G Sbjct: 7 GVAGGSNTGAQSAYFGVGGGPAGGGGGASKVGGAGAPPPGTSVYMGAGAGGGGGGGAQSA 66 Query: 755 XXGGGGXGXGGXGXGXGXG-----GGGGXXXXGXGG 663 GG GG G GGG GG Sbjct: 67 YFAVGGAPVGGAPAAVPMGAPPPAGGGASTMTALGG 102 Score = 36.3 bits (80), Expect = 0.033 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G GGG GG GG GG G G G G GGGG G G GG Sbjct: 22 GVGGGPAGGGGGASKVGGA----GAPPPGTSVYMGAGAGGGGGGGAQSAYFAVGGAPVGG 77 Query: 686 XXXXGXGGGXGXXGXG 639 G G G Sbjct: 78 APAAVPMGAPPPAGGG 93 Score = 35.9 bits (79), Expect = 0.044 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 5/107 (4%) Frame = -3 Query: 968 GXGGGXXGXGGGXX--GGXGXXGXXXXXGGGXGXGGGXGGGXGG---GXGGXXXXGGGXX 804 G GGG G GGG GG G G G GGG GGG GG G Sbjct: 22 GVGGGPAGGGGGASKVGGAGAPPPGTSVYMGAGAGGGGGGGAQSAYFAVGGAPVGGAPAA 81 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G G GG G G GG Sbjct: 82 VPMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRGASTMTAVGG 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 3/85 (3%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG---XGXGXGX 702 G G GG GG G G GGG G G G Sbjct: 154 GAPTGASTMTAVGGAPGEASTMTAVGGAPRGASTMTAVGAPGGGASALGAAPPAGSMSGG 213 Query: 701 GGGGGXXXXGXGGGXGXXGXGXXGG 627 GGGGG G G G G G G Sbjct: 214 GGGGGATSGYFGVGQGVMGGGGAVG 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 GGGGG GG G G GG GGG GG Sbjct: 29 GGGGGASKVGGAGAPPPGTSVYMGAGAGGGGGGGAQSAYFAVGG 72 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G GGG G G G G GGG G G G G GG G G Sbjct: 208 GSMSGGGGGGGATSGYFGVGQGVMG----GGGAVGQSAYFGVGGGAAGGAKSGGGGGG 261 Score = 29.9 bits (64), Expect = 2.9 Identities = 28/113 (24%), Positives = 28/113 (24%), Gaps = 2/113 (1%) Frame = -3 Query: 947 GXGGGXXGGX--GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G GG G G GG G GG G G G GG Sbjct: 7 GVAGGSNTGAQSAYFGVGGGPAGGGGGASKVGGAGAPPPGTSVYMGAGAGGGGGGGAQSA 66 Query: 773 XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GG G GGG G G GG G Sbjct: 67 YFAVGGAPVGGAPAAVPMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRG 119 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 982 GGGGXGXGGG--XXGXXGGXGXGXGXXXXGGXGGGGXG 875 GGG G GGG G G G G GGGG G Sbjct: 24 GGGPAGGGGGASKVGGAGAPPPGTSVYMGAGAGGGGGG 61 >Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical protein T24B8.4 protein. Length = 866 Score = 55.6 bits (128), Expect = 5e-08 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPP-PXPXPXPXP--PXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P PPP P PPPP P P P P PPPP P PPP P Sbjct: 59 PKPSFFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPP 118 Query: 811 PPPXXXXPPXPPPXPPPXPP 870 PP P PP P P Sbjct: 119 PPSGLGVAPQPPRPKTPVNP 138 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 1/85 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP-XXXXPPPXXXXPPXPPP 849 P PP P P P P P PPP P PP P PPP PPP Sbjct: 48 PSGILPPGQSIPKPSFFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPP 107 Query: 850 XPPPXPPPXPXPPPXXXXXPXXPXP 924 P PP P PP P P P Sbjct: 108 PPMFGAPPPPPPPSGLGVAPQPPRP 132 Score = 51.2 bits (117), Expect = 1e-06 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 3/77 (3%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP---XPXPPPPXXPPXXXXPPPXXXXPP 837 P P PPP P P PP P PP PPP PPPP PPP PP Sbjct: 59 PKPSFFIPPPVPNGF-IPPPPGPGGIPP--PPPMFAGGIPPPPPMMGGIPPPPPMFGAPP 115 Query: 838 XPPPXPPPXPPPXPXPP 888 PPP P P P Sbjct: 116 PPPPPSGLGVAPQPPRP 132 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 5/90 (5%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP-----XPPPXPPPXPXPP 888 P PP P P PPP P PPP P PPP PPP P PP Sbjct: 48 PSGILPPGQSIPKPSFFIPPPV-PNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPP 106 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P PP PPP P P P Sbjct: 107 P----PPMFGAPPPPPPPSGLGVAPQPPRP 132 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/74 (36%), Positives = 27/74 (36%), Gaps = 5/74 (6%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPX---PPPXPPPXPXPPPXXXXX--PXXPXPPXXPP 939 PP PP P P PP P PPP P P PPP P P PP Sbjct: 47 PPSGILPPGQSIPKPSFFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPP 106 Query: 940 PXPXXPPPXPXXPP 981 P P P P PP Sbjct: 107 PPPMFGAPPPPPPP 120 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 5/77 (6%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPPPXX 792 PP P P PPP P PPPP P PP P PPP PP PPPP Sbjct: 66 PPPVPNGFIP-PPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPP---PPPPPS 121 Query: 793 PPXXXXPPPXXXXPPXP 843 PP P P Sbjct: 122 GLGVAPQPPRPKTPVNP 138 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 777 PPXPXPXPPXPXX--PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P PP P PPP PP PP PPPP PP P P P P Sbjct: 77 PPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAPQPPRPKTPV 136 Query: 951 XP 956 P Sbjct: 137 NP 138 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 10/70 (14%) Frame = +1 Query: 616 PPXXP----PXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP----- 765 PP P P P P P PPP PPPPP P PP PP PPP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGV 125 Query: 766 XPXPPPPXXP 795 P PP P P Sbjct: 126 APQPPRPKTP 135 Score = 46.8 bits (106), Expect = 2e-05 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 12/85 (14%) Frame = +1 Query: 724 PPXPXPPPPXX--PPPXPX---PPPPXXPPXXXXPPPXXXXPPXPPPXPP----PXPPP- 873 PP P P PPP P PPPP P PPP PPP P P PPP Sbjct: 53 PPGQSIPKPSFFIPPPVPNGFIPPPPG--PGGIPPPPPMFAGGIPPPPPMMGGIPPPPPM 110 Query: 874 --XPXPPPXXXXXPXXPXPPXXPPP 942 P PPP P PP P Sbjct: 111 FGAPPPPPPPSGLGVAPQPPRPKTP 135 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 4/71 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXX---PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP 947 PP P P P P PPP PPP P PPP PP P P P P Sbjct: 67 PPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPP--PPMFGAPPPPPPPSGLG 124 Query: 948 XXP-PPXPXPP 977 P PP P P Sbjct: 125 VAPQPPRPKTP 135 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 8/64 (12%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPP-----PXPPXXXXPXPXPXPPXXPXXPPPXP---X 971 P P P PPP P PPP P PP P PP PPP P Sbjct: 54 PGQSIPKPSFFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGA 113 Query: 972 PPPP 983 PPPP Sbjct: 114 PPPP 117 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 4/97 (4%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 P P P P P PPPP P PP P P P PP Sbjct: 59 PKPSFFIPPPVPNGFIPPPPG--PGGIPPPPPMFAGGIP--PPPPMMGGIP--------- 105 Query: 872 XXXXPPPXPXXXPXPPPXP----XXPXPPXPXPPXXP 970 PPP P PPP P P PP P P P Sbjct: 106 ----PPPPMFGAPPPPPPPSGLGVAPQPPRPKTPVNP 138 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 9/77 (11%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPX----XPXPPPXPPXXPXPPP-----PXPPXXXXPXPXPX 932 P P P P PPP P PP P PPP P PP P P Sbjct: 59 PKPSFFIPPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPP 118 Query: 933 PPXXPXXPPPXPXPPPP 983 PP P P P P Sbjct: 119 PPSGLGVAPQPPRPKTP 135 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/88 (30%), Positives = 27/88 (30%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P PPP P PP P PP PP P P Sbjct: 59 PKPSFFIPPPVPNGFIPPPPGPGGIPPPPP-------MFAGGIPPPPPMMGGIPPPP--P 109 Query: 819 XXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PPP P PP P PP P P Sbjct: 110 MFGAPPP--PPPPSGLGVAPQPPRPKTP 135 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P P PP P P PPPPP P P Sbjct: 80 PGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPP 117 >U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific family, class qprotein 3 protein. Length = 265 Score = 55.6 bits (128), Expect = 5e-08 Identities = 38/102 (37%), Positives = 38/102 (37%), Gaps = 4/102 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXX--GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GGG GG GGG G GG G G G G G Sbjct: 152 GGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGG-GGATSAYFGVGSGAMGGGGAGA 210 Query: 806 XXXGGXXGGG--GXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G GG GGGG G G G GGGGG Sbjct: 211 QSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGG 252 Score = 52.4 bits (120), Expect = 5e-07 Identities = 40/113 (35%), Positives = 40/113 (35%), Gaps = 2/113 (1%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGX--GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G GG G GG G GGG GGG G G GGGG Sbjct: 153 GAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVG-----SGAMGGGG 207 Query: 773 XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG GG G G GGGGG G G G G GG GG Sbjct: 208 AGAQSAYFGVGGGPVGGGGGGAKSGGGGG----GIPGQSVYMGAGGGGGGGGG 256 Score = 52.4 bits (120), Expect = 5e-07 Identities = 39/99 (39%), Positives = 39/99 (39%), Gaps = 1/99 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG G G G G GGG G GGG Sbjct: 166 GGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVGS--GAMGGGGAGAQSAYFGVGGGPV- 222 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 GG GGGG GGG GGG G G G G GGGGG Sbjct: 223 -GG--GGGGAKSGGG--GGGIPGQSVYMGAGGGGGGGGG 256 Score = 51.6 bits (118), Expect = 8e-07 Identities = 35/122 (28%), Positives = 35/122 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG GG G GG GG GG Sbjct: 112 GAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRGVSTMTAVGGAPGGASTMTAMGGGPSAF 171 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G G GGG GG G G G GGG G G G G G G G Sbjct: 172 GGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKS 231 Query: 620 GG 615 GG Sbjct: 232 GG 233 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG--- 815 GGGGG G G G G G G G G GG GGG GGG G Sbjct: 184 GGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGGGGGGIPGQSV 243 Query: 814 XXGXGGXGXGXGG 776 G GG G G GG Sbjct: 244 YMGAGGGGGGGGG 256 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 1/100 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG-XGXXGGXGGGXGXXGGGXXXXGXX 809 GG GG GG GG GGGG G G G GG Sbjct: 156 GGASTMTAMGGGPSAFGGAPPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYF 215 Query: 808 GXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G GG G GG G G GGGGG Sbjct: 216 GVGGGPVGGGGGGAKSGGGGGGIPGQSVYMGAGGGGGGGG 255 Score = 30.3 bits (65), Expect = 2.2 Identities = 28/122 (22%), Positives = 28/122 (22%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG GG GG GG Sbjct: 85 GGAPSGASTMTAIGGAPRGASTMTAVGGAPMGGSSTMTAVGGAPIGGSSTMTAVGGAPRG 144 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 GG G G G G G G GGG G G Sbjct: 145 VSTMTAVGGAPGGASTMTAMGGGPSAFGGAPPPPSGSAMGG-GGGGGATSAYFGVGSGAM 203 Query: 620 GG 615 GG Sbjct: 204 GG 205 >Z74472-4|CAA98942.1| 301|Caenorhabditis elegans Hypothetical protein F23H12.4 protein. Length = 301 Score = 55.2 bits (127), Expect = 7e-08 Identities = 40/130 (30%), Positives = 40/130 (30%), Gaps = 9/130 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX-PPPXPXPPPPXXP 795 P PP P PP P PP PP P P P P P P P P Sbjct: 131 PGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGP 190 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP----PPXPXXP 957 P P P P P P P P P P PP P PP P P Sbjct: 191 PGPAGEAGAPGPAGEPGTPAISEPLTPGAPG-EPGDSGPPGPPGPPGAPGNDGPPGPPGP 249 Query: 958 --PPXPXXPP 981 P P PP Sbjct: 250 KGAPGPDGPP 259 Score = 51.6 bits (118), Expect = 8e-07 Identities = 42/132 (31%), Positives = 42/132 (31%), Gaps = 15/132 (11%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P P P P P PP P P P P P PP P PP P Sbjct: 109 PAGAPGKPGKPGRPGAPGTP--GTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGD 166 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPP-------PXPXPPPXXXXXPXXPXPPXXP--- 936 P P P P P P PP P P P P P P P Sbjct: 167 PGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDS 226 Query: 937 -PPXPXXPPPXP 969 PP P PP P Sbjct: 227 GPPGPPGPPGAP 238 Score = 51.6 bits (118), Expect = 8e-07 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 6/121 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P P P P P P P P P P Sbjct: 141 PTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAP 200 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP 957 P P P P P P PP P PP P PP P P P Sbjct: 201 GPAGEP--GTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGP 258 Query: 958 P 960 P Sbjct: 259 P 259 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/120 (29%), Positives = 35/120 (29%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P PPP P P PP P PP Sbjct: 104 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVA-PCEPTTPPPCKPCPQ-GPPGPPGPP 161 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P PP P P P P P P Sbjct: 162 GAPGDPGEAGTPGRPGTDAAPGSP-GPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAP 220 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 8/105 (7%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P PP P PPP P PP PP PP Sbjct: 104 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPP--GPPGPP 161 Query: 871 PXPXPP--------PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P Sbjct: 162 GAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEP 206 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 8/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P PP P P P Sbjct: 151 PQGPPGPPGP--PGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGT 208 Query: 796 PXXXXP-------PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P PP PP P P PP P PP Sbjct: 209 PAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGPPGVDGQSGPP 268 Query: 955 PPPXPXXPP 981 PP P P Sbjct: 269 GPPGPAGTP 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 128 PGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGP 187 Query: 795 -XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 PP P P P P P P P P P PP P P P Sbjct: 188 RGPPGPAGEAGAPGPAGEPGTPAISEPL-TPGAPGEPGDSGPPGPPGPPGAPGNDGP-PG 245 Query: 972 PPPP 983 PP P Sbjct: 246 PPGP 249 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P PP P P PP P P Sbjct: 190 PPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGP 249 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPP 873 P PP PP P P P Sbjct: 250 KGAPGPDGPPGVDGQSGPPGPPGPAGTP 277 Score = 35.1 bits (77), Expect = 0.077 Identities = 30/123 (24%), Positives = 30/123 (24%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P PP P Sbjct: 157 PPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLT 216 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP PP P P P P P P P P Sbjct: 217 -PGAPGEPGDSGPPG-----PPGPPGAPGNDGPPGPPGPKGAPGPDGPPGVDGQSGPPGP 270 Query: 975 PPP 983 P P Sbjct: 271 PGP 273 >V00147-1|CAA23463.1| 296|Caenorhabditis elegans protein ( Caenorhabditis elegansgene Col-1 coding for a collagen. ). Length = 296 Score = 55.2 bits (127), Expect = 7e-08 Identities = 40/130 (30%), Positives = 40/130 (30%), Gaps = 9/130 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX-PPPXPXPPPPXXP 795 P PP P PP P PP PP P P P P P P P P Sbjct: 126 PGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGP 185 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP----PPXPXXP 957 P P P P P P P P P P PP P PP P P Sbjct: 186 PGPAGEAGAPGPAGEPGTPAISEPLTPGAPG-EPGDSGPPGPPGPPGAPGNDGPPGPPGP 244 Query: 958 --PPXPXXPP 981 P P PP Sbjct: 245 KGAPGPDGPP 254 Score = 51.6 bits (118), Expect = 8e-07 Identities = 42/132 (31%), Positives = 42/132 (31%), Gaps = 15/132 (11%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P P P P P PP P P P P P PP P PP P Sbjct: 104 PAGAPGKPGKPGRPGAPGTP--GTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGD 161 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPP-------PXPXPPPXXXXXPXXPXPPXXP--- 936 P P P P P P PP P P P P P P P Sbjct: 162 PGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDS 221 Query: 937 -PPXPXXPPPXP 969 PP P PP P Sbjct: 222 GPPGPPGPPGAP 233 Score = 51.6 bits (118), Expect = 8e-07 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 6/121 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P P P P P P P P P P Sbjct: 136 PTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAP 195 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP 957 P P P P P P PP P PP P PP P P P Sbjct: 196 GPAGEP--GTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGP 253 Query: 958 P 960 P Sbjct: 254 P 254 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/120 (29%), Positives = 35/120 (29%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P PPP P P PP P PP Sbjct: 99 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVA-PCEPTTPPPCKPCPQ-GPPGPPGPP 156 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P PP P P P P P P Sbjct: 157 GAPGDPGEAGTPGRPGTDAAPGSP-GPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAP 215 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 8/105 (7%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P PP P PPP P PP PP PP Sbjct: 99 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPP--GPPGPP 156 Query: 871 PXPXPP--------PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P Sbjct: 157 GAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEP 201 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 8/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P PP P P P Sbjct: 146 PQGPPGPPGP--PGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGT 203 Query: 796 PXXXXP-------PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P PP PP P P PP P PP Sbjct: 204 PAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGPPGADGQSGPP 263 Query: 955 PPPXPXXPP 981 PP P P Sbjct: 264 GPPGPAGTP 272 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 123 PGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGP 182 Query: 795 -XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 PP P P P P P P P P P PP P P P Sbjct: 183 RGPPGPAGEAGAPGPAGEPGTPAISEPL-TPGAPGEPGDSGPPGPPGPPGAPGNDGP-PG 240 Query: 972 PPPP 983 PP P Sbjct: 241 PPGP 244 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P PP P P PP P P Sbjct: 185 PPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGP 244 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPP 873 P PP PP P P P Sbjct: 245 KGAPGPDGPPGADGQSGPPGPPGPAGTP 272 Score = 35.5 bits (78), Expect = 0.058 Identities = 30/123 (24%), Positives = 30/123 (24%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P PP P Sbjct: 152 PPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLT 211 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP PP P P P P P P P P Sbjct: 212 -PGAPGEPGDSGPPG-----PPGPPGAPGNDGPPGPPGPKGAPGPDGPPGADGQSGPPGP 265 Query: 975 PPP 983 P P Sbjct: 266 PGP 268 >U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequence x-hybridizingprotein 1 protein. Length = 589 Score = 55.2 bits (127), Expect = 7e-08 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 8/126 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P Sbjct: 337 PSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFD 396 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPX 951 P PP P P P PP P PP P P PP PP P Sbjct: 397 PS-GAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPF 455 Query: 952 XPPPXP 969 P P Sbjct: 456 NPSGAP 461 Score = 54.8 bits (126), Expect = 9e-08 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 8/126 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P Sbjct: 397 PSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFN 456 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPX 951 P PP P P P PP P PP P P PP PP P Sbjct: 457 PS-GAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPF 515 Query: 952 XPPPXP 969 P P Sbjct: 516 DPSGAP 521 Score = 54.8 bits (126), Expect = 9e-08 Identities = 41/128 (32%), Positives = 41/128 (32%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 409 PFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPG 468 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P PP PP P P P P P PP P Sbjct: 469 PFNPSGAP-PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGMPP 527 Query: 958 PPXPXXPP 981 P P P Sbjct: 528 VPLPTDLP 535 Score = 54.8 bits (126), Expect = 9e-08 Identities = 42/133 (31%), Positives = 42/133 (31%), Gaps = 13/133 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 439 PFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 498 Query: 784 PXXP---PXXXXPPPXXXXPPXPPPXPPPXPPPXPXP-----PPXXXXXPXXPXPPXXPP 939 P P P PP PP PP P P P P P P Sbjct: 499 PFNPSGAPPSGGPPGPFDPSGAPPSGMPPVPLPTDLPIPSESPSFFQWIFGRPKPSGPAG 558 Query: 940 PXPXXPPPXPXXP 978 P P PP P P Sbjct: 559 PAPSGEPPGPFDP 571 Score = 54.4 bits (125), Expect = 1e-07 Identities = 40/126 (31%), Positives = 40/126 (31%), Gaps = 8/126 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P Sbjct: 367 PSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFN 426 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPX 951 P PP P P P PP P PP P P PP PP P Sbjct: 427 PS-GAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPF 485 Query: 952 XPPPXP 969 P P Sbjct: 486 DPSGAP 491 Score = 54.0 bits (124), Expect = 2e-07 Identities = 45/139 (32%), Positives = 45/139 (32%), Gaps = 19/139 (13%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 214 PFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPG 273 Query: 784 PXXP---PXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPX--PPXXPPPX 945 P P P PP PP PP P P P P P PP PP Sbjct: 274 PFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPG 333 Query: 946 PXXP--------PPXPXXP 978 P P PP P P Sbjct: 334 PFDPSGAPPSGGPPGPFNP 352 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 199 PFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 258 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP PP P P P P P PP Sbjct: 259 PFNPSGAP-PSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPSGGPP 317 Query: 964 XPXXP 978 P P Sbjct: 318 GPFNP 322 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 244 PFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPG 303 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP PP P P P P P PP Sbjct: 304 PFDPSGAQ-PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPP 362 Query: 964 XPXXP 978 P P Sbjct: 363 GPFDP 367 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 289 PFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 348 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP PP P P P P P PP Sbjct: 349 PFNPSGAP-PSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPP 407 Query: 964 XPXXP 978 P P Sbjct: 408 GPFNP 412 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 394 PFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPG 453 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP PP P P P P P PP Sbjct: 454 PFNPSGAP-PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPP 512 Query: 964 XPXXP 978 P P Sbjct: 513 GPFDP 517 Score = 53.2 bits (122), Expect = 3e-07 Identities = 42/129 (32%), Positives = 42/129 (32%), Gaps = 12/129 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 319 PFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 378 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXP--XPPXXPPP 942 P P P P P PP PP P PP P P PP PP Sbjct: 379 PFDPSGAP-PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPP 437 Query: 943 XPXXPPPXP 969 P P P Sbjct: 438 GPFNPSGAP 446 Score = 53.2 bits (122), Expect = 3e-07 Identities = 42/129 (32%), Positives = 42/129 (32%), Gaps = 12/129 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 349 PFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPG 408 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXP--XPPXXPPP 942 P P P P P PP PP P PP P P PP PP Sbjct: 409 PFNPSGAP-PSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPP 467 Query: 943 XPXXPPPXP 969 P P P Sbjct: 468 GPFNPSGAP 476 Score = 53.2 bits (122), Expect = 3e-07 Identities = 42/129 (32%), Positives = 42/129 (32%), Gaps = 12/129 (9%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 379 PFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPG 438 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXP--XPPXXPPP 942 P P P P P PP PP P PP P P PP PP Sbjct: 439 PFNPSGAP-PSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPP 497 Query: 943 XPXXPPPXP 969 P P P Sbjct: 498 GPFNPSGAP 506 Score = 52.8 bits (121), Expect = 4e-07 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 6/127 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP--PPXPX-PXPXPPXPXPPPPXXP---PPXPXP 777 P P P P P PP PP P P PP PP P P PP P Sbjct: 302 PGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGP 361 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P PP PP P P P P P Sbjct: 362 PGPFDPSGAP-PSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGG 420 Query: 958 PPXPXXP 978 PP P P Sbjct: 421 PPGPFNP 427 Score = 52.4 bits (120), Expect = 5e-07 Identities = 39/126 (30%), Positives = 39/126 (30%), Gaps = 8/126 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP-PPXXPPPXPXPPPPXX 792 P PP P P P PP P P P P P P PP PP P Sbjct: 172 PSGAPPSGGPPGPFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFN 231 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXP--XPPXXPPPXPX 951 P P P P PP PP P PP P P PP PP P Sbjct: 232 PSGAP-PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPF 290 Query: 952 XPPPXP 969 P P Sbjct: 291 DPSGAP 296 Score = 52.4 bits (120), Expect = 5e-07 Identities = 45/133 (33%), Positives = 45/133 (33%), Gaps = 16/133 (12%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 229 PFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 288 Query: 784 PXXP---PXXXXPP----PXXXXPPXPPPXP--PPXPPPXPXPPPXXXXXPXXP--XPPX 930 P P P PP P P PP P P PP PP P P PP Sbjct: 289 PFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPP-----GPFDPSGAPPS 343 Query: 931 XPPPXPXXPPPXP 969 PP P P P Sbjct: 344 GGPPGPFNPSGAP 356 Score = 52.4 bits (120), Expect = 5e-07 Identities = 46/140 (32%), Positives = 46/140 (32%), Gaps = 22/140 (15%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P Sbjct: 247 PSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFD 306 Query: 778 P----PPXXPPXXXXPP--PXXXXPPXP--PPXPPP--XPP----PXPXPPPXXXXXPXX 915 P P PP P P PP P P PP PP P PP P Sbjct: 307 PSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFD 366 Query: 916 P--XPPXXPPPXPXXPPPXP 969 P PP PP P P P Sbjct: 367 PSGAPPSGGPPGPFDPSGAP 386 Score = 52.0 bits (119), Expect = 6e-07 Identities = 46/140 (32%), Positives = 46/140 (32%), Gaps = 22/140 (15%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P Sbjct: 232 PSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFD 291 Query: 778 P---PP-XXPPXXXXP--------PPXXXXPP-XPPPXPPPXP-PPXPXPPPXXXXXPXX 915 P PP PP P PP P PP PP P P PP P Sbjct: 292 PSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFN 351 Query: 916 P--XPPXXPPPXPXXPPPXP 969 P PP PP P P P Sbjct: 352 PSGAPPSGGPPGPFDPSGAP 371 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P P P P PP P P P P P Sbjct: 157 PSGAPPSGGPPGLFDPSGAPPSGGPPGPFGPSGAP--PSGGPPGPFNPSEAPPSGGPTGP 214 Query: 796 PXXXXPPPXXXXP-PXPPP-XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P P P PP PP P P P P P PP P Sbjct: 215 FDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGP 274 Query: 970 XXP 978 P Sbjct: 275 FDP 277 Score = 51.2 bits (117), Expect = 1e-06 Identities = 43/135 (31%), Positives = 43/135 (31%), Gaps = 13/135 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPX- 774 P PP P P P PP P P P PP P P PP PP P Sbjct: 442 PSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFN 501 Query: 775 ---PPPPXXPPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP PP P P PP P P P P P P P P P Sbjct: 502 PSGAPPSGGPPGPFDPSGAPPSGMPPVPLPTDLPIPSESPSFFQWIFGRP-KPSGPAGPA 560 Query: 940 PXPXXPPP-XPXXPP 981 P P P P PP Sbjct: 561 PSGEPPGPFDPSGPP 575 Score = 50.4 bits (115), Expect = 2e-06 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 7/125 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP---PPXPXXXXPPPPPXPXPXPXPPXPXPPP--PXXPPPXPXPP 780 P PP P P PP P PP P P P PP P P P Sbjct: 162 PSGGPPGLFDPSGAPPSGGPPGPFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAP 221 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPXX 954 P PP P P P P PP PP P P PP PP P Sbjct: 222 PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPP-----GPFNPSGAPPSGGPPGPFD 276 Query: 955 PPPXP 969 P P Sbjct: 277 PSGAP 281 Score = 50.4 bits (115), Expect = 2e-06 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 5/125 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P P P P PP PP P P PP PP Sbjct: 184 PFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPG 243 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P PP PP P P P P P PP Sbjct: 244 PFDPSGAP-PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPP 302 Query: 964 XPXXP 978 P P Sbjct: 303 GPFDP 307 Score = 50.4 bits (115), Expect = 2e-06 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 7/125 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP---PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPP 783 P PP P P PP P PP P P P PP P P P P Sbjct: 312 PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAP 371 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXP--XPPXXPPPXPXX 954 P P P PP PP P P PP P P PP PP P Sbjct: 372 PSGGPPGPFDPSG-----APPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFN 426 Query: 955 PPPXP 969 P P Sbjct: 427 PSGAP 431 Score = 50.0 bits (114), Expect = 3e-06 Identities = 37/119 (31%), Positives = 37/119 (31%), Gaps = 5/119 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPP-PPXPX-PXPXPPXPXPPPPXXP---PPXPXPPP 783 P P P P P P P PP P P PP PP P P PP PP Sbjct: 424 PFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPG 483 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P PP PP P P P P P P P Sbjct: 484 PFDPSGAP-PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGMPPVPLPTDLPIPSESP 541 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/121 (32%), Positives = 39/121 (32%), Gaps = 13/121 (10%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPP---PPPXPXPXPXPPXPXPPPPXXP---PPXPXPPPPXXPPXXX 807 P P P PP PP P PP PP P P PP PP P P Sbjct: 147 PSGGPPGPFDPSGAPPSGGPPGLFDPSGAPPSGGPPGPFGPSGAPPSGGPPGPFNPSEAP 206 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXP--XPPXXPPPXPXXPPPX 966 P P P PP PP P PP P P PP PP P P Sbjct: 207 -PSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGA 265 Query: 967 P 969 P Sbjct: 266 P 266 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/115 (29%), Positives = 34/115 (29%), Gaps = 1/115 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P PP P PP P P P P Sbjct: 51 PSDLPDPSSPPPAPRPSGQPPGPQGPSDLPGPSGAPPGPPHPSGPPHRPHPHPSRRPRPT 110 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP PP P P P Sbjct: 111 RLPRP-SRSPHSDAPEPSAATDGFEL---VFGKHHSTGAPPSGGPPGPFDPSGAP 161 Score = 48.8 bits (111), Expect = 6e-06 Identities = 41/124 (33%), Positives = 41/124 (33%), Gaps = 10/124 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPP 783 PP P P P P PP P P P PP P P PP PP P P Sbjct: 191 PPSGGP--PGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPS 248 Query: 784 PXXPPXXXXPP--PXXXXPPXPPPXP--PPXPPPXPXPPPXXXXXPXXP--XPPXXPPPX 945 P P P P PP P P PP PP P P PP PP Sbjct: 249 GAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPP-----GPFDPSGAPPSGGPPG 303 Query: 946 PXXP 957 P P Sbjct: 304 PFDP 307 Score = 48.8 bits (111), Expect = 6e-06 Identities = 42/136 (30%), Positives = 42/136 (30%), Gaps = 15/136 (11%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPPPPXXP---PPXPXP 777 P PP P P P PP P P P PP P P P PP P Sbjct: 262 PSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFN 321 Query: 778 P---PP-XXPPXXXXP--PPXXXXPP---XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPX 930 P PP PP P P PP P PP PP P P P P Sbjct: 322 PSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFD 381 Query: 931 XPPPXPXXPPPXPXXP 978 P PP P P Sbjct: 382 PSGAPPSGGPPGPFDP 397 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = +3 Query: 777 PPXPXPX--PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P PP P P P P PP P P P P P P P P P Sbjct: 61 PPAPRPSGQPPGPQGPSDLPGPSGAPPGPPHPSGPPHRPHPHPSRRPRPTRLPRPSRSPH 120 Query: 951 XPPPXP 968 P P Sbjct: 121 SDAPEP 126 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-----PPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P PP P P P Sbjct: 297 PSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAP 356 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 357 PSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAP 416 Query: 960 PXPXPPPP 983 P PP P Sbjct: 417 PSGGPPGP 424 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-----PPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P PP P P P Sbjct: 237 PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAP 296 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 297 PSGGPPGPFDPSGAQPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAP 356 Query: 960 PXPXPPPP 983 P PP P Sbjct: 357 PSGGPPGP 364 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-----PPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P PP P P P Sbjct: 312 PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAP 371 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 372 PSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAP 431 Query: 960 PXPXPPPP 983 P PP P Sbjct: 432 PSGGPPGP 439 Score = 44.0 bits (99), Expect = 2e-04 Identities = 40/140 (28%), Positives = 40/140 (28%), Gaps = 22/140 (15%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPP------------- 747 P PP P P P P P P P P P P P P Sbjct: 82 PSGAPPGPPHPSGPPHRPHPHPSRRPRPTRLPRPSRSPHSDAPEPSAATDGFELVFGKHH 141 Query: 748 PXXPPPXPXPPPPXXP---PXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXX 915 PP PP P P P PP PP PP P P PP P Sbjct: 142 STGAPPSGGPPGPFDPSGAPPSGGPPGLFDPSGAPPSGGPPGPFGPSGAPPSGGPPGPFN 201 Query: 916 P--XPPXXPPPXPXXPPPXP 969 P PP P P P P Sbjct: 202 PSEAPPSGGPTGPFDPSGAP 221 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/127 (27%), Positives = 35/127 (27%), Gaps = 4/127 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPP--PPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P PP P P PP PP P P P Sbjct: 214 PFDPSGAPPS---GGPPGPFNPSGAPPSGGPPG---PFDPSGAPPSGGPPGPFNPSGAPP 267 Query: 789 XPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PP P P P P P P P PP P P P P P P PP Sbjct: 268 SGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAQPSGGPPGPFNPSGAPP 327 Query: 963 XPXPPPP 983 PP P Sbjct: 328 SGGPPGP 334 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-----PPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P PP P P P Sbjct: 327 PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAP 386 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 387 PSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAP 446 Query: 960 PXPXPPPP 983 P PP P Sbjct: 447 PSGGPPGP 454 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 8/128 (6%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXP-----PPPPXXXP-PXXPXXXXXXXXXXXXXXXXPPX 785 P PP P P P PP P P P Sbjct: 342 PSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAPPSGGPPGPFDPSGAP 401 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 402 PSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAP 461 Query: 960 PXPXPPPP 983 P PP P Sbjct: 462 PSGGPPGP 469 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 4/110 (3%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXP---XPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P PPP P P P P P P P P P PP P PP P P Sbjct: 51 PSDLPDPSSPPPAPRPSGQPPGPQGPSDLPGPSGAP---PGPPHPSGPPHRPHPHPSRRP 107 Query: 832 PPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P PP P P Sbjct: 108 RPTRLPRPSRSPHSDAPEPSAATDGFELVFGKHHSTGAPPSGGPPGPFDP 157 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P PP P P P P P P P Sbjct: 192 PSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAP 251 Query: 960 PXPXPPPP 983 P PP P Sbjct: 252 PSGGPPGP 259 Score = 41.9 bits (94), Expect = 7e-04 Identities = 35/116 (30%), Positives = 35/116 (30%), Gaps = 12/116 (10%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPP---PPXXPPPXPXP 777 P PP P P P PP P P P PP P P PP PP P P Sbjct: 472 PSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGMPPVPLP 531 Query: 778 ---PPPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P P P P P P P PP PP Sbjct: 532 TDLPIPSESPSFFQWIFGRPKPSGPAGPAPSGEPPGPFDPSGPPPSESSEGSGIPP 587 Score = 41.5 bits (93), Expect = 9e-04 Identities = 39/144 (27%), Positives = 39/144 (27%), Gaps = 12/144 (8%) Frame = +1 Query: 574 VDRXDXAXXXXXXXPPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP---- 741 VD D P P P P P P PP PP P P P P P Sbjct: 49 VDPSDLPDPSSPPPAPRPSGQPPGPQGPSDLPGPSGA-PPGPPHPSGPPHRPHPHPSRRP 107 Query: 742 -----PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXX 903 P P P P P PP PP P P PP Sbjct: 108 RPTRLPRPSRSPHSDAPEPSAATDGFELVFGKHHSTGAPPSGGPPGPFDPSGAPPSGGPP 167 Query: 904 XPXXP--XPPXXPPPXPXXPPPXP 969 P PP PP P P P Sbjct: 168 GLFDPSGAPPSGGPPGPFGPSGAP 191 Score = 41.5 bits (93), Expect = 9e-04 Identities = 31/99 (31%), Positives = 31/99 (31%), Gaps = 5/99 (5%) Frame = +1 Query: 697 PPXPX-PXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPP 861 PP P P PP PP P PP PP P P PP P P PP Sbjct: 151 PPGPFDPSGAPPSGGPPGLFDPSGAPPSGGPPGPFGPSGA--PPSGGPPGPFNPSEAPPS 208 Query: 862 XPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P PP P P Sbjct: 209 GGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDP 247 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 6/97 (6%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPX---PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PP P P P P PP PP P PP PP PP PP P Sbjct: 146 PPSGGP-PGPFDPSGAPPSGGPPGLFDPSGAPP-----SGGPPGPFGPSGAPPSGGPPGP 199 Query: 868 -PPXPXPPPXXXXXPXXP--XPPXXPPPXPXXPPPXP 969 P PP P P PP PP P P P Sbjct: 200 FNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAP 236 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P P P P P P P P P P Sbjct: 177 PSGGPPGPFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAP 236 Query: 960 PXPXPPPP 983 P PP P Sbjct: 237 PSGGPPGP 244 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P PP P P P P P P P Sbjct: 207 PSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPGPFNPSGAP 266 Query: 960 PXPXPPPP 983 P PP P Sbjct: 267 PSGGPPGP 274 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P P P P PP P P P P P P P Sbjct: 162 PSGGPPGLFDPSGAPPSGGPPGPFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAP 221 Query: 960 PXPXPPPP 983 P PP P Sbjct: 222 PSGGPPGP 229 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXP--XPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P PP P P P PP P P P P Sbjct: 182 PGPFGPSGAPPSGGPPGPFNPSEAPPSGGPTGPFDPSGAPPSGGPPGPFNPSGAPPSGGP 241 Query: 960 PXPXPP 977 P P P Sbjct: 242 PGPFDP 247 Score = 37.1 bits (82), Expect = 0.019 Identities = 33/126 (26%), Positives = 33/126 (26%), Gaps = 3/126 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P P P P Sbjct: 92 PSGPPHRP-HPHPSRRPRPTRLPRPSRSPHSDAPEPSAATDGFELVFGKHHSTGAP-PSG 149 Query: 795 XPPXPXXPXXXXP---PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPX 965 PP P P P PP P PP PP P P P P P P PP Sbjct: 150 GPPGPFDPSGAPPSGGPPGLFDPSGAPP-SGGPPGPFGPSGAPPSGGPPGPFNPSEAPPS 208 Query: 966 PXPPPP 983 P P Sbjct: 209 GGPTGP 214 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 814 PPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PPP P P PP P P P P P P P P P P Sbjct: 51 PSDLPDPSSPPPAPRPSGQPPGPQGPSDLPGPSGAPPGPPHPSGPPHRPHPHPSRRP 107 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXP--PPPXPPXXXXPXPXPXP-PXXPXXPPPXPX 971 P P P P P P P P P PP PP P P P P P P Sbjct: 55 PDPSSPPPAPRPSGQPPGPQGPSDLPGPSGAPPGPPHPSGPPHRPHPHPSRRPRPTRLPR 114 Query: 972 P 974 P Sbjct: 115 P 115 Score = 32.7 bits (71), Expect = 0.41 Identities = 36/138 (26%), Positives = 36/138 (26%), Gaps = 22/138 (15%) Frame = +3 Query: 615 PXXPPXXPPX--PXXXXXPXPXXXXXXPPPP--PXXXPPXX--PXXXXXXXXXXXXXXXX 776 P P PP P P PP P P PP P Sbjct: 439 PFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFNPSGAPPSGGPPGPFDPSGAPPSGGPPG 498 Query: 777 PPXPXPXPPXPXXPXXXXP---PPXXPXPPPXPPXXPXP-------------PPPXPPXX 908 P P PP P P PP P P P P P P P P Sbjct: 499 PFNPSGAPPSGGPPGPFDPSGAPPSGMPPVPLPTDLPIPSESPSFFQWIFGRPKPSGPAG 558 Query: 909 XXPXPXPXPPXXPXXPPP 962 P P P P PPP Sbjct: 559 PAPSGEPPGPFDPSGPPP 576 >J01047-1|AAA27988.1| 296|Caenorhabditis elegans protein ( C.elegans (nematode)collagen 1 (col-1) gene, complete cds. ). Length = 296 Score = 55.2 bits (127), Expect = 7e-08 Identities = 40/130 (30%), Positives = 40/130 (30%), Gaps = 9/130 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX-PPPXPXPPPPXXP 795 P PP P PP P PP PP P P P P P P P P Sbjct: 126 PGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGP 185 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP----PPXPXXP 957 P P P P P P P P P P PP P PP P P Sbjct: 186 PGPAGEAGAPGPAGEPGTPAISEPLTPGAPG-EPGDSGPPGPPGPPGAPGNDGPPGPPGP 244 Query: 958 --PPXPXXPP 981 P P PP Sbjct: 245 KGAPGPDGPP 254 Score = 51.6 bits (118), Expect = 8e-07 Identities = 42/132 (31%), Positives = 42/132 (31%), Gaps = 15/132 (11%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P P P P P PP P P P P P PP P PP P Sbjct: 104 PAGAPGKPGKPGRPGAPGTP--GTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGD 161 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPP-------PXPXPPPXXXXXPXXPXPPXXP--- 936 P P P P P P PP P P P P P P P Sbjct: 162 PGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDS 221 Query: 937 -PPXPXXPPPXP 969 PP P PP P Sbjct: 222 GPPGPPGPPGAP 233 Score = 51.6 bits (118), Expect = 8e-07 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 6/121 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P P P P P P P P P P Sbjct: 136 PTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAP 195 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXP 957 P P P P P P PP P PP P PP P P P Sbjct: 196 GPAGEP--GTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGP 253 Query: 958 P 960 P Sbjct: 254 P 254 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/120 (29%), Positives = 35/120 (29%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P PPP P P PP P PP Sbjct: 99 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVA-PCEPTTPPPCKPCPQ-GPPGPPGPP 156 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P PP P P P P P P Sbjct: 157 GAPGDPGEAGTPGRPGTDAAPGSP-GPRGPPGPAGEAGAPGPAGEPGTPAISEPLTPGAP 215 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 8/105 (7%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P PP P PPP P PP PP PP Sbjct: 99 PGPPGPAGAPGKPGKPGRPGAPGTPGTPGKPPVAPCEPTTPPPCKPCPQGPP--GPPGPP 156 Query: 871 PXPXPP--------PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P Sbjct: 157 GAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEP 201 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/129 (27%), Positives = 36/129 (27%), Gaps = 8/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXP 795 P PP P P P P P P P P P P PP P P P Sbjct: 146 PQGPPGPPGP--PGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGT 203 Query: 796 PXXXXP-------PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P P PP PP P P PP P PP Sbjct: 204 PAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGPKGAPGPDGPPGADGQSGPP 263 Query: 955 PPPXPXXPP 981 PP P P Sbjct: 264 GPPGPAGTP 272 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 1/124 (0%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 123 PGTPGKPPVAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDAAPGSPGP 182 Query: 795 -XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 PP P P P P P P P P P PP P P P Sbjct: 183 RGPPGPAGEAGAPGPAGEPGTPAISEPL-TPGAPGEPGDSGPPGPPGPPGAPGNDGP-PG 240 Query: 972 PPPP 983 PP P Sbjct: 241 PPGP 244 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P PP P P PP P P Sbjct: 185 PPGPAGEAGAPGPAGEPGTPAISEPLTPGAPGEPGDSGPPGPPGPPGAPGNDGPPGPPGP 244 Query: 796 PXXXXP--PPXXXXPPXPPPXPPPXPPP 873 P PP PP P P P Sbjct: 245 KGAPGPDGPPGADGQSGPPGPPGPAGTP 272 Score = 35.5 bits (78), Expect = 0.058 Identities = 30/123 (24%), Positives = 30/123 (24%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P PP P Sbjct: 152 PPGPPGAPGDPGEAGTPGRPGTDAAPGSPGPRGPPGPAGEAGAPGPAGEPGTPAISEPLT 211 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP PP P P P P P P P P Sbjct: 212 -PGAPGEPGDSGPPG-----PPGPPGAPGNDGPPGPPGPKGAPGPDGPPGADGQSGPPGP 265 Query: 975 PPP 983 P P Sbjct: 266 PGP 268 >AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical protein D1007.7 protein. Length = 988 Score = 55.2 bits (127), Expect = 7e-08 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 4/84 (4%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXP-PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PPP PP P PPP P P P PP PP PPP P P Sbjct: 660 PPPNIQPPVPHPPPMGFPFQHQLTQLPGQPRPAGLPPGVPPMFNLNAPPPPGIPGYPPAP 719 Query: 919 XPPXXPPPXPXXPPP---XPXXPP 981 PP PP P PP P PP Sbjct: 720 PPPGVGPPPPQGIPPMGFDPNKPP 743 Score = 52.0 bits (119), Expect = 6e-07 Identities = 34/103 (33%), Positives = 34/103 (33%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P PPP P P P P P PP PP PP Sbjct: 660 PPPNIQPPVPHPPPMGFPFQHQLTQLPGQPR-PAGLPPGVPPMFNLNAPPPPGIPGYPPA 718 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP P PPP PP P P PP PP P Sbjct: 719 PPP-PGVGPPPPQGIPP-MGFDPNKPPPPMFQQGFNAGAPPPP 759 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 4/103 (3%) Frame = +1 Query: 631 PXXPXPXX--PXPPPXPXXXXPPPPPXPXPXPXPPXP--XPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPPP P P PP P PPPP PP P PP Sbjct: 686 PGQPRPAGLPPGVPPMFNLNAPPPPGIPGYPPAPPPPGVGPPPPQGIPPMGFDPNKPPPP 745 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PPP P PPP P PP Sbjct: 746 MF---QQGFNAGAPPPPFGRGAGPMSSFPPPPRGGMHHMPPPP 785 Score = 49.6 bits (113), Expect = 3e-06 Identities = 41/126 (32%), Positives = 41/126 (32%), Gaps = 14/126 (11%) Frame = +1 Query: 628 PPXXPXPXXPXPPPX------PXXXXPPPP-PXPXPXPXPPX---PXPPPPXXP--PPXP 771 PP P P PPP P P P P PP PPPP P PP P Sbjct: 660 PPPNIQPPVPHPPPMGFPFQHQLTQLPGQPRPAGLPPGVPPMFNLNAPPPPGIPGYPPAP 719 Query: 772 XPPPPXXPPXXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PPP PP PP P P PP P PP P PP Sbjct: 720 -PPPGVGPPPPQGIPPMGFDPNKPPPPMFQQGFNAGAPPPPFGRGAGPMSSFPPPPRGGM 778 Query: 946 PXXPPP 963 PPP Sbjct: 779 HHMPPP 784 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 6/100 (6%) Frame = +3 Query: 696 PPPXXXPPXX-PXXXXXXXXXXXXXXXXPPXPXPXPPX--PXXPXXXXPPPXXPXPPPXP 866 PPP PP P P P PP P PPP P PP P Sbjct: 660 PPPNIQPPVPHPPPMGFPFQHQLTQLPGQPRPAGLPPGVPPMFNLNAPPPPGIPGYPPAP 719 Query: 867 PX---XPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PP PP P P P P PP Sbjct: 720 PPPGVGPPPPQGIPPMGFDPNKPPPPMFQQGFNAGAPPPP 759 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P PP PP P PPP P PP Sbjct: 708 PPPGIPGYP-PAPPPPGVGPPPPQGIPPM-GFDPNKPPPPMFQQGFNAGAPPPPFGRGAG 765 Query: 957 PPXPXPPPP 983 P PPPP Sbjct: 766 PMSSFPPPP 774 >Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical protein C33B4.3b protein. Length = 993 Score = 54.8 bits (126), Expect = 9e-08 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 3/95 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P PPPP PPP P P Sbjct: 724 PPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPP--PPPPPPHCEPTMV 781 Query: 796 PXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPPP 891 PP PP PPP PP PPP P PPP Sbjct: 782 HVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 3/102 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP---PPPXXPPPXPXPPPPXXPPX 801 P P PPP P P P P P PPPP PP Sbjct: 714 PFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPPPPPPP 773 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP PPP P PP P P PP Sbjct: 774 PHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPP 815 Score = 46.0 bits (104), Expect = 4e-05 Identities = 33/109 (30%), Positives = 33/109 (30%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PPPPP P P P P PPP P Sbjct: 714 PFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPPPP--P 771 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP P P PP PP PPP P PP Sbjct: 772 --PPPHCEPTMVHVEFTPPSTSSVP--PPPPPLPPISSGAPPPPPPPPP 816 Score = 45.2 bits (102), Expect = 7e-05 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 8/115 (6%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P PPPP P Sbjct: 688 PAPPPASYISPDLQRDSSMQRSEYSRPFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSL 747 Query: 841 PPPXPPPXP--------PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP P PPP P PP PPP P PP Sbjct: 748 PRSASTPQPIQQQQSSIPPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPP 802 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 831 PPPXXPXPPPX--PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P PPP P P P P P PP PPP P PPP Sbjct: 765 PPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P PP P P PP P PPPP PP P P PP Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPP 814 >Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical protein C33B4.3a protein. Length = 1110 Score = 54.8 bits (126), Expect = 9e-08 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 3/95 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P P PPPP PPP P P Sbjct: 724 PPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPP--PPPPPPHCEPTMV 781 Query: 796 PXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPPP 891 PP PP PPP PP PPP P PPP Sbjct: 782 HVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 3/102 (2%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP---PPPXXPPPXPXPPPPXXPPX 801 P P PPP P P P P P PPPP PP Sbjct: 714 PFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPPPPPPP 773 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP PPP P PP P P PP Sbjct: 774 PHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPP 815 Score = 46.0 bits (104), Expect = 4e-05 Identities = 33/109 (30%), Positives = 33/109 (30%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PPPPP P P P P PPP P Sbjct: 714 PFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSLPRSASTPQPIQQQQSSIPPPPPP--P 771 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP P P PP PP PPP P PP Sbjct: 772 --PPPHCEPTMVHVEFTPPSTSSVP--PPPPPLPPISSGAPPPPPPPPP 816 Score = 45.2 bits (102), Expect = 7e-05 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 8/115 (6%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P PPPP P Sbjct: 688 PAPPPASYISPDLQRDSSMQRSEYSRPFRPTSRPKTPPPPPPMQHQNHQNHQYQQQHPSL 747 Query: 841 PPPXPPPXP--------PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P PP P PPP P PP PPP P PP Sbjct: 748 PRSASTPQPIQQQQSSIPPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPP 802 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 831 PPPXXPXPPPX--PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P PPP P P P P P PP PPP P PPP Sbjct: 765 PPPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPPPP 816 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P PP P P PP P PPPP PP P P PP Sbjct: 766 PPPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPPPLPPISSGAPPPPPPP 814 >Z68314-1|CAA92658.1| 102|Caenorhabditis elegans Hypothetical protein F07H5.6 protein. Length = 102 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/82 (46%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXG-GG 693 G GG G G G GGG GG GG G G GGG G GGG G G G G G G GG Sbjct: 21 GFGGFGGYGLGLGLGCGGGF---GGFSGGYGLGYGGGFGGYGGGFGGYGLG-GYGLGYGG 76 Query: 692 GGXXXXGXGGGXGXXGXGXXGG 627 G G GGG G G G Sbjct: 77 YGMFGSGYGGGCGYSMIGGCFG 98 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = -1 Query: 946 GXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G GG G G G GG GG G G GGG G GGG G G GG G G GG Sbjct: 23 GGFGGYGLGLGLGCGGGFGGFSGGYGLGYGGGFGGYGGG---FGGYGLGGYGLGYGG 76 Score = 50.0 bits (114), Expect = 3e-06 Identities = 36/83 (43%), Positives = 36/83 (43%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GG G GG G GG G G GGG GG GGG G G GG G G Sbjct: 21 GFGGFGGYGLGLGLGCGGGFGGFSGGYGLGYGGGFGG---YGGGF----GGYGLGGYGLG 73 Query: 761 GGXXGGGGXGXGGXGXGXGXGGG 693 G G G G GG G G GG Sbjct: 74 YGGYGMFGSGYGG-GCGYSMIGG 95 Score = 48.4 bits (110), Expect = 8e-06 Identities = 33/80 (41%), Positives = 33/80 (41%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG G G G GG G G G G GGG GG GGG GG G G Sbjct: 21 GFGGFGGYGLGLGLGCGGGFGGFSG----GYGLGYGGGF-GGYGGGFGGYGLGGYGLGYG 75 Query: 797 GGXXGGGGXGXGGGXXGGGG 738 G G G G G G GG Sbjct: 76 GYGMFGSGYGGGCGYSMIGG 95 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/68 (45%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG-GGGXXXXGXGG-GXGXXGXG 639 G GG G G G GGG GG G G G G G GG GGG G GG G G G G Sbjct: 21 GFGGFGGYGLGLGLGCGGGF--GGFSGGYGLGYGGGFGGYGGGFGGYGLGGYGLGYGGYG 78 Query: 638 XXGGXXGG 615 G GG Sbjct: 79 MFGSGYGG 86 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG 846 G G GGG G GGG GG G G GG G G GGG G Sbjct: 46 GYGLGYGGGFGGYGGGF-GGYGLGGYGLGYGGYGMFGSGYGGGCG 89 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGX--GGGXGGGXG 834 GG G GG G GGG G G G G G G GG G G GGG G Sbjct: 38 GGFGGFSGGYGLGYGGGFGGYGGGFGGYGLGGYGLGYGGYGMFGSGYGGGCG 89 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 7/53 (13%) Frame = -1 Query: 982 GGGGXGXGG----GXXGXXGGXGXGXGXXXXG--GXGGGGXGXXG-GXGGGXG 845 GGG G G G G GG G G G G G G GG G G G GGG G Sbjct: 37 GGGFGGFSGGYGLGYGGGFGGYGGGFGGYGLGGYGLGYGGYGMFGSGYGGGCG 89 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG 857 G GGG G GG G G G G G GG G G G GG G Sbjct: 50 GYGGGFGGYGGGFGGYGLGGYGLG---YGGYGMFGSGYGGGCG 89 >Z46343-8|CAA86461.1| 549|Caenorhabditis elegans Hypothetical protein F10F2.9 protein. Length = 549 Score = 54.4 bits (125), Expect = 1e-07 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 5/121 (4%) Frame = -3 Query: 962 GGGXXGX---GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 GGG G G GG GG G G GG GGG G GG Sbjct: 312 GGGNEGGDQWGSNNNGGDNYGSELSNNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGG 371 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG--XXXXGXGGGXGXXGXGXXGGXXG 618 G GG G GG GG G G G GGG G G Sbjct: 372 SWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYSKNGYGSNNNRND 431 Query: 617 G 615 G Sbjct: 432 G 432 Score = 50.0 bits (114), Expect = 3e-06 Identities = 32/113 (28%), Positives = 32/113 (28%), Gaps = 2/113 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GG G G G GGG GG GG Sbjct: 278 GSSGSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELSN 337 Query: 782 --GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG G G G GG G G GG G GG G G G G Sbjct: 338 NWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWG 390 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/109 (29%), Positives = 32/109 (29%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GG G G G GGG G G GG G Sbjct: 281 GSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNN--GGDNYGSELSNN 338 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GG G G G GG G G G GG GG Sbjct: 339 WGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGG 387 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/118 (25%), Positives = 30/118 (25%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GGG GG G GG G GG GG Sbjct: 340 GGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGS---GGSGGGNWGDNDNYG 396 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GGG G G G G G GG Sbjct: 397 SSNKWNGNGNQDNDNDNFGGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGG 454 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/121 (23%), Positives = 28/121 (23%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G GGG G G G Sbjct: 379 GGSGGSGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYS---KNGYGSNNNRNDGWGS 435 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GG GG G G G GG G G G Sbjct: 436 SSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNS 495 Query: 620 G 618 G Sbjct: 496 G 496 Score = 37.1 bits (82), Expect = 0.019 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 1/110 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG-GXXXXGGXXGGGGXGX 765 G G G G GG G G GG G G G G G Sbjct: 254 GTNDNDGNSWKGSGNSNGNSDNWGGSSGSGSNGGNDGDSNYGNEGSWKPSG--NSYGRNR 311 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GG G G G GG G G G GG GG Sbjct: 312 GGGNEGGDQWGSNNNGGD----NYGSELSNNWGGSNG--GSGSNGGSGGG 355 Score = 36.7 bits (81), Expect = 0.025 Identities = 28/104 (26%), Positives = 28/104 (26%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG GG G G G G G G G G GG Sbjct: 327 GGDNYGSELSNNWGGSNGGSGSNG-----GSGGGNTDNDNWGSNNGNSGGSWGNGGTGGS 381 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG GGG G G GGG G G Sbjct: 382 GG-SGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYSKNGYG 424 Score = 36.3 bits (80), Expect = 0.033 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 10/80 (12%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG----------XGXXG 836 GGG G G GG G G GG G GG GGG G G Sbjct: 312 GGGNEGGDQWG-SNNNGGDNYGSELSNNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSG 370 Query: 835 GGXXXXGXXGXGGXGXGXGG 776 G G G GG G G G Sbjct: 371 GSWGNGGTGGSGGSGGGNWG 390 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G GGG G G G GGGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNGNGDEDY 509 Query: 707 G 705 G Sbjct: 510 G 510 Score = 35.1 bits (77), Expect = 0.077 Identities = 29/124 (23%), Positives = 29/124 (23%), Gaps = 7/124 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G G Sbjct: 350 GGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDN 409 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-------GXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GGG G G G G GG GG G G G Sbjct: 410 DNDNFGGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNN 469 Query: 641 GXXG 630 G G Sbjct: 470 GNDG 473 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = -3 Query: 962 GGGXXGXGGGXXG----GXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXX 798 GGG G G G G GG GG GG G G Sbjct: 415 GGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGN 474 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G GG G G G G G Sbjct: 475 NWESNNGGNGGGGDNWNNGNSGNNGNNNGNG 505 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/103 (26%), Positives = 27/103 (26%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGG---GXXXX 818 GG G G GG G G G G G GG G GG G Sbjct: 277 GGSSGSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELS 336 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G GG GG G Sbjct: 337 NNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTG 379 Score = 32.3 bits (70), Expect = 0.54 Identities = 25/117 (21%), Positives = 25/117 (21%), Gaps = 1/117 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGGXXX 801 G G G G GGG G GGG G G Sbjct: 182 GNRNDGDDYNGNGNNQDNWNSGSNSGGYNGGGGGSGGGSNWNNGDNENDGWNNNNNNRKS 241 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G GG GG G G G Sbjct: 242 NNNNNNNYGNSWGTNDNDGNSWKGSGNSNGNSDNWGGSSGSGSNGGNDGDSNYGNEG 298 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGX---GGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 GG GG GGG G G GG GGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNGNGDEDY 509 Query: 674 G 672 G Sbjct: 510 G 510 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG---XXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GG GG GG G G GG GGGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNG 503 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = -1 Query: 985 GGGGGXGXG---GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GGG G G GG G GG GGG G G G G Sbjct: 351 GSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDND 410 Query: 814 XXGXGG 797 GG Sbjct: 411 NDNFGG 416 Score = 31.1 bits (67), Expect = 1.3 Identities = 26/103 (25%), Positives = 26/103 (25%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGG----GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 G G G G G G G G GG GG GG Sbjct: 281 GSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELSNNWG 340 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G GG G G GG GG Sbjct: 341 GSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGG 383 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/84 (23%), Positives = 20/84 (23%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GG GG GG G G G G G Sbjct: 207 GGYNGGGGGSGGGSNWNNGDNENDGWNNNNNNRKSNNNNNNNYGNSWGTNDNDGNSWKGS 266 Query: 689 GXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G GG G Sbjct: 267 GNSNGNSDNWGGSSGSGSNGGNDG 290 Score = 30.3 bits (65), Expect = 2.2 Identities = 30/122 (24%), Positives = 30/122 (24%), Gaps = 1/122 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG GG G G G G G G G GGG G Sbjct: 367 GNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNG-NGNQDNDNDNFGGGYSKNGYGS 425 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXG-XGXXXXXGXGGXX 629 G G G G GGG G G G GG Sbjct: 426 NNNRNDGWGS-SSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNG 484 Query: 628 GG 623 GG Sbjct: 485 GG 486 >Z35598-9|CAA84658.1| 549|Caenorhabditis elegans Hypothetical protein F10F2.9 protein. Length = 549 Score = 54.4 bits (125), Expect = 1e-07 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 5/121 (4%) Frame = -3 Query: 962 GGGXXGX---GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 GGG G G GG GG G G GG GGG G GG Sbjct: 312 GGGNEGGDQWGSNNNGGDNYGSELSNNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGG 371 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG--XXXXGXGGGXGXXGXGXXGGXXG 618 G GG G GG GG G G G GGG G G Sbjct: 372 SWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYSKNGYGSNNNRND 431 Query: 617 G 615 G Sbjct: 432 G 432 Score = 50.0 bits (114), Expect = 3e-06 Identities = 32/113 (28%), Positives = 32/113 (28%), Gaps = 2/113 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G GG G G G GGG GG GG Sbjct: 278 GSSGSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELSN 337 Query: 782 --GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG G G G GG G G GG G GG G G G G Sbjct: 338 NWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWG 390 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/109 (29%), Positives = 32/109 (29%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GG G G G GGG G G GG G Sbjct: 281 GSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNN--GGDNYGSELSNN 338 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GG GG G G G GG G G G GG GG Sbjct: 339 WGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGG 387 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/118 (25%), Positives = 30/118 (25%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GGG GG G GG G GG GG Sbjct: 340 GGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGS---GGSGGGNWGDNDNYG 396 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G G GGG G G G G G GG Sbjct: 397 SSNKWNGNGNQDNDNDNFGGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGG 454 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/121 (23%), Positives = 28/121 (23%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G GGG G G G Sbjct: 379 GGSGGSGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYS---KNGYGSNNNRNDGWGS 435 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G GG GG G G G GG G G G Sbjct: 436 SSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNS 495 Query: 620 G 618 G Sbjct: 496 G 496 Score = 37.1 bits (82), Expect = 0.019 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 1/110 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG-GXXXXGGXXGGGGXGX 765 G G G G GG G G GG G G G G G Sbjct: 254 GTNDNDGNSWKGSGNSNGNSDNWGGSSGSGSNGGNDGDSNYGNEGSWKPSG--NSYGRNR 311 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG GG G G G GG G G G GG GG Sbjct: 312 GGGNEGGDQWGSNNNGGD----NYGSELSNNWGGSNG--GSGSNGGSGGG 355 Score = 36.7 bits (81), Expect = 0.025 Identities = 28/104 (26%), Positives = 28/104 (26%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GG GG G G G G G G G G GG Sbjct: 327 GGDNYGSELSNNWGGSNGGSGSNG-----GSGGGNTDNDNWGSNNGNSGGSWGNGGTGGS 381 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG GGG G G GGG G G Sbjct: 382 GG-SGGGNWGDNDNYGSSNKWNGNGNQDNDNDNFGGGYSKNGYG 424 Score = 36.3 bits (80), Expect = 0.033 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 10/80 (12%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG----------XGXXG 836 GGG G G GG G G GG G GG GGG G G Sbjct: 312 GGGNEGGDQWG-SNNNGGDNYGSELSNNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSG 370 Query: 835 GGXXXXGXXGXGGXGXGXGG 776 G G G GG G G G Sbjct: 371 GSWGNGGTGGSGGSGGGNWG 390 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G GGG G G G GGGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNGNGDEDY 509 Query: 707 G 705 G Sbjct: 510 G 510 Score = 35.1 bits (77), Expect = 0.077 Identities = 29/124 (23%), Positives = 29/124 (23%), Gaps = 7/124 (5%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G G Sbjct: 350 GGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDN 409 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXG-------GXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GGG G G G G GG GG G G G Sbjct: 410 DNDNFGGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNN 469 Query: 641 GXXG 630 G G Sbjct: 470 GNDG 473 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = -3 Query: 962 GGGXXGXGGGXXG----GXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXX 798 GGG G G G G GG GG GG G G Sbjct: 415 GGGYSKNGYGSNNNRNDGWGSSSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGN 474 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G GG G G G G G Sbjct: 475 NWESNNGGNGGGGDNWNNGNSGNNGNNNGNG 505 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/103 (26%), Positives = 27/103 (26%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXGXXGG---GXXXX 818 GG G G GG G G G G G GG G GG G Sbjct: 277 GGSSGSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELS 336 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G G GG GG G Sbjct: 337 NNWGGSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTG 379 Score = 32.3 bits (70), Expect = 0.54 Identities = 25/117 (21%), Positives = 25/117 (21%), Gaps = 1/117 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGGXXX 801 G G G G GGG G GGG G G Sbjct: 182 GNRNDGDDYNGNGNNQDNWNSGSNSGGYNGGGGGSGGGSNWNNGDNENDGWNNNNNNRKS 241 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G G G G GG GG G G G Sbjct: 242 NNNNNNNYGNSWGTNDNDGNSWKGSGNSNGNSDNWGGSSGSGSNGGNDGDSNYGNEG 298 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGX---GGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 GG GG GGG G G GG GGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNGNGDEDY 509 Query: 674 G 672 G Sbjct: 510 G 510 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG---XXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GG GG GG G G GG GGGG G G G G Sbjct: 450 GGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNGGGGDNWNNGNSGNNGNNNG 503 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = -1 Query: 985 GGGGGXGXG---GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 G GGG G G GG G GG GGG G G G G Sbjct: 351 GSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNGNGNQDND 410 Query: 814 XXGXGG 797 GG Sbjct: 411 NDNFGG 416 Score = 31.1 bits (67), Expect = 1.3 Identities = 26/103 (25%), Positives = 26/103 (25%), Gaps = 4/103 (3%) Frame = -1 Query: 985 GGGGGXGXGG----GXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXX 818 G G G G G G G G GG GG GG Sbjct: 281 GSGSNGGNDGDSNYGNEGSWKPSGNSYGRNRGGGNEGGDQWGSNNNGGDNYGSELSNNWG 340 Query: 817 GXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G G G GG G G GG GG Sbjct: 341 GSNGGSGSNGGSGGGNTDNDNWGSNNGNSGGSWGNGGTGGSGG 383 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/84 (23%), Positives = 20/84 (23%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GG GG GG G G G G G Sbjct: 207 GGYNGGGGGSGGGSNWNNGDNENDGWNNNNNNRKSNNNNNNNYGNSWGTNDNDGNSWKGS 266 Query: 689 GXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G GG G Sbjct: 267 GNSNGNSDNWGGSSGSGSNGGNDG 290 Score = 30.3 bits (65), Expect = 2.2 Identities = 30/122 (24%), Positives = 30/122 (24%), Gaps = 1/122 (0%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G GG GG G G G G G G G GGG G Sbjct: 367 GNSGGSWGNGGTGGSGGSGGGNWGDNDNYGSSNKWNG-NGNQDNDNDNFGGGYSKNGYGS 425 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXG-XGXXXXXGXGGXX 629 G G G G GGG G G G GG Sbjct: 426 NNNRNDGWGS-SSSNNNNNNNNNNNGGTGGYSNNGGGWGSNNNNNGNDGNNWESNNGGNG 484 Query: 628 GG 623 GG Sbjct: 485 GG 486 >Z98866-26|CAM33505.1| 559|Caenorhabditis elegans Hypothetical protein Y49E10.29 protein. Length = 559 Score = 54.0 bits (124), Expect = 2e-07 Identities = 39/127 (30%), Positives = 39/127 (30%), Gaps = 10/127 (7%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPP----- 786 P P P P P PP P P P PP P PP PP P Sbjct: 290 PVQQAPPKPVPQQTPPVQQAPPKPAVQQAPTRAAPAPPKPAPQQAPPVQQNPPKPAVQQA 349 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPP-PXPXXPP 960 P P P P P P P PP PP P P PP P P P Sbjct: 350 QAPVVQQAPAPPVQQAP-PKPTPQQAPPVRQNPPMPAVQQAPSSQQATQAPPKPAPQQAP 408 Query: 961 PXPXXPP 981 P PP Sbjct: 409 PVQQNPP 415 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 3/124 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX--PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP-XPPPP 786 P PP P P P P PP P P PP PP P P Sbjct: 331 PQQAPPVQQNPPKPAVQQAQAPVVQQAPAPPVQQAPPKPTPQQAPPVRQNPPMPAVQQAP 390 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 PP P PP P P P PP P PP P P Sbjct: 391 SSQQATQAPPKPAPQQAPPVQQNPPKPTPSP-APPAQKAQPVTQQQASAPPTSPSAPVQA 449 Query: 967 PXXP 978 P P Sbjct: 450 PNTP 453 Score = 47.6 bits (108), Expect = 1e-05 Identities = 37/137 (27%), Positives = 37/137 (27%), Gaps = 16/137 (11%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PP P P P P P P P P P PP Sbjct: 247 PPKPIVQQAPVVQQAPPPKQQQAQAQPVQQPPNPAPVVQQASAPVQQAP-PKPVPQQTPP 305 Query: 799 XXXXPP-------PXXXXPPXPPPXPPPXPPPXPXPP---------PXXXXXPXXPXPPX 930 PP P P P P P PP PP P P P Sbjct: 306 VQQAPPKPAVQQAPTRAAPAPPKPAPQQAPPVQQNPPKPAVQQAQAPVVQQAPAPPVQQA 365 Query: 931 XPPPXPXXPPPXPXXPP 981 P P P PP PP Sbjct: 366 PPKPTPQQAPPVRQNPP 382 Score = 47.6 bits (108), Expect = 1e-05 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 9/131 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP-PXPXPXPX----PPXPXPPPPXXPPPXPXPP 780 P PP P P P P PP P P P PP P P P Sbjct: 300 PQQTPPVQQAPPKPAVQQAPTRAAPAPPKPAPQQAPPVQQNPPKPAVQQAQAPVVQQAPA 359 Query: 781 PPXXP----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PP P PP PP P P PP P P P P Sbjct: 360 PPVQQAPPKPTPQQAPPVRQNPPMPAVQQAPSSQQATQAPPKPAPQQAPPVQQNPPKPTP 419 Query: 949 XXPPPXPXXPP 981 PP P Sbjct: 420 SPAPPAQKAQP 430 Score = 46.4 bits (105), Expect = 3e-05 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 3/121 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP---PPPXXPP 798 PP P P PP P P PPP P PP P Sbjct: 224 PPVQQASPKPVAQPVQQQPVVQAPPKPIVQQAPVVQQAPPPKQQQAQAQPVQQPPNPAPV 283 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P PP PP P P P P PP P Sbjct: 284 VQQASAPVQQAP--PKPVPQQTPPVQQAPPKPAVQQAPTRAAPAPPKPAPQQAPPVQQNP 341 Query: 979 P 981 P Sbjct: 342 P 342 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/112 (27%), Positives = 31/112 (27%), Gaps = 1/112 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P P P P P P Sbjct: 277 PPNPAPVVQQASAPVQQAPPKPVPQQTPPVQQAPPKPAVQQAPTRAAPAP-PKPAPQQAP 335 Query: 796 PXXXXPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P P P PP PP P P PP P Sbjct: 336 PVQQNPPKPAVQQAQAPVVQQAPAPPVQQAPP---KPTPQQAPPVRQNPPMP 384 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/115 (25%), Positives = 29/115 (25%), Gaps = 1/115 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P PP P P PP P P PP PP Sbjct: 360 PPVQQAPPKPTPQQAPPVRQNPPMPAVQQAPSSQQATQAPPK-PAPQQAPPVQQNPPKPT 418 Query: 808 XPPPXXXXPPXP-PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P PP P P P P PP P Sbjct: 419 PSPAPPAQKAQPVTQQQASAPPTSPSAPVQAPNTPTQKASSQDPIVQQDPPPKEP 473 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/108 (26%), Positives = 29/108 (26%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PP P P P P P PP P P P P PP Sbjct: 366 PPKPTPQQAPPVRQNPPMPAVQQAPSSQQATQAPPKPAPQQAPPVQQNP-PKPTPSPAPP 424 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PP P P P P P PPP Sbjct: 425 -AQKAQPVTQQQASAPPTSPSAPVQAPN-TPTQKASSQDPIVQQDPPP 470 Score = 36.3 bits (80), Expect = 0.033 Identities = 33/132 (25%), Positives = 33/132 (25%), Gaps = 10/132 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP--PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 P PP P P P PP P PP P P P Sbjct: 180 PTQQPPVVQQTPPPQQPVVQAPVAQQAPPSQPQQAQAQPVVQQAPPVQQASPKPVAQPVQ 239 Query: 790 XPPXXXXPP-PXXXXPPXPPPXPPPXPP-----PXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P PP P P PPP P PP P PP P Sbjct: 240 QQPVVQAPPKPIVQQAPVVQQAPPPKQQQAQAQPVQQPPNPAPVVQQASAPVQQAPPKPV 299 Query: 952 X--PPPXPXXPP 981 PP PP Sbjct: 300 PQQTPPVQQAPP 311 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 6/81 (7%) Frame = +1 Query: 664 PPXPXXXXPPP----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 PP P PP PP P P P PP P P P P P Sbjct: 399 PPKPAPQQAPPVQQNPPKPTPSPAPPAQKAQPVTQQQASAPPTSPSAPVQAPNTPTQKAS 458 Query: 832 PPXP--PPXPPPXPPPXPXPP 888 P PPP P P Sbjct: 459 SQDPIVQQDPPPKEPSISSEP 479 Score = 33.1 bits (72), Expect = 0.31 Identities = 23/96 (23%), Positives = 23/96 (23%), Gaps = 1/96 (1%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P P P P PP P P P PP P Sbjct: 65 PPAAQQIPVVQQAPPAQPAQQKPVAQAPPAQAKPTVQQAPILVAQAPPNPPAPQAQQHQA 124 Query: 877 PXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P P PP Sbjct: 125 PAPPAARQIPVQQPPKPVVQQAPAQQAPKSVAQAPP 160 Score = 33.1 bits (72), Expect = 0.31 Identities = 29/120 (24%), Positives = 29/120 (24%), Gaps = 3/120 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P P P P P PP P Sbjct: 78 PPAQPAQQKPVAQAPPAQAKPTVQQAPILVAQAPPNPPAPQAQQHQAPAPPAARQIPVQQ 137 Query: 808 XPPP-XXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P P P PP PP P P Sbjct: 138 PPKPVVQQAPAQQAPKSVAQAPPAQAKPIVQQAQAQPVVQKAPTQQPPVVQQTPP-PQQP 196 Score = 28.7 bits (61), Expect = 6.7 Identities = 26/123 (21%), Positives = 26/123 (21%), Gaps = 7/123 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP----- 780 PP P PP PP P P P PP P Sbjct: 111 PPNPPAPQAQQHQAPAPPAARQIPVQQPPKPVVQQAPAQQAPKSVAQAPPAQAKPIVQQA 170 Query: 781 --PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P PP P P P PP P PP Sbjct: 171 QAQPVVQKAPTQQPPVVQQTPPPQQPVVQAPVAQQAPPSQPQQAQAQPVVQQAPPVQQAS 230 Query: 955 PPP 963 P P Sbjct: 231 PKP 233 Score = 28.7 bits (61), Expect = 6.7 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 1/109 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP P P PP P P P PP P PP P P P Sbjct: 399 PPKPAPQQAPPVQQNPPKPTP----SPAPPAQKAQPVTQQQASAPP-TSPSAPVQAPNTP 453 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P PP P P P P P P Sbjct: 454 TQKASSQDPIVQQDP-PPKEPSISSEPTTTKKPRKSFSPGSATPKHTQP 501 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/59 (25%), Positives = 15/59 (25%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P PP PPP P P PP P P Sbjct: 160 PAQAKPIVQQAQAQPVVQKAPTQQPPVVQQTPPPQQPVVQAPVAQQAPPSQPQQAQAQP 218 >M80650-1|AAA27985.1| 298|Caenorhabditis elegans alpha-collagen protein. Length = 298 Score = 54.0 bits (124), Expect = 2e-07 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P P PP P PPP P PP P P P Sbjct: 102 PGPPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGP 161 Query: 871 PXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P P P PP P P Sbjct: 162 PGDSGEPGSPGLPGQDAAPGEPGPKGPKGPPGAPGAP 198 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/129 (30%), Positives = 39/129 (30%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P PP P P P PP P PP Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGPPGDSG 166 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP------PXXXXXPXXPXPPXXP-PPXPX 951 P P P P P P PP P P P P P P P Sbjct: 167 EPGSPGLPGQDAAPGEPGPKGPKGPPGAPGAPEHQESQECPRGEPLIPGEPGPPGEAGPQ 226 Query: 952 XPPPXPXXP 978 PP P P Sbjct: 227 GPPGSPGQP 235 Score = 51.6 bits (118), Expect = 8e-07 Identities = 37/130 (28%), Positives = 37/130 (28%), Gaps = 8/130 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXP--XXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P PP P P P P P P P P PP P P Sbjct: 142 PPPWKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPKGPPGAPGAPEHQ 201 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP--PXXPPPXPXXP-- 957 P P PP P PP P P P P P P P Sbjct: 202 ESQECPRGEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADGN 261 Query: 958 --PPXPXXPP 981 P P PP Sbjct: 262 PGAPGPAGPP 271 Score = 50.0 bits (114), Expect = 3e-06 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 11/128 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX----PPXPXPPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P P Sbjct: 129 PGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAAPGEPGPKGP 188 Query: 787 XXPPXXXXPPPXXXXPPXP------PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPX 945 PP P P P P P P PP P P P P Sbjct: 189 KGPPGAPGAPEHQESQECPRGEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKG 248 Query: 946 PXXPPPXP 969 P P P Sbjct: 249 PNGPDGQP 256 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P P P P PP P P PPP P P P PP P Sbjct: 104 PPGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGP---PGPPGPPG 160 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 161 PPGDSGEPGSP 171 Score = 36.3 bits (80), Expect = 0.033 Identities = 32/126 (25%), Positives = 32/126 (25%), Gaps = 3/126 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P PP P P P Sbjct: 126 PGNPGRPPQQPCEPITPPPWKPCPQGPPGP-PGPPGPPGDSGEPGSPGLPGQDAAPG-EP 183 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXP--XXPPPX 965 P P P P P P P P PP P P P P P Sbjct: 184 GPKGPKGPPGAPGAPEHQESQECPRGEPLIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQ 243 Query: 966 PXPPPP 983 P P P Sbjct: 244 PGPKGP 249 Score = 32.7 bits (71), Expect = 0.41 Identities = 28/123 (22%), Positives = 28/123 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P PP P P P Sbjct: 158 PPGPPGDSGEPGSPGLPGQDAAPGEPGPKGPKGPPGAPGAPEHQESQEC------PRGEP 211 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P P P P P P Sbjct: 212 LIPGEPGPPGEAGPQGPPGSPGQPGADGSPGQPGPKGPNGPDGQPGADGNPGAPGPAGPP 271 Query: 975 PPP 983 P Sbjct: 272 GSP 274 Score = 32.3 bits (70), Expect = 0.54 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 6/73 (8%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXP-PPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXX 953 P P P P P P P P P P PP PP PP P P Sbjct: 120 PGAPGLPGNPGRPPQQPCEPITPPPWKPCPQGPPGPPGPPGPPGDSGEPGSPGLPGQDAA 179 Query: 954 P----PPXPXPPP 980 P P P PP Sbjct: 180 PGEPGPKGPKGPP 192 >AL132898-19|CAN99707.1| 258|Caenorhabditis elegans Hypothetical protein Y59A8B.26 protein. Length = 258 Score = 53.6 bits (123), Expect = 2e-07 Identities = 44/128 (34%), Positives = 44/128 (34%), Gaps = 6/128 (4%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GG G GG G G G GG G GG G GG GG GG Sbjct: 101 GGLGGATGGATGALGGLTGTVG--GLTNALGGATGGLGGLSGILGGATGGATGALGGLTG 158 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG----GGXXXXGXGGGXGXXG--XG 639 G G GG G G G G G GG G GG G G G Sbjct: 159 TVGGLTNALEGATGGLGGLSGILGGATGGATGALGGLTGTVGGLTNALGGATGGLGGLSG 218 Query: 638 XXGGXXGG 615 GG GG Sbjct: 219 ILGGAAGG 226 Score = 49.6 bits (113), Expect = 3e-06 Identities = 39/123 (31%), Positives = 39/123 (31%), Gaps = 2/123 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXX--GGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G GG GG GG G GG G GG G GG GG Sbjct: 115 GGLTGTVGGLTNALGGATGGLGGLSGILGGATGGATGALGGLTGTVGGLTNALEGATGGL 174 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G G GG GG G GG G GG G GG Sbjct: 175 GGLSGIL-GGATGGATGALGGLTGTVGGLTNALGGATGGLGGLSGILGGAAGGATGGLGG 233 Query: 626 XXG 618 G Sbjct: 234 ITG 236 Score = 42.7 bits (96), Expect = 4e-04 Identities = 36/99 (36%), Positives = 36/99 (36%), Gaps = 3/99 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGX-GGGXGGGXGGGXGGXXXXGGGXX 804 GG G GG G GG G GG G GG GG G G GG Sbjct: 147 GGATGALGGLTGTVGGLTNAL--EGATGGLGGLSGILGGATGGATGALGGLTGTVGGLTN 204 Query: 803 XXGGXXGG-GG-XGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG GG GG G GG GG G GG G G Sbjct: 205 ALGGATGGLGGLSGILGGAAGGATGGLGGITGNVGQVAG 243 Score = 38.3 bits (85), Expect = 0.008 Identities = 42/131 (32%), Positives = 42/131 (32%), Gaps = 9/131 (6%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX--GXXXXXGGGXGXGGGX----GGGXGGGXGGXXXX 819 G G G G G GG G G GG G GG GG GG GG Sbjct: 83 GAVTGVVDGVTGTVGDLTGGLGGATGGATGALGGLTGTVGGLTNALGGAT-GGLGGLSGI 141 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG-XGGGGGXXXXGXGGGXGXXG- 645 GG GG G GG GG G G GG G GG G G Sbjct: 142 LGGATGGATGALGGLTGTVGGLTNALEGATGGLGGLSGILGGATGGATGALGGLTGTVGG 201 Query: 644 -XGXXGGXXGG 615 GG GG Sbjct: 202 LTNALGGATGG 212 Score = 34.3 bits (75), Expect = 0.14 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG-GXGXGG--GXXGGGGXGXGGXGXGXGXG 699 GG GG G G G G GG G GG G GG GG G Sbjct: 72 GGVAGGATGSLGAVTGVVDGVTGTVGDLTGGLGGATGGATGALGGLTGTVGGLTNALGGA 131 Query: 698 GGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GG G GG G Sbjct: 132 TGGLGGLSGILGGATGGATGALGGLTG 158 Score = 33.5 bits (73), Expect = 0.24 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 2/90 (2%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G G G G GG GG GG GG GG G Sbjct: 76 GGATGSLGAVTGVVDGVTGTVGDLTGGL---GGATGGATGALGGLTGTVGGLTNALGGAT 132 Query: 710 XGXGGGGGXXXXGXGGGXGXXG--XGXXGG 627 G GG G GG G G G GG Sbjct: 133 GGLGGLSGILGGATGGATGALGGLTGTVGG 162 >AF326941-1|AAG49391.1| 139|Caenorhabditis elegans 5H1 protein. Length = 139 Score = 53.6 bits (123), Expect = 2e-07 Identities = 37/85 (43%), Positives = 37/85 (43%), Gaps = 7/85 (8%) Frame = -3 Query: 887 GGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG--GXXGGGGXG----X 729 G G GG G GG G G G G G GG GGG G G G GGGG G Sbjct: 35 GSYGTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPGVGGGPGAFGPYGRYGGGGYGGYGRY 94 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG GG G GGG G Sbjct: 95 GRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXX 804 G G G G G GG GG G G GG G GGG G G G GG G G Sbjct: 38 GTVGGAGLGGPGIGGPGLGGPGIGGPGL---GGPGVGGGPGAFGPYGRYGGGGYGGYGRY 94 Query: 803 XXGGXXGG-GGXGXGGGXXGGGGXG 732 G GG GG G GG GGG G Sbjct: 95 GRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 50.8 bits (116), Expect = 1e-06 Identities = 39/92 (42%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG-GXGGGXGGGXGGXXXXGGGXXX 801 G G GG G GG GG G G GG G GG G GGG G G GGG Sbjct: 35 GSYGTVGGA-GLGGPGIGGPGLGGPGI---GGPGLGGPGVGGGP-GAFGPYGRYGGG--G 87 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G G GG G GG G G G G G Sbjct: 88 YGGYGRYGRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 49.2 bits (112), Expect = 4e-06 Identities = 39/89 (43%), Positives = 39/89 (43%), Gaps = 6/89 (6%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG--GXXGGGGXGXG 762 G G G G GG G GG GG G G G GGG G G GGGG G Sbjct: 35 GSYGTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPG---VGGGPGAFGPYGRYGGGGYGGY 91 Query: 761 G--GXXG--GGGXGXGGXGXGXGXGGGGG 687 G G G GG G GG G G G GGG G Sbjct: 92 GRYGRYGRYGGYGGYGGYG-GPGYGGGPG 119 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/65 (46%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -3 Query: 794 GXXGGGGXGXGG-GXXGGGGXGXGGXG-XGXGXGGG-GGXXXXGXGGGXGXXGXGXXG-- 630 G GG G G G G G GG G GG G G G GGG G G GG G G G G Sbjct: 38 GTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPGVGGGPGAFGPYGRYGGGGYGGYGRYGRY 97 Query: 629 GXXGG 615 G GG Sbjct: 98 GRYGG 102 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 985 GGGGGXGXGG-GXXGXXGGXGXGXGXXXXGGXGGG 884 GGGG G G G G GG G G G G GGG Sbjct: 84 GGGGYGGYGRYGRYGRYGGYG-GYGGYGGPGYGGG 117 >AF125955-7|AAD14713.1| 139|Caenorhabditis elegans Hypothetical protein F46E10.2 protein. Length = 139 Score = 53.6 bits (123), Expect = 2e-07 Identities = 37/85 (43%), Positives = 37/85 (43%), Gaps = 7/85 (8%) Frame = -3 Query: 887 GGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG--GXXGGGGXG----X 729 G G GG G GG G G G G G GG GGG G G G GGGG G Sbjct: 35 GSYGTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPGVGGGPGAFGPYGRYGGGGYGGYGRY 94 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG GG G GGG G Sbjct: 95 GRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXX 804 G G G G G GG GG G G GG G GGG G G G GG G G Sbjct: 38 GTVGGAGLGGPGIGGPGLGGPGIGGPGL---GGPGVGGGPGAFGPYGRYGGGGYGGYGRY 94 Query: 803 XXGGXXGG-GGXGXGGGXXGGGGXG 732 G GG GG G GG GGG G Sbjct: 95 GRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 50.8 bits (116), Expect = 1e-06 Identities = 39/92 (42%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG-GXGGGXGGGXGGXXXXGGGXXX 801 G G GG G GG GG G G GG G GG G GGG G G GGG Sbjct: 35 GSYGTVGGA-GLGGPGIGGPGLGGPGI---GGPGLGGPGVGGGP-GAFGPYGRYGGG--G 87 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG G G GG G GG G G G G G Sbjct: 88 YGGYGRYGRYGRYGGYGGYGGYGGPGYGGGPG 119 Score = 49.2 bits (112), Expect = 4e-06 Identities = 39/89 (43%), Positives = 39/89 (43%), Gaps = 6/89 (6%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG--GXXGGGGXGXG 762 G G G G GG G GG GG G G G GGG G G GGGG G Sbjct: 35 GSYGTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPG---VGGGPGAFGPYGRYGGGGYGGY 91 Query: 761 G--GXXG--GGGXGXGGXGXGXGXGGGGG 687 G G G GG G GG G G G GGG G Sbjct: 92 GRYGRYGRYGGYGGYGGYG-GPGYGGGPG 119 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/65 (46%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -3 Query: 794 GXXGGGGXGXGG-GXXGGGGXGXGGXG-XGXGXGGG-GGXXXXGXGGGXGXXGXGXXG-- 630 G GG G G G G G GG G GG G G G GGG G G GG G G G G Sbjct: 38 GTVGGAGLGGPGIGGPGLGGPGIGGPGLGGPGVGGGPGAFGPYGRYGGGGYGGYGRYGRY 97 Query: 629 GXXGG 615 G GG Sbjct: 98 GRYGG 102 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 985 GGGGGXGXGG-GXXGXXGGXGXGXGXXXXGGXGGG 884 GGGG G G G G GG G G G G GGG Sbjct: 84 GGGGYGGYGRYGRYGRYGGYG-GYGGYGGPGYGGG 117 >AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical protein R148.5b protein. Length = 505 Score = 53.6 bits (123), Expect = 2e-07 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 7/98 (7%) Frame = +1 Query: 691 PPPPXPXPXPXP---PXPXPPPPXX--PPP--XPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P P P P PPP PPP PPPP PPP PPP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFM----PPPP 325 Query: 850 XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP PPP P PP PPP P P Sbjct: 326 HFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRP 363 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/94 (36%), Positives = 34/94 (36%), Gaps = 2/94 (2%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX--PPXXXXPPPXXXXPPXPPPXPPPXP 867 PPP P P P PP PPPP PP PPP PPP PP P Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPP----PPPHFMGRGMPPPFMPP-P 324 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P PPP P Sbjct: 325 PHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPP 358 Score = 50.0 bits (114), Expect = 3e-06 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 14/98 (14%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPPPP------XXPPPXPXPPP--PX 789 P P P PP P PPP P P PPPP PPP PPP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGM 329 Query: 790 XPPXXXXPPP---XXXXPPXPPPXPPPXPP-PXPXPPP 891 PP PPP P PP PPP P P PP Sbjct: 330 GPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPP 367 Score = 48.4 bits (110), Expect = 8e-06 Identities = 35/99 (35%), Positives = 35/99 (35%), Gaps = 18/99 (18%) Frame = +1 Query: 619 PXXPPXXPXPXXPXP----PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX---------P 759 P P P P P PP P PPPPP PP PPPP P Sbjct: 278 PPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMP 337 Query: 760 PPXP-----XPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP P P PP PP PPP P PP P Sbjct: 338 PPHPMMFRGGPYPPFFPP----PPPHFMRPSSPPTDGGP 372 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXX-PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 PP PP P P PPP PPP P PPP P P PP Sbjct: 271 PPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMG 330 Query: 954 PPPXPXPPP 980 PP PPP Sbjct: 331 PPRGFMPPP 339 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/98 (28%), Positives = 28/98 (28%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPP PP PP PP P PPP P PP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGM 329 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P PP P PP P P Sbjct: 330 GPPRGFMP-PPHPMMFRGGPYPPFFPPPPPHFMRPSSP 366 Score = 35.9 bits (79), Expect = 0.044 Identities = 28/107 (26%), Positives = 28/107 (26%), Gaps = 6/107 (5%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPX-PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXX----- 776 P P PP P P PPPP PP P Sbjct: 271 PPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMG 330 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 PP PP P PP P PPP PP P P Sbjct: 331 PPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGPIITGP 377 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP P P P P P PP P P P P PP P P Sbjct: 324 PPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGPIITGP 377 >AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical protein R148.5a protein. Length = 528 Score = 53.6 bits (123), Expect = 2e-07 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 7/98 (7%) Frame = +1 Query: 691 PPPPXPXPXPXP---PXPXPPPPXX--PPP--XPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P P P P PPP PPP PPPP PPP PPP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFM----PPPP 325 Query: 850 XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PP PPP P PP PPP P P Sbjct: 326 HFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRP 363 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/94 (36%), Positives = 34/94 (36%), Gaps = 2/94 (2%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX--PPXXXXPPPXXXXPPXPPPXPPPXP 867 PPP P P P PP PPPP PP PPP PPP PP P Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPP----PPPHFMGRGMPPPFMPP-P 324 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P PPP P Sbjct: 325 PHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPP 358 Score = 50.0 bits (114), Expect = 3e-06 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 14/98 (14%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPPPP------XXPPPXPXPPP--PX 789 P P P PP P PPP P P PPPP PPP PPP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGM 329 Query: 790 XPPXXXXPPP---XXXXPPXPPPXPPPXPP-PXPXPPP 891 PP PPP P PP PPP P P PP Sbjct: 330 GPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPP 367 Score = 48.4 bits (110), Expect = 8e-06 Identities = 35/99 (35%), Positives = 35/99 (35%), Gaps = 18/99 (18%) Frame = +1 Query: 619 PXXPPXXPXPXXPXP----PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX---------P 759 P P P P P PP P PPPPP PP PPPP P Sbjct: 278 PPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMP 337 Query: 760 PPXP-----XPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP P P PP PP PPP P PP P Sbjct: 338 PPHPMMFRGGPYPPFFPP----PPPHFMRPSSPPTDGGP 372 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXX-PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 PP PP P P PPP PPP P PPP P P PP Sbjct: 271 PPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMG 330 Query: 954 PPPXPXPPP 980 PP PPP Sbjct: 331 PPRGFMPPP 339 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/98 (28%), Positives = 28/98 (28%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPP PP PP PP P PPP P PP Sbjct: 270 PPPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGM 329 Query: 870 XXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P PP P PP P PP P P Sbjct: 330 GPPRGFMP-PPHPMMFRGGPYPPFFPPPPPHFMRPSSP 366 Score = 35.9 bits (79), Expect = 0.044 Identities = 28/107 (26%), Positives = 28/107 (26%), Gaps = 6/107 (5%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPX-PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXX----- 776 P P PP P P PPPP PP P Sbjct: 271 PPHHPYGPPHPMHHPYAMMPPPFGFFPPPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMG 330 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXP 917 PP PP P PP P PPP PP P P Sbjct: 331 PPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGPIITGP 377 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP P P P P P PP P P P P PP P P Sbjct: 324 PPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGPIITGP 377 >Z69658-1|CAA93481.1| 418|Caenorhabditis elegans Hypothetical protein C36H8.1 protein. Length = 418 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP---PXPPP 861 PPPP P P PP P PPP P P P P P PP P P P P Sbjct: 177 PPPPRPPPQE-PPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPAP 235 Query: 862 XPPPXPXPP 888 P P PP Sbjct: 236 VEPSDPAPP 244 Score = 52.8 bits (121), Expect = 4e-07 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 1/77 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P PPP P P P PP P P P P P PPP P P Sbjct: 177 PPPPR---PPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAP 233 Query: 844 PPXPPPXP-PPXPXPPP 891 P P P PP P P Sbjct: 234 APVEPSDPAPPSKLPSP 250 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/75 (34%), Positives = 26/75 (34%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P PP PPPPP P P P P P P P PP P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAP-PPAPVQDPAPAP 235 Query: 811 PPPXXXXPPXPPPXP 855 P PP P P Sbjct: 236 VEPSDPAPPSKLPSP 250 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP--PXXPPPXPXPPPPXXPPX 801 PP P P P P PPP P P P P P P P PPP P P P Sbjct: 178 PPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPAPVE 237 Query: 802 XXXPPPXXXXP 834 P P P Sbjct: 238 PSDPAPPSKLP 248 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP-PXPPPXPPPXPPPXP-XPPPXX 897 PP P PPP P P PP PP P P P P P P PPP P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPP--PPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPA 234 Query: 898 XXXPXXPXPPXXPP 939 P P PP P Sbjct: 235 PVEPSDPAPPSKLP 248 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXPPXXPPPXP 948 PPP PP P P P PPP P P P P P P P P P P P P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAP-PPAPVQDPAPAP 235 Query: 949 XXP-PPXP 969 P P P Sbjct: 236 VEPSDPAP 243 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P P PP P P P P P P P P P P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPAPV 236 Query: 957 PPXPXPPP 980 P PP Sbjct: 237 EPSDPAPP 244 Score = 46.8 bits (106), Expect = 2e-05 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XX 915 PPPP PP PP P PP P P P P P PPP P Sbjct: 177 PPPPRPPP--QEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPA 234 Query: 916 PXPPXXPPPXPXXPPP 963 P P P P P P Sbjct: 235 PVEPSDPAPPSKLPSP 250 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP-XXPPPXPXPPPPXX 792 PP PP P PPP P P P P P PP P P P P P Sbjct: 183 PPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPAPVEPSDPA 242 Query: 793 PPXXXXPP 816 PP P Sbjct: 243 PPSKLPSP 250 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPP-XXPXP----PPPXPPXXXXPXPXPXPPXXPXXPPP 962 PP P P P P PP PP P P P P P P P P P P Sbjct: 177 PPPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDPAPAPV 236 Query: 963 XPXPPPP 983 P P P Sbjct: 237 EPSDPAP 243 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +1 Query: 841 PPPXPPPXPPP------XPXPPPXXXXXPXXPXPPXXPPP-XPXXPPPXPXXPP 981 PPP PPP PP P PPP P P P P PPP P P Sbjct: 178 PPPRPPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQDP 231 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 5/71 (7%) Frame = +3 Query: 777 PPXPXPXPP----XPXXPXXXXPPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPX 941 PP P P P P P P P P P P PPP P P P P P Sbjct: 182 PPPQEPPKPVEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAP--VQDPAPAPVEPS 239 Query: 942 XPXXPPPXPXP 974 P P P P Sbjct: 240 DPAPPSKLPSP 250 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 1/81 (1%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP PP P PPPP P PP P Sbjct: 180 PRPPPQEPPKP----------VEQAAPPPPPAPMPVPVEKAPEPVPAPVEQIAPPPAPVQ 229 Query: 795 XP-PXPXXPXXXXPPPXXPXP 854 P P P P PP P P Sbjct: 230 DPAPAPVEPSDPAPPSKLPSP 250 >AC024859-14|AAY43989.1| 643|Caenorhabditis elegans Hypothetical protein Y71H2AM.19 protein. Length = 643 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G GG G GG G G GG GGG GGG GGGG GG G G Sbjct: 562 GDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGG-GGGFQ 620 Query: 704 XGGGGG 687 GGGGG Sbjct: 621 SGGGGG 626 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G GGG G G G G G GGGG G GGG GGG GG G Sbjct: 562 GDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQS 621 Query: 707 GXGGG 693 G GGG Sbjct: 622 GGGGG 626 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG GG G G G GG GG GGGG G GG GGGG G G G Sbjct: 567 GGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGGGG 626 Score = 49.2 bits (112), Expect = 4e-06 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G GGG G GG G GG GGG GGG G G GG GGG Sbjct: 562 GDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQS 621 Query: 797 GGXXGGG 777 GG GGG Sbjct: 622 GG--GGG 626 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 G G GGG GG G G G GG G GG G G G G GGG G GG Sbjct: 559 GMSGDMRSGGGYRGRGGRGNGQRFG-GRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGG 617 Query: 662 GXGXXGXG 639 G G G Sbjct: 618 GFQSGGGG 625 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/63 (44%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 GGG G G G G GG G GGG GGGG GG G GGGGG G Sbjct: 567 GGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGG---GQRSGGGGGFQSGG 623 Query: 671 XGG 663 GG Sbjct: 624 GGG 626 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G GGG G G G GG G G GG GG GGG GG GG Sbjct: 562 GDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGG--GGF 619 Query: 776 GXGXGGG 756 G GGG Sbjct: 620 QSGGGGG 626 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G G GG GG G G G GG GGG GG GG GGG Sbjct: 575 GRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGGGG 626 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/81 (32%), Positives = 27/81 (33%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G GG G G G G G GG G G G GG GG G GG G G Sbjct: 562 GDMRSGGGYRGRG-GRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQ 620 Query: 632 GGXXGGXXXXXXXAXSXRSTW 570 G GG + W Sbjct: 621 SGGGGGRQQQQQQRAQPQQDW 641 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXG-XXGGGXXXXGXXG 806 GGG G GG G G G G GGGG G GG GGG GGG G G Sbjct: 567 GGGYRGRGGRGNGQRFG-GRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGGG 625 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G GG G G G GG G GG GGG G GG GGG Sbjct: 568 GGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQRSGGGGGFQSGGG 624 Score = 32.7 bits (71), Expect = 0.41 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 G G GGG G GG G G GG G GG GG G GGG Sbjct: 559 GMSGDMRSGGGYRGR-GGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGG-------- 609 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 610 -GQRSGGGGG 618 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG G GG GG G GGG G G GGG G G Sbjct: 9 GGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGGNRGYN--NNRGGGGGGYNRQDRGDG 66 Query: 665 G 663 G Sbjct: 67 G 67 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/76 (26%), Positives = 20/76 (26%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G G G G GGG G G GG G G G Sbjct: 29 GGDGGAAAAASAGGGNRGYNNNRGGGGGGYNRQDRGDGGS-SNFSRGGYNNRDEGSDNRG 87 Query: 779 GGXGXGGGXXGGGGXG 732 G GG G Sbjct: 88 SGRSYNNDRRDNGGDG 103 >AC024772-3|AAF60538.1| 2344|Caenorhabditis elegans Hypothetical protein Y40C5A.3 protein. Length = 2344 Score = 53.2 bits (122), Expect = 3e-07 Identities = 36/106 (33%), Positives = 36/106 (33%), Gaps = 9/106 (8%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPP-PXXPPPXPXP---PPPXXP-PXXXXPPPXXXXP-PXPPP 849 P P P P P P P P P P P P P P P P P P P Sbjct: 1982 PQPTTYQRPHPIKVQVRPATKPYRPRPSPAPRIQPRPYNPQPVVVQRPQFRPQPQPRPQP 2041 Query: 850 XPPPXPPPXPXPPPXXXXXPXXPXP---PXXPPPXPXXPPPXPXXP 978 P P P P P P P P P PPP P P P P P Sbjct: 2042 QPQPQPQPQPQPQQPYIQRPALTLPFQQPQYPPPIPFQPRPAPFIP 2087 Score = 49.2 bits (112), Expect = 4e-06 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P P P P P P P P P P P P P P P P P P Sbjct: 2003 PYRPRPSPAPRIQPRPYNPQPVVVQRPQFRPQPQPRPQPQPQPQPQPQPQPQQPYIQRPA 2062 Query: 823 XXXPPXPPPXPPPXP-PPXPXP 885 P P PPP P P P P Sbjct: 2063 LTLPFQQPQYPPPIPFQPRPAP 2084 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = +1 Query: 727 PXPXPPP-PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX-PPPXPPPXPXPPPXXX 900 P P P P P P P P P P P P P P P P P P P Sbjct: 545 PAPAPQPSPSSPVYGPTPSEPAKPSM-----PSGESPAQPEPSIPAVNPEPSPSQPSSSG 599 Query: 901 XXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PPP P P Sbjct: 600 PIQTAPPSPSSPNAIPEGPPPGPDVP 625 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P PP P P Sbjct: 553 PSSPVYGPTPSEPAKPSMPSGESPAQPEPSIPAVNPEPSPSQPSSSGPIQTAPPSPSSPN 612 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPP 870 PP P PPP P Sbjct: 613 AIPEGPPPGPDVPVMIALPPPKSP 636 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P P P P P P P P P P P P PP P P P Sbjct: 1714 PAPAPVTQPAVQPAPGPVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQPLPQP 1773 Query: 949 XXPPPXPXXP 978 P P Sbjct: 1774 QPTEPEEPLP 1783 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/92 (28%), Positives = 26/92 (28%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P P P P P P P P P P P P P P Sbjct: 545 PAPAPQPSPSSPVYGPTPSEPAKPSMPSGESPAQPEPSIPAVNPEPSPSQPSSSGPIQTA 604 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP P P PPP Sbjct: 605 PPSPSSPNAIPEGPP---PGPDVPVMIALPPP 633 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 1/99 (1%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P P P PP P P P P P P P P Sbjct: 1738 PAPGPAPG---PALEPAPAPTSAPQIVEPLPPVQPLPQPQPTEPEEPLPIATPAPQPTEH 1794 Query: 835 PXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXP 948 P P P P P P P P P Sbjct: 1795 TYGAQGPNIVPVVTAAPYVPQETQAPIAPSNPEPVQPNP 1833 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 1/97 (1%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P P P P P P P P P P P P P P P P P Sbjct: 545 PAPAPQPSPSSPVYGPTP--SEPAKPSMPSGESP--AQPEPSIPAVNPEPSPSQPSSSGP 600 Query: 874 XPXPPPXXXXXPXXPXP-PXXPPPXPXXPPPXPXXPP 981 PP P P P PPP P P PP Sbjct: 601 IQTAPP----SPSSPNAIPEGPPPGPDVPVMIALPPP 633 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 2/90 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP-PPXXPPPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P P P P Sbjct: 545 PAPAPQPSPSSPVYGPTPSEPAKPSMPS-GESPAQPEPSIPAVNPEPSPSQPSSSGPIQT 603 Query: 805 XXPPPXXXXP-PXPPPXPPPXPPPXPXPPP 891 P P P PP P P PPP Sbjct: 604 APPSPSSPNAIPEGPPPGPDVPVMIALPPP 633 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 1/84 (1%) Frame = +1 Query: 700 PXPXPXPXPPX-PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 P P P P P P P P P P P P P P P PP P P Sbjct: 1714 PAPAPVTQPAVQPAPGPVEHRYEIPAPGPAPGPALEPAPAPTSA-PQIVEPLPPVQPLPQ 1772 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P P P P P Sbjct: 1773 PQP-----TEPEEPLPIATPAPQP 1791 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/89 (25%), Positives = 23/89 (25%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P PP P P P P P P P P Sbjct: 1740 PGPAPGPALEPAPAPTSAPQIVEPLPPVQPLPQPQPTEPEEPLPIATPAPQPTEHTYGAQ 1799 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P P P P P P P Sbjct: 1800 GPNIVPVVTAAPYVPQETQAPIAPSNPEP 1828 Score = 38.3 bits (85), Expect = 0.008 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 6/93 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPP----PXPXPXPXP-PXPXPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P P P P P P Sbjct: 1999 PATKPYRPRPS-PAPRIQPRPYNPQPVVVQRPQFRPQPQPRPQPQPQPQPQPQPQPQQPY 2057 Query: 784 PXXPPXXXXPPPXXXXPPXP-PPXPPPXPPPXP 879 P PP P P P P P P Sbjct: 2058 IQRPALTLPFQQPQYPPPIPFQPRPAPFIPFQP 2090 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P P P P P P P P Sbjct: 1714 PAPAPVTQ-PAVQPAPGPVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQPLPQ 1772 Query: 841 PPPXPPPXPPPXPXPPP 891 P P P P P P P Sbjct: 1773 PQPTEPEEPLPIATPAP 1789 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 9/77 (11%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXP-----PPXXPXPPPXPPXXPXPPPPXPPXXXXPX----PXPX 932 P P P P P P P P P P P P P P P P Sbjct: 2006 PRPSPAPRIQPRPYNPQPVVVQRPQFRPQPQPRPQPQPQPQPQPQPQPQQPYIQRPALTL 2065 Query: 933 PPXXPXXPPPXPXPPPP 983 P P PPP P P P Sbjct: 2066 PFQQPQYPPPIPFQPRP 2082 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G GGG GGG GG G GGGGG Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGGG 2160 Score = 37.1 bits (82), Expect = 0.019 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 780 PXPX-PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP----PXXXXPXPXP-XPPX 941 P P P P P P P P P P P P P P P P P PP Sbjct: 2016 PRPYNPQPVVVQRPQFRPQPQPRPQPQPQPQPQPQPQPQQPYIQRPALTLPFQQPQYPPP 2075 Query: 942 XPXXPPPXPXPP 977 P P P P P Sbjct: 2076 IPFQPRPAPFIP 2087 Score = 36.3 bits (80), Expect = 0.033 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 4/121 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX-PPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P P P P P P Sbjct: 1714 PAPAPVTQPAVQPAPGPVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQPLP-Q 1772 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP--PPXPXXPPPX 966 P P P P P P P P P P P P P Sbjct: 1773 PQPTEPEEPLPIATPAPQPTEHTYGAQGPNIVPVVTAAPYVPQETQAPIAPSNPEPVQPN 1832 Query: 967 P 969 P Sbjct: 1833 P 1833 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GGG GGG G GG GG GGGG G Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 837 PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P P P P P P P P P P P P P P Sbjct: 2003 PYRPRPSPAPRIQPRPYNPQPVVVQRPQFRPQPQPRP-QPQPQPQPQP 2049 Score = 35.1 bits (77), Expect = 0.077 Identities = 26/106 (24%), Positives = 26/106 (24%), Gaps = 2/106 (1%) Frame = +1 Query: 631 PXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P P P P P P P P P P P P P Sbjct: 393 PSAPSPASPSSVSVTIPRVALPASVSVPSPSPASNVPVTITLSAPAKSPATYGPAPEPSR 452 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PP P P P P P P P P P P Sbjct: 453 PAVPPVAPAPSVIPTSSQPSQPKQTQPAQPTPSAPKIPEGPAQPSP 498 Score = 35.1 bits (77), Expect = 0.077 Identities = 27/98 (27%), Positives = 27/98 (27%), Gaps = 6/98 (6%) Frame = +1 Query: 661 PPPXPXXXXPPP----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXX 828 P P P P P P P P P P PP P P P P Sbjct: 420 PSPSPASNVPVTITLSAPAKSPATYGPAPEPSRPAVPP--VAPAPSVIPTSSQPSQPKQT 477 Query: 829 XPPXPPPXPPPXP--PPXPXPPPXXXXXPXXPXPPXXP 936 P P P P P P P P P P P Sbjct: 478 QPAQPTPSAPKIPEGPAQPSPNAVKTSYGSSPAAPRVP 515 Score = 35.1 bits (77), Expect = 0.077 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 2/86 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXP-PPPXXPPPXPXPPPPX 789 P P P P P P P P P P P P P P P P P P P Sbjct: 2008 PSPAPRIQPRPYNPQPV---VVQRPQFRPQPQPRPQPQPQPQPQPQPQPQQPYIQRPALT 2064 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXP 867 P PP P P P P P Sbjct: 2065 LPFQQPQYPPPIPFQPRPAPFIPFQP 2090 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG GG GGG GGG GG G GG G Sbjct: 2131 GGGC---GGGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPPXP-XPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P PP Sbjct: 547 PAPQPSPSSPVYGPTPSEPAKPSMPSGESPAQPEPSIPAVNPEPSPSQPSSSGPIQTAPP 606 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P PP P P P P P Sbjct: 607 SPSSPNAIPEGPPPGPDVPVMIALPPPKSP 636 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 GGG GG GGG GG GG G GGG Sbjct: 2131 GGGCGG-GCSGGGNSCGGGCNSGGSCGGGGG 2160 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP--PXXPX 950 P P P P P P P P P PP P P P P P P Sbjct: 571 PSGESPAQPEPSIPAVN-PEPSPSQPSSSGPIQTAPPSPSSPNAIPEGPPPGPDVPVMIA 629 Query: 951 XPPP 962 PPP Sbjct: 630 LPPP 633 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG 843 GG GG G G GGG GG GGG GG Sbjct: 2131 GGGCGG-GCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 973 GXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG 875 G G GGG G GG G G G GGGG G Sbjct: 2131 GGGCGGGCSG--GGNSCGGGCNSGGSCGGGGGG 2161 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 889 GGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXG 791 GGG G GG GG GGG G G GG G Sbjct: 2131 GGGCG--GGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXP 909 P P P P P P P P P PP P P P P P Sbjct: 420 PSPSPASNVPVTITLSAPAKSPATYGPAPEPSRPAVPPVAPAPSVIPTSSQPSQPKQTQP 479 Query: 910 XXPXPPXXP-PPXPXXPPP 963 P P P P P P Sbjct: 480 AQPTPSAPKIPEGPAQPSP 498 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P P PP P P P P P P Sbjct: 1726 PAPGPVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQ--PLPQP-QPTEPEEPL 1782 Query: 960 PXPXPPP 980 P P P Sbjct: 1783 PIATPAP 1789 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P P P P P P P P P P P P Sbjct: 1740 PGPAPGPALEPAPAPTSAPQIVEPLPPVQP--LPQPQPTEPEEPLP 1783 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 780 PXPXPXP-PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXX-PXPXPXPPXXPXX 953 P P P P P P P P P P P PP P P P P P Sbjct: 2033 PQPQPRPQPQPQPQPQPQPQPQQPYIQRPALTLPFQQPQYPPPIPFQPRPAPFIPFQPMV 2092 Query: 954 PPPXP 968 P P Sbjct: 2093 QRPSP 2097 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX-PPXPXPPP--PXXPPPXPXPPPP 786 P P P P P P P P P P PP P P P PPP P P Sbjct: 571 PSGESPAQPEPSIPAVNPEPS---PSQPSSSGPIQTAPPSPSSPNAIPEGPPPGPDVPVM 627 Query: 787 XXPPXXXXP 813 P P Sbjct: 628 IALPPPKSP 636 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG G GG GGG GG G GGGG Sbjct: 2131 GGGCGGGCSG--GGNSCGGGCNSGG---SCGGGGGG 2161 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGG 864 G GGG GG G GG G GGG Sbjct: 2133 GCGGGCSGGGNSCGGGCNSGGSCGGGGG 2160 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P P P P P P P PP P P Sbjct: 1714 PAPAPVTQPAVQPAPGPVEHRYEIPAPGPAPGPALEPAPAPTSAPQIVEPLPPVQP-LPQ 1772 Query: 960 PXPXPP 977 P P P Sbjct: 1773 PQPTEP 1778 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -3 Query: 746 GGGXGXGGXGXGXGXGGG--GGXXXXGXGGG 660 GGG G G G G GGG G G GGG Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G G G G G G GG GGG GG Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 28.7 bits (61), Expect = 6.7 Identities = 28/129 (21%), Positives = 28/129 (21%), Gaps = 8/129 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P P P P P Sbjct: 456 PPVAPAPSVIPTSSQPSQPKQTQPAQPTPSAPKIPEGPAQPSPNAVKTSYGSSPAAPRVP 515 Query: 796 PXXXXPPPXXXXPPXPPPXPPP------XPPPXPXPPPXXXXXPXXPXPPXXP--PPXPX 951 P P P P P P P P P P P P Sbjct: 516 EMIEVAPGNVEKTPDQTDNQVPETSHEMAPAPAPQPSPSSPVYGPTPSEPAKPSMPSGES 575 Query: 952 XPPPXPXXP 978 P P P Sbjct: 576 PAQPEPSIP 584 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 2037 PRPQPQPQPQPQ-PQPQPQQPYIQRPALTLPFQQPQYPPPIPFQPRPAPFIPFQPMVQRP 2095 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXG 733 GG G G GG GG GGGG G Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGGGG 2161 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 916 GXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G GG GGG GG G GGG Sbjct: 2131 GGGCGGGCSGGGNSCGGGCNSGGSCGGGG 2159 >Z72514-1|CAA96674.1| 428|Caenorhabditis elegans Hypothetical protein T10B10.1 protein. Length = 428 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/125 (27%), Positives = 34/125 (27%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P PP PP P P PP Sbjct: 285 PPSSGTSAPQPPPRGSTAAPGTRAPPATRAPPATRAPPATTRAPPATTRPAPASQPPVRE 344 Query: 796 PXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P P P P P P P P P P P PPP Sbjct: 345 PETPDSGYPSPAPQEPAHPSPSYPSPSYPSPSYPSPSYPSPSYPSPSYPAEPAYSVPPPA 404 Query: 967 PXXPP 981 P Sbjct: 405 KPEQP 409 Score = 48.0 bits (109), Expect = 1e-05 Identities = 32/112 (28%), Positives = 32/112 (28%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P PP PP P P PP P P P P P P P Sbjct: 309 PPATRAPPATRAPPATTRA-PPATTRPAPASQPPVREPETPDSGYPSPAPQEPAH-PSPS 366 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P P P P P P P P P P P P Sbjct: 367 YPSPSYPSPSYPSPSYPSPSYPSPSYPAEPAYSVPPPAKPEQPSGGYDAPSP 418 Score = 46.0 bits (104), Expect = 4e-05 Identities = 27/92 (29%), Positives = 27/92 (29%), Gaps = 1/92 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX-PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP P P P P P P P P P P P P P P P P Sbjct: 328 PPATTRPAPASQPPVREPETPDSGYPSPAPQEPAHPSPSYPSPSYPSPSYPSPSYPSPSY 387 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P PP P P P PP Sbjct: 388 PSPSYPAEPAYSVPPPAKPEQPSGGYDAPSPP 419 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/101 (28%), Positives = 29/101 (28%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P P P P P P P P P P Sbjct: 321 PPATTRAPPATTRPAPASQPPVREPETPDSGYPSPAPQEPAHPSPSYPSP-SYPSPSYPS 379 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P PP P P P P Sbjct: 380 PSYPSPSYPSPSYPAEPAYSVP-PPAKPEQPSGGYDAPSPP 419 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPX 965 P P P P P P P P P P P P P P P PP P P Sbjct: 353 PSPAPQEPAHPSPSYPSPSYPSPSYPSPSYPSPSYPSPSYPAEPAYSVPPPAKPEQPSGG 412 Query: 966 PXPPPP 983 P P Sbjct: 413 YDAPSP 418 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/99 (27%), Positives = 27/99 (27%), Gaps = 4/99 (4%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX--P 867 P P PP P PP P P PP PP PP P Sbjct: 275 PCPQRQDDRTPPSSGTSAPQPPPRGSTAAPGTRAPPATRAPPATRAPPATTRAPPATTRP 334 Query: 868 PPXPXPPPXXXXXP--XXPXPPXXPPPXPXXPPPXPXXP 978 P PP P P P P P P P P Sbjct: 335 APASQPPVREPETPDSGYPSPAPQEPAHPSPSYPSPSYP 373 >AF047659-10|AAC04430.1| 798|Caenorhabditis elegans Hypothetical protein K07H8.10 protein. Length = 798 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/94 (37%), Positives = 35/94 (37%), Gaps = 6/94 (6%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G GGG G GG G GGG GG G G GG G G G G G Sbjct: 8 GRGGGGFRGGRGGGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPG 67 Query: 698 G-----GGGXXXXGXGGG-XGXXGXGXXGGXXGG 615 G GG G GGG G G GG GG Sbjct: 68 GFRGDREGGFSPRGRGGGFRGGDRGGFRGGDRGG 101 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/109 (33%), Positives = 37/109 (33%), Gaps = 4/109 (3%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G GGG G GG G GG G GG G G Sbjct: 11 GGGFRGGRGGGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPGGFR 70 Query: 761 GGXXGG-GGXGXGGXGXGXGXGGGGGXXXXG---XGGGXGXXGXGXXGG 627 G GG G GG G GG G G GG G G GG Sbjct: 71 GDREGGFSPRGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRGGDRGG 119 Score = 48.0 bits (109), Expect = 1e-05 Identities = 42/130 (32%), Positives = 42/130 (32%), Gaps = 9/130 (6%) Frame = -3 Query: 977 GXXGXGGGXX--GXGGGXXGGXGXXGXXXXXGGGXGX------GGGXGGGXGGGXGGXXX 822 G G G G G GGG GG GG G GG G GG G Sbjct: 16 GGRGGGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPGGFRGDREG 75 Query: 821 XGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 GG GG G GG GG G G G G GG G G G Sbjct: 76 GFSPRGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRG-GDRGGSPWRGGDRGVANRGR 134 Query: 641 G-XXGGXXGG 615 G GG GG Sbjct: 135 GDFSGGSRGG 144 Score = 47.2 bits (107), Expect = 2e-05 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 7/115 (6%) Frame = -3 Query: 968 GXGGGXXGXGGG-----XXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 G GG G GGG GG G G G GG G G GG G Sbjct: 10 GGGGFRGGRGGGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPGGF 69 Query: 803 XXGGXXGGGGXGXGGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GGG GG GG G G GG G G GG G Sbjct: 70 RGDREGGFSPRGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRGGDRGGSPWRG 124 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/120 (29%), Positives = 35/120 (29%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GGG GG GG GG G GG GG GG Sbjct: 71 GDREGGFSPRGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRGGDRGGSPWRGGDR--- 127 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G GG GG G G G G G GG G G G Sbjct: 128 -GVANRGRGDFSGGSRGGNKFSPRGGGRGGFTPRGRGGNDFSPRGGRGNFQSRGGGSRVG 186 Score = 43.6 bits (98), Expect = 2e-04 Identities = 33/108 (30%), Positives = 33/108 (30%), Gaps = 5/108 (4%) Frame = -3 Query: 923 GXGXXGXXXXXGGG-----XGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G GGG G GGG GG G G G G GG G Sbjct: 8 GRGGGGFRGGRGGGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPG 67 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G GG G G G G GG Sbjct: 68 GFRGDREGGFSPRGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRGG 115 Score = 42.7 bits (96), Expect = 4e-04 Identities = 42/137 (30%), Positives = 42/137 (30%), Gaps = 19/137 (13%) Frame = -3 Query: 980 GGXXGXGGGXXGXG-GGXXGGXGXXGXXXXXGGGXGXGGGX------GGGXGGGXGGXXX 822 GG G GG G GG GG GG G G GG G GG Sbjct: 28 GGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPGGFRGDREGGFSPRGRGGGFR 87 Query: 821 XGGGXXXXGGXXGGG-----------GXGXGGGXXGGGGXGXGGXGXGXGXGGG-GGXXX 678 G GG GG G GG GG G G G GG GG Sbjct: 88 GGDRGGFRGGDRGGSPWRGGDRGNFRGGDRGGSPWRGGDRGVANRGRGDFSGGSRGGNKF 147 Query: 677 XGXGGGXGXXGXGXXGG 627 GGG G GG Sbjct: 148 SPRGGGRGGFTPRGRGG 164 Score = 38.3 bits (85), Expect = 0.008 Identities = 32/124 (25%), Positives = 32/124 (25%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G GGG G G G G G G GG G G G Sbjct: 20 GGSGFTPRGGGGGFRGGDRGRSPGGFRGGDRGRSSSGFRGGDRGRSPGGFRGDREGGFSP 79 Query: 805 XGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G GG G G GG G G G G G Sbjct: 80 RGRGGGFRGGDRGGFRGGDRGGSPWRGGDRGNFRGGDRGGSPWRGGDRGVANRGRGDFSG 139 Query: 625 GXXG 614 G G Sbjct: 140 GSRG 143 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 52.4 bits (120), Expect = 5e-07 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PPPP P P P P PP P PPP PPP PPP P P Sbjct: 324 PPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPX---PPXPXPP-PPXXPPPXPXPPPPXXP 795 PPP P P P P P PP PP PP PPP P PPPP P Sbjct: 325 PPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPP P P P P P P P PPP P PPPP Sbjct: 324 PPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPP 369 Score = 45.2 bits (102), Expect = 7e-05 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPPPP P P P P P PP PP PPP PP PPP PPP Sbjct: 324 PPPPP-----PMKLDPSPQPAATPVEITEIPPIISPPAP--PPP----PPPPPPPPPPQT 372 Query: 868 P 870 P Sbjct: 373 P 373 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +1 Query: 814 PPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PPP P P P P P P PPP P PPP P P Sbjct: 318 PTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +1 Query: 841 PPPXPPPXPPPXPXP---PPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP PP P P P P P PP PPP P PPP P P Sbjct: 324 PPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 PP PP P P P P PP P P PP P PPPP PPP Sbjct: 324 PPPPPPMKLDPS-PQPAATPVEITEIPPIISPPAPPPPPPPPPPP--PPP 370 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +1 Query: 667 PXPXXXXPPPP-----PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PPPP P P P P PP PP P PPPP PP PPP Sbjct: 318 PTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPP---PPPP 370 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 9/73 (12%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP---------XPPPX 852 P P P P PPPP PP P P P PP Sbjct: 299 PADDQIPEASEPTEAEADAPTTFILPPPP--PPMKLDPSPQPAATPVEITEIPPIISPPA 356 Query: 853 PPPXPPPXPXPPP 891 PPP PPP P PPP Sbjct: 357 PPPPPPPPPPPPP 369 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 PP P P P P P PP P P P PPPP PP P Sbjct: 324 PPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P PPP P P P P P PPP P P Sbjct: 305 PEASEPTEAEADAPTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPP--P 362 Query: 958 PPXPXXPP 981 PP P PP Sbjct: 363 PPPPPPPP 370 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 PP P P P P PP P P PPPP PP P P P P Sbjct: 324 PPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPP----PPPPPQTP 373 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P PPP P P P P PP P PP PPP P P Sbjct: 318 PTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTP 373 >Z77665-7|CAI46591.1| 360|Caenorhabditis elegans Hypothetical protein K02E11.10 protein. Length = 360 Score = 52.4 bits (120), Expect = 5e-07 Identities = 38/121 (31%), Positives = 38/121 (31%), Gaps = 5/121 (4%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG-GXX 786 GGG G GG G GGG GGG GGG GG G G Sbjct: 95 GGGLGGFGGAPAPAPAFGGLGGGYQAAPALGGGLGGGLGGGPGGGYQAAPALQLPGLGAP 154 Query: 785 GGGGXGXGGGXXG----GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G GGG GG G G G G G G G Sbjct: 155 APAFGGLGGGYQGAPTLGGGQAQGGAGYQQGPAQGRFVAQQGSAQGVQGGAGYQQGPAQG 214 Query: 617 G 615 G Sbjct: 215 G 215 Score = 42.7 bits (96), Expect = 4e-04 Identities = 41/133 (30%), Positives = 41/133 (30%), Gaps = 17/133 (12%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-----GGXGGGXGGXXXXGGGXXXX 798 GG GG G G GG G GG GG GGG GGG Sbjct: 72 GGYAVAPSGGFGGAGGSYAAPALGGGLGGFGGAPAPAPAFGGLGGGYQAAPALGGGLGGG 131 Query: 797 -GGXXGGG----------GXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG GGG G G GG GG G G G GG G G Sbjct: 132 LGGGPGGGYQAAPALQLPGLGAPAPAFGGLGGGYQGAPTLGGGQAQGGAGYQQGPAQGRF 191 Query: 653 XXGXGXXGGXXGG 615 G G GG Sbjct: 192 VAQQGSAQGVQGG 204 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GG GG G GG G G GGG GGG G GG G Sbjct: 83 GGAGGSYAAPALGGGLGGFGGAPAPAPAFGGLGGGYQAAPALGGGLGGGLGGGPGGG 139 Score = 31.1 bits (67), Expect = 1.3 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 3/99 (3%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG-XXXXGGGXXX 801 G GGG G G G G G GG G G GG G Sbjct: 167 GAPTLGGGQAQGGAGYQQGPAQGRFVAQQGSAQGVQGGAGYQQGPAQGGFTAQQGPAQVV 226 Query: 800 XGGXXGGGGXGXGG--GXXGGGGXGXGGXGXGXGXGGGG 690 GG G GG G GG G G GG Sbjct: 227 QGGAGYQQGPAQGGFVAQQGPAPAAQGGAGYQQGSTQGG 265 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXG--GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G G GGG G G GG GGG G GGG G G Sbjct: 129 GGGLGGGPGGGYQAAPALQLPGLGAPAPAFGGLGGGYQGAP-TLGGGQAQGGAG 181 >Z69360-4|CAC42291.2| 732|Caenorhabditis elegans Hypothetical protein F25H8.5c protein. Length = 732 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 2/112 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPP 816 P P P PPP PPP P P P P PPP P PP P P P P Sbjct: 88 PQPT-PGPPPPRNNCLPPPGPPP-PCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPS 145 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P P P P P P P Sbjct: 146 PRGYENQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEP 197 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 7/121 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PP P P P P P PP P P P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYEN 151 Query: 799 XXXXPPPXXXXPPXPPP------XPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P PP P P P P Sbjct: 152 QPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYS 211 Query: 958 P 960 P Sbjct: 212 P 212 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 11/122 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP-XPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP PP P PPP P P P P P P P P P P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPP-------PXXXXXPXXPXPPXXPPP 942 P P P P P PP P PP P P PP P Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSPNTMAPPQHQQP 223 Query: 943 XP 948 P Sbjct: 224 YP 225 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PPP PP P PP PP P P P Sbjct: 90 PTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQP 134 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PPP PP P PP P P P P P P P P P Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 34.7 bits (76), Expect = 0.10 Identities = 29/105 (27%), Positives = 29/105 (27%), Gaps = 8/105 (7%) Frame = +3 Query: 693 PPPPXXX---PPXXPXXXXXXXXXXXXXXXXPPXPXPXP-PXPXXPXXXXPPPXX---PX 851 PPPP PP P P P P P P P P P Sbjct: 94 PPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQP 153 Query: 852 PPPXPPXXPXPPP-PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P P P P P P P P P P PP Sbjct: 154 QPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPP 198 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PP P P PP P PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPP 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 30/124 (24%), Positives = 30/124 (24%), Gaps = 5/124 (4%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX---- 791 PP PP P P PP P P PP P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P PP P PP P P P PP Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSP--NTMAPPQHQ 221 Query: 969 XPPP 980 P P Sbjct: 222 QPYP 225 Score = 29.5 bits (63), Expect = 3.8 Identities = 27/122 (22%), Positives = 27/122 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPP P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQP-PQPQPQPYPQRTGGCLPSPRGYE 150 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P PP P P Sbjct: 151 NQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYY 210 Query: 975 PP 980 P Sbjct: 211 SP 212 >Z69360-3|CAA93286.2| 369|Caenorhabditis elegans Hypothetical protein F25H8.5b protein. Length = 369 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 2/112 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPP 816 P P P PPP PPP P P P P PPP P PP P P P P Sbjct: 88 PQPT-PGPPPPRNNCLPPPGPPP-PCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPS 145 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P P P P P P P Sbjct: 146 PRGYENQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEP 197 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 7/121 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PP P P P P P PP P P P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYEN 151 Query: 799 XXXXPPPXXXXPPXPPP------XPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P PP P P P P Sbjct: 152 QPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYS 211 Query: 958 P 960 P Sbjct: 212 P 212 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 11/122 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP-XPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP PP P PPP P P P P P P P P P P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPP-------PXXXXXPXXPXPPXXPPP 942 P P P P P PP P PP P P PP P Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSPNTMAPPQHQQP 223 Query: 943 XP 948 P Sbjct: 224 YP 225 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PPP PP P PP PP P P P Sbjct: 90 PTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQP 134 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PPP PP P PP P P P P P P P P P Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 34.7 bits (76), Expect = 0.10 Identities = 29/105 (27%), Positives = 29/105 (27%), Gaps = 8/105 (7%) Frame = +3 Query: 693 PPPPXXX---PPXXPXXXXXXXXXXXXXXXXPPXPXPXP-PXPXXPXXXXPPPXX---PX 851 PPPP PP P P P P P P P P P Sbjct: 94 PPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQP 153 Query: 852 PPPXPPXXPXPPP-PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P P P P P P P P P P PP Sbjct: 154 QPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPP 198 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PP P P PP P PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPP 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 30/124 (24%), Positives = 30/124 (24%), Gaps = 5/124 (4%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX---- 791 PP PP P P PP P P PP P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P PP P PP P P P PP Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSP--NTMAPPQHQ 221 Query: 969 XPPP 980 P P Sbjct: 222 QPYP 225 Score = 29.5 bits (63), Expect = 3.8 Identities = 27/122 (22%), Positives = 27/122 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPP P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQP-PQPQPQPYPQRTGGCLPSPRGYE 150 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P PP P P Sbjct: 151 NQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYY 210 Query: 975 PP 980 P Sbjct: 211 SP 212 >Z69360-2|CAA93285.2| 780|Caenorhabditis elegans Hypothetical protein F25H8.5a protein. Length = 780 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 2/112 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPP 816 P P P PPP PPP P P P P PPP P PP P P P P Sbjct: 88 PQPT-PGPPPPRNNCLPPPGPPP-PCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPS 145 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP P P P P P P P P P P Sbjct: 146 PRGYENQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEP 197 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 7/121 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P PP P P P P P PP P P P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYEN 151 Query: 799 XXXXPPPXXXXPPXPPP------XPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P PP P P P P Sbjct: 152 QPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYS 211 Query: 958 P 960 P Sbjct: 212 P 212 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/122 (27%), Positives = 34/122 (27%), Gaps = 11/122 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXP-XPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP PP P PPP P P P P P P P P P P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPP---PXPXPP-------PXXXXXPXXPXPPXXPPP 942 P P P P P PP P PP P P PP P Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSPNTMAPPQHQQP 223 Query: 943 XP 948 P Sbjct: 224 YP 225 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PPP PP P PP PP P P P Sbjct: 90 PTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQP 134 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PPP PP P PP P P P P P P P P P Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYP 136 Score = 34.7 bits (76), Expect = 0.10 Identities = 29/105 (27%), Positives = 29/105 (27%), Gaps = 8/105 (7%) Frame = +3 Query: 693 PPPPXXX---PPXXPXXXXXXXXXXXXXXXXPPXPXPXP-PXPXXPXXXXPPPXX---PX 851 PPPP PP P P P P P P P P P Sbjct: 94 PPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQP 153 Query: 852 PPPXPPXXPXPPP-PXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP P P P P P P P P P P PP Sbjct: 154 QPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPP 198 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PP P P PP P PP PP Sbjct: 88 PQPTPGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQPP 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 30/124 (24%), Positives = 30/124 (24%), Gaps = 5/124 (4%) Frame = +3 Query: 624 PPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX---- 791 PP PP P P PP P P PP P Sbjct: 104 PPGPPPPCQQYQQPQPPPCQRPQPPQPQPQPYPQRTGGCLPSPRGYENQPQPPQPQQQQY 163 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXP-XPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P PP P PP P P P PP Sbjct: 164 PQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYYSP--NTMAPPQHQ 221 Query: 969 XPPP 980 P P Sbjct: 222 QPYP 225 Score = 29.5 bits (63), Expect = 3.8 Identities = 27/122 (22%), Positives = 27/122 (22%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P PPP P P P Sbjct: 92 PGPPPPRNNCLPPPGPPPPCQQYQQPQPPPCQRPQP-PQPQPQPYPQRTGGCLPSPRGYE 150 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P PP P P Sbjct: 151 NQPQPPQPQQQQYPQPQPQRGGCTYSQPQPQPQQQPQPPCYQRQPEPPRQTGGCLPGPYY 210 Query: 975 PP 980 P Sbjct: 211 SP 212 Score = 29.1 bits (62), Expect = 5.1 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G G GG GG G GG GG G G G G G G Sbjct: 666 GAGAVAGGAKAAGGA--VVDGVAAAGGAVVGGAKAVGSGIADGAKFVGENVAYGAGAVAG 723 Query: 674 G--XGGGXGXXGXGXXGG 627 G GG G GG Sbjct: 724 GAKAAGGAVVDGAAAAGG 741 Score = 28.3 bits (60), Expect = 8.9 Identities = 22/88 (25%), Positives = 22/88 (25%) Frame = -3 Query: 956 GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G GG G GG GG G G G G G GG Sbjct: 666 GAGAVAGGAKAAGGAVVDGVAAAGGAVVGGAKAVGSGIADGA-KFVGENVAYGAGAVAGG 724 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G GG Sbjct: 725 AKAAGGAVVDGAAAAGGAVVDGAKAVGG 752 >Z66565-6|CAA91483.1| 165|Caenorhabditis elegans Hypothetical protein T04F8.8 protein. Length = 165 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 P P PPP P P P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEP 144 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P PPPP P P P P P P P P P P P P P P P P Sbjct: 98 PPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P PPP P P P P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 P PPP PP P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEP 144 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXP 777 PP P P P P P P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEP---RPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEP 144 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +1 Query: 673 PXXXXPPPPPXP-XPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 P PPPPP P P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PPPP P P P P P P P P P P P P P P P P Sbjct: 98 PPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PPP PPPP P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPP---PPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEP 144 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP P PP P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXP 777 PP PP P P P P P P P P P P P P P P P P P P P P Sbjct: 98 PPPPPPTQPEP-EPEPRPEP---QPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP PPP P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQP-EPQPEPQPEPQP-EPHPEPAPEP 144 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 P P P P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P PP P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP P P P P P P P P P P P P P P P P P Sbjct: 100 PPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQ-PEPHPEPAPEPIVKP 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PPP P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPE-PQPEPHPEPAP 142 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPP P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP-XXPPPXPXXPP 981 PP PP P P P P P P P P P P P P P P P P P Sbjct: 99 PPPPPTQPEPEPEPRPEPQPEPQPEP-QPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P PPP PP P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEPR--PEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPP P PP P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPP--PPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQP-EPHPEPAPEP 144 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGG 792 G G G GGG G G G G GGG G GGG GG G GG Sbjct: 20 GYGAQAYGMGGG---GGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGG 76 Query: 791 XXGGGGXGXGGG 756 G G GGG Sbjct: 77 YNRPYGGGGGGG 88 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 814 PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEP-QPEPQPEPHPEPAPEP 144 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/77 (35%), Positives = 27/77 (35%), Gaps = 2/77 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG--XGGXXXXGGGX 807 GG G G GGG G GGG G GGG GG G GG Sbjct: 19 GGYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYGN-GGGFGGNNYNNGPPPFDGGY 77 Query: 806 XXXGGXXGGGGXGXGGG 756 G GGGG G G Sbjct: 78 NRPYGGGGGGGYGRPQG 94 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P P P P P P P P P P P P P P P P P Sbjct: 99 PPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQPEPHP-EPAPEPIVKP 148 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXP 947 P P PP P P P P P P P P P P P P P P P P P Sbjct: 92 PQGYVPPPPPPPTQPEPEPEP-RPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKP 148 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 PP P P P P P P P P P P P P P P P P P P Sbjct: 97 PPPPPPPTQPEPEPE-PRPEPQPEPQPEPQPEPQPEPQ-PEPHPEPAPEPIVKP 148 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXGGXGX 714 GG G GGG GG G G GG G G G GG G G G Sbjct: 19 GGYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDG-GY 77 Query: 713 GXGXGGGGG 687 GGGGG Sbjct: 78 NRPYGGGGG 86 Score = 36.3 bits (80), Expect = 0.033 Identities = 26/79 (32%), Positives = 26/79 (32%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G G G GGG G GGG G GGG G G G Sbjct: 14 GVAYCGGYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYG---NGGGFG-GNNYNNG 69 Query: 743 GGXGXGGXGXGXGXGGGGG 687 GG G GGGGG Sbjct: 70 PPPFDGGYNRPYGGGGGGG 88 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG--GGGGX 684 GG G G GGG G G GG G G G GG G GG Sbjct: 19 GGYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGGYN 78 Query: 683 XXXGXGGGXG 654 G GGG G Sbjct: 79 RPYGGGGGGG 88 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXP 923 P P P P P P P P P P P P P P P Sbjct: 108 PEPEPRPEPQPEPQPEPQPEPQPEPQPEPHPEPAPEPIVKPYNSYAQP 155 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG G G G G G GGG G G GG G G Sbjct: 30 GGGGGYNRPMNSYG--NGYNNGGGFNNYG--NGGGFGGNNYNNGPPPFDGGYNRPYGGGG 85 Query: 805 XGGXGXGXG 779 GG G G Sbjct: 86 GGGYGRPQG 94 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX-GXGXGGGGGXXXXGXGGGXGXXGX 642 G G G GGGG G G GG G G G GG G G Sbjct: 20 GYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGGYNR 79 Query: 641 GXXGGXXGG 615 GG GG Sbjct: 80 PYGGGGGGG 88 >U52003-5|AAG00057.1| 730|Caenorhabditis elegans P granule abnormality protein 1,isoform a protein. Length = 730 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G G GG GGG G GG GG G G G G G Sbjct: 673 GGGGRGGYGGGDRGGRGGYGGDRGGR--GGYGGGDRGGRGGYGGDRGRGGYG----GRGG 726 Query: 805 XGG 797 GG Sbjct: 727 RGG 729 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/67 (46%), Positives = 31/67 (46%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG GG G GG G GG GGG GG GG GG GG Sbjct: 672 GGGGGRGGYGGGDRGGRG------GYGGDRGGRGGYGGGDRGGRGGY----GGDRGRGGY 721 Query: 788 XGGGGXG 768 G GG G Sbjct: 722 GGRGGRG 728 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G GGG GG G G G G GGG G GG G G G GG G Sbjct: 674 GGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGYGGDRGRGGYGGRGGRGG 729 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/79 (43%), Positives = 34/79 (43%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GG G GG GGG GG GG GG GG G G GGG GG Sbjct: 660 GFGQFAPTSSAYGGGGGRGGYGGGDRGGRGGY----------GGDRGGRG-GYGGGDRGG 708 Query: 743 GGXGXGGXGXGXGXGGGGG 687 G G GG G GG GG Sbjct: 709 RG-GYGGDRGRGGYGGRGG 726 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GGG GG GGG G GG G GGG G GG GG G GG G G GG Sbjct: 673 GGGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGY--GGDRGRGGYGGRGGRGG 729 >U52003-4|ABB51171.1| 771|Caenorhabditis elegans P granule abnormality protein 1,isoform b protein. Length = 771 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G G GG GGG G GG GG G G G G G Sbjct: 714 GGGGRGGYGGGDRGGRGGYGGDRGGR--GGYGGGDRGGRGGYGGDRGRGGYG----GRGG 767 Query: 805 XGG 797 GG Sbjct: 768 RGG 770 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/67 (46%), Positives = 31/67 (46%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG GG G GG G GG GGG GG GG GG GG Sbjct: 713 GGGGGRGGYGGGDRGGRG------GYGGDRGGRGGYGGGDRGGRGGY----GGDRGRGGY 762 Query: 788 XGGGGXG 768 G GG G Sbjct: 763 GGRGGRG 769 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G GGG GG G G G G GGG G GG G G G GG G Sbjct: 715 GGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGYGGDRGRGGYGGRGGRGG 770 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/79 (43%), Positives = 34/79 (43%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GG G GG GGG GG GG GG GG G G GGG GG Sbjct: 701 GFGQFAPTSSAYGGGGGRGGYGGGDRGGRGGY----------GGDRGGRG-GYGGGDRGG 749 Query: 743 GGXGXGGXGXGXGXGGGGG 687 G G GG G GG GG Sbjct: 750 RG-GYGGDRGRGGYGGRGG 767 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GGG GG GGG G GG G GGG G GG GG G GG G G GG Sbjct: 714 GGGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGY--GGDRGRGGYGGRGGRGG 770 >AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical protein Y53H1A.1 protein. Length = 613 Score = 52.4 bits (120), Expect = 5e-07 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 4/109 (3%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P P PP P PPPP PPP P PP Sbjct: 78 PPGPSG--PSGPPVYHNQGPPRGYPPPPPQGADTWRGAPPPAHHGHFGPPGHHFQGPPQH 135 Query: 844 PPXPPPXP----PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP P PP P PP P P P PPP P P Sbjct: 136 FPPGPPRPHFPGPPGPHRPPEHYPGPPRPQAPAAPPPKSLFPSAQKPKP 184 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/118 (30%), Positives = 36/118 (30%), Gaps = 9/118 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX--PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P PPP PPP P PP PP P P Sbjct: 87 PPVYHNQGPPRGYPPPPPQGADTWRGAPPPAHHGHFGPPGHHFQGPPQHFPPGPPRPHFP 146 Query: 790 XPPXXXXPPPXXXXPPXP--PPXPPPXP--PPXPXPPPXXXXXPXXP---XPPXXPPP 942 PP PP PP P P PPP P P P P P PPP Sbjct: 147 GPPGPHRPPEHYPGPPRPQAPAAPPPKSLFPSAQKPKPLFAAASSAPSFFGAPQRPPP 204 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = +1 Query: 718 PXPPXPXPPPPXX---PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P PP PP PPPP PP PP PP PP Sbjct: 79 PGPSGPSGPPVYHNQGPPRGYPPPPPQGADTWRGAPPPAHHGHFGPPGHHFQGPPQHFPP 138 Query: 889 PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP PP Sbjct: 139 -------GPPRPHFPGPPGPHRPPEHYPGPP 162 Score = 35.5 bits (78), Expect = 0.058 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 9/78 (11%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPX----PP----PXPPXXPXPPPPXPPXXXXPXPXPX 932 PP P PP PP PP PP P PP P P P Sbjct: 95 PPRGYPPPPPQGADTWRGAPPPAHHGHFGPPGHHFQGPPQHFPPGPPRPHFPGPPGPHRP 154 Query: 933 PPXXPXXP-PPXPXPPPP 983 P P P P P PPP Sbjct: 155 PEHYPGPPRPQAPAAPPP 172 >AL023835-10|CAA19494.2| 691|Caenorhabditis elegans Hypothetical protein Y37A1B.11 protein. Length = 691 Score = 52.4 bits (120), Expect = 5e-07 Identities = 39/130 (30%), Positives = 39/130 (30%), Gaps = 9/130 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX 792 PP PP P P P P P P P P P P P P P P Sbjct: 457 PPYEPPSDRFEAEFADEPECEWIRDPTPTPPPSPQPVYRLPSPKP-VTPEPLPSPTITDV 515 Query: 793 PPXXXXPPPXXXXP--------PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P P P P P P PPP P P P P P P P Sbjct: 516 SLAIATPSPEESDDDQELILPSPEPSPVREPTPPPPPREP-----TPREPTPEPEPVREP 570 Query: 949 XXPPPXPXXP 978 PPP P P Sbjct: 571 TPPPPPPAKP 580 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/101 (29%), Positives = 30/101 (29%), Gaps = 3/101 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPPP 786 P PP P P P P P P P P P P P P P Sbjct: 482 PTPTPPPSPQPVYRLPSPKPVTPEPLPSPTITDVSLAIATPSPEESDDDQELILPSPEPS 541 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PPP P P P P P P P PPP P Sbjct: 542 PVREPTPPPPPREPTPREPTPEPEPVREPTPPPPPPAKPRP 582 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPX-PPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P P P P P PPPP P P P P P P PPP P P P Sbjct: 536 PSPEPSPVREPTPPPPPREPTPREPTPEPEPVREPTPPPPPPAKPRP 582 >AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical protein H28G03.2c protein. Length = 275 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/83 (36%), Positives = 30/83 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PP P P P PP PPP P PP P PPP Sbjct: 75 PMPHHMGMPP-PGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPP--PMSLLGPPP 131 Query: 820 XXXXPPXPPPXPPPXPPPXPXPP 888 P PPP P P PP Sbjct: 132 FSVPPSVPPPTSSAAAPIVPPPP 154 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP----XPPPXPXPPPXXXXX 906 PPP PPP PP PP PPP P PPP PPP PP Sbjct: 83 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 142 Query: 907 PXXPXPPXXPPPXPXXPPPXP 969 P PPP P P Sbjct: 143 SSAAAPIVPPPPVQSTAQPPP 163 Score = 50.8 bits (116), Expect = 1e-06 Identities = 33/103 (32%), Positives = 33/103 (32%), Gaps = 5/103 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PP PP P P P PPP PPP PP PPP PP Sbjct: 55 PPMPPMPFSASSLVSLKYGQPMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLG 114 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP PPP P PP Sbjct: 115 AAPYAVP---PPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPP 154 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 8/89 (8%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPP-XXXXPPPXXXXPPXPPPXPPPXP- 867 P P PP PPP PPP PPP PP P PP PPP Sbjct: 75 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 134 Query: 868 PPXPXPPPXXXXXPXXPXPP----XXPPP 942 PP PP P P PP PPP Sbjct: 135 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 163 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPP P P P PP PPP P PP Sbjct: 83 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 142 Query: 820 XXXXPPXPPPXP---PPXPPP 873 P PP P PPP Sbjct: 143 SSAAAPIVPPPPVQSTAQPPP 163 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 4/78 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP PPP P P P PPP PP PPP Sbjct: 90 PPFMPPPIGMPPPPL---GMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPP-SVPPPTSSA 145 Query: 796 PXXXXPPPXXXXPPXPPP 849 PPP PPP Sbjct: 146 AAPIVPPPPVQSTAQPPP 163 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP--PP 983 P PPP P P PP PPP P P PP PPP PP PP Sbjct: 84 PPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVP-PPMSLLGPPPFSVPPSVPP 140 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP PP P P P P P P P PP P PP PPP P Sbjct: 90 PPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPPTSSAAAP 148 Query: 787 XXPPXXXXPPPXXXXPPXP 843 PP PP P P Sbjct: 149 IVPP----PPVQSTAQPPP 163 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 13/81 (16%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPX-----------PPXXPXPPPPX--PPXXXXPX 920 P P PP P PPP PPP PP PPP PP P Sbjct: 83 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 142 Query: 921 PXPXPPXXPXXPPPXPXPPPP 983 P P P PPP Sbjct: 143 SSAAAPIVPPPPVQSTAQPPP 163 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P PPPP PP PP P PP P Sbjct: 83 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPP 141 Query: 819 XXXXPPPXXPXPPPXPPXXPXP 884 P P PP P P Sbjct: 142 TSSAAAPIVPPPPVQSTAQPPP 163 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 4/89 (4%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P PPP PP PP P P Sbjct: 75 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 134 Query: 819 XXXXPPP----XXPXPPPXPPXXPXPPPP 893 PPP P PP P PPP Sbjct: 135 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 163 >AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical protein H28G03.2b protein. Length = 298 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/83 (36%), Positives = 30/83 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PP P P P PP PPP P PP P PPP Sbjct: 98 PMPHHMGMPP-PGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPP--PMSLLGPPP 154 Query: 820 XXXXPPXPPPXPPPXPPPXPXPP 888 P PPP P P PP Sbjct: 155 FSVPPSVPPPTSSAAAPIVPPPP 177 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP----XPPPXPXPPPXXXXX 906 PPP PPP PP PP PPP P PPP PPP PP Sbjct: 106 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 165 Query: 907 PXXPXPPXXPPPXPXXPPPXP 969 P PPP P P Sbjct: 166 SSAAAPIVPPPPVQSTAQPPP 186 Score = 50.8 bits (116), Expect = 1e-06 Identities = 33/103 (32%), Positives = 33/103 (32%), Gaps = 5/103 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PP PP P P P PPP PPP PP PPP PP Sbjct: 78 PPMPPMPFSASSLVSLKYGQPMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLG 137 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP PPP P PP Sbjct: 138 AAPYAVP---PPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPP 177 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 8/89 (8%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPP-XXXXPPPXXXXPPXPPPXPPPXP- 867 P P PP PPP PPP PPP PP P PP PPP Sbjct: 98 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 157 Query: 868 PPXPXPPPXXXXXPXXPXPP----XXPPP 942 PP PP P P PP PPP Sbjct: 158 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 186 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPP P P P PP PPP P PP Sbjct: 106 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 165 Query: 820 XXXXPPXPPPXP---PPXPPP 873 P PP P PPP Sbjct: 166 SSAAAPIVPPPPVQSTAQPPP 186 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 4/78 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP PPP P P P PPP PP PPP Sbjct: 113 PPFMPPPIGMPPPPL---GMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPP-SVPPPTSSA 168 Query: 796 PXXXXPPPXXXXPPXPPP 849 PPP PPP Sbjct: 169 AAPIVPPPPVQSTAQPPP 186 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP--PP 983 P PPP P P PP PPP P P PP PPP PP PP Sbjct: 107 PPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVP-PPMSLLGPPPFSVPPSVPP 163 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP PP P P P P P P P PP P PP PPP P Sbjct: 113 PPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPPTSSAAAP 171 Query: 787 XXPPXXXXPPPXXXXPPXP 843 PP PP P P Sbjct: 172 IVPP----PPVQSTAQPPP 186 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 13/81 (16%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPX-----------PPXXPXPPPPX--PPXXXXPX 920 P P PP P PPP PPP PP PPP PP P Sbjct: 106 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 165 Query: 921 PXPXPPXXPXXPPPXPXPPPP 983 P P P PPP Sbjct: 166 SSAAAPIVPPPPVQSTAQPPP 186 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P PPPP PP PP P PP P Sbjct: 106 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPP 164 Query: 819 XXXXPPPXXPXPPPXPPXXPXP 884 P P PP P P Sbjct: 165 TSSAAAPIVPPPPVQSTAQPPP 186 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 4/89 (4%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P PPP PP PP P P Sbjct: 98 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 157 Query: 819 XXXXPPP----XXPXPPPXPPXXPXPPPP 893 PPP P PP P PPP Sbjct: 158 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 186 >AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical protein H28G03.2a protein. Length = 548 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/83 (36%), Positives = 30/83 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PP P P P PP PPP P PP P PPP Sbjct: 348 PMPHHMGMPP-PGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPP--PMSLLGPPP 404 Query: 820 XXXXPPXPPPXPPPXPPPXPXPP 888 P PPP P P PP Sbjct: 405 FSVPPSVPPPTSSAAAPIVPPPP 427 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP----XPPPXPXPPPXXXXX 906 PPP PPP PP PP PPP P PPP PPP PP Sbjct: 356 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 415 Query: 907 PXXPXPPXXPPPXPXXPPPXP 969 P PPP P P Sbjct: 416 SSAAAPIVPPPPVQSTAQPPP 436 Score = 50.8 bits (116), Expect = 1e-06 Identities = 33/103 (32%), Positives = 33/103 (32%), Gaps = 5/103 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPX 852 PP PP P P P PPP PPP PP PPP PP Sbjct: 328 PPMPPMPFSASSLVSLKYGQPMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLG 387 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP PPP P PP Sbjct: 388 AAPYAVP---PPMSLLGPPPFSVPPSVPPPTSSAAAPIVPPPP 427 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 8/89 (8%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPP--PXXPP-XXXXPPPXXXXPPXPPPXPPPXP- 867 P P PP PPP PPP PPP PP P PP PPP Sbjct: 348 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 407 Query: 868 PPXPXPPPXXXXXPXXPXPP----XXPPP 942 PP PP P P PP PPP Sbjct: 408 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 436 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PPPP P P P PP PPP P PP Sbjct: 356 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 415 Query: 820 XXXXPPXPPPXP---PPXPPP 873 P PP P PPP Sbjct: 416 SSAAAPIVPPPPVQSTAQPPP 436 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 4/78 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP----PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P PPP PPP P P P PPP PP PPP Sbjct: 363 PPFMPPPIGMPPPPL---GMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPP-SVPPPTSSA 418 Query: 796 PXXXXPPPXXXXPPXPPP 849 PPP PPP Sbjct: 419 AAPIVPPPPVQSTAQPPP 436 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP--PP 983 P PPP P P PP PPP P P PP PPP PP PP Sbjct: 357 PPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVP-PPMSLLGPPPFSVPPSVPP 413 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 3/79 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP PP P P P P P P P PP P PP PPP P Sbjct: 363 PPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPPTSSAAAP 421 Query: 787 XXPPXXXXPPPXXXXPPXP 843 PP PP P P Sbjct: 422 IVPP----PPVQSTAQPPP 436 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 13/81 (16%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPX-----------PPXXPXPPPPX--PPXXXXPX 920 P P PP P PPP PPP PP PPP PP P Sbjct: 356 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSVPPSVPPPT 415 Query: 921 PXPXPPXXPXXPPPXPXPPPP 983 P P P PPP Sbjct: 416 SSAAAPIVPPPPVQSTAQPPP 436 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P PPPP PP PP P PP P Sbjct: 356 PPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPP-PFSVPPSVPPP 414 Query: 819 XXXXPPPXXPXPPPXPPXXPXP 884 P P PP P P Sbjct: 415 TSSAAAPIVPPPPVQSTAQPPP 436 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 4/89 (4%) Frame = +3 Query: 639 PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXP 818 P P P P PPP PP PP P P Sbjct: 348 PMPHHMGMPPPGMGPPPFMPPPIGMPPPPLGMPPPHIGLGAAPYAVPPPMSLLGPPPFSV 407 Query: 819 XXXXPPP----XXPXPPPXPPXXPXPPPP 893 PPP P PP P PPP Sbjct: 408 PPSVPPPTSSAAAPIVPPPPVQSTAQPPP 436 >AF077868-1|AAC36100.1| 730|Caenorhabditis elegans PGL-1 protein. Length = 730 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/63 (47%), Positives = 30/63 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG G GG G G GG GGG G GG GG G G G G G Sbjct: 673 GGGGRGGYGGGDRGGRGGYGGDRGGR--GGYGGGDRGGRGGYGGDRGRGGYG----GRGG 726 Query: 805 XGG 797 GG Sbjct: 727 RGG 729 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/67 (46%), Positives = 31/67 (46%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GGG GG G GG G GG GGG GG GG GG GG Sbjct: 672 GGGGGRGGYGGGDRGGRG------GYGGDRGGRGGYGGGDRGGRGGY----GGDRGRGGY 721 Query: 788 XGGGGXG 768 G GG G Sbjct: 722 GGRGGRG 728 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G GGG GG G G G G GGG G GG G G G GG G Sbjct: 674 GGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGYGGDRGRGGYGGRGGRGG 729 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/79 (43%), Positives = 34/79 (43%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G G GG G GG GGG GG GG GG GG G G GGG GG Sbjct: 660 GFGQFAPTSSAYGGGGGRGGYGGGDRGGRGGY----------GGDRGGRG-GYGGGDRGG 708 Query: 743 GGXGXGGXGXGXGXGGGGG 687 G G GG G GG GG Sbjct: 709 RG-GYGGDRGRGGYGGRGG 726 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GGG GG GGG G GG G GGG G GG GG G GG G G GG Sbjct: 673 GGGGRGGYGGGDRGGRGGYGGDRGGRGGYGGGDRGGRGGY--GGDRGRGGYGGRGGRGG 729 >Z99773-3|CAE11316.1| 305|Caenorhabditis elegans Hypothetical protein H06A10.2 protein. Length = 305 Score = 52.0 bits (119), Expect = 6e-07 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 1/90 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P P PPP P PP P P P Sbjct: 109 PGPPGPGGSPGKPGKPGKPGAPGAPGAAGKGASAPCEAKTPPPCQPCPAGPPGPPGPDGP 168 Query: 871 PXPXPPPXXXXXPXXPXPPXXP-PPXPXXP 957 P P P P PP P PP P P Sbjct: 169 AGPAGPDGEAGSPAAPSPPGPPGPPGPAGP 198 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/119 (29%), Positives = 35/119 (29%), Gaps = 1/119 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P PP P P P P P PP P PP P Sbjct: 150 PPCQPCPAGPPGPPGPDGPAGPAGPDGEAGS-PAAPSPPGPPGPPGPAGPAGNDGAAGTP 208 Query: 808 XPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P PP P PP P PP P P P P Sbjct: 209 GPDGPAGESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGP----PGPAGAP 263 Score = 50.0 bits (114), Expect = 3e-06 Identities = 37/120 (30%), Positives = 37/120 (30%), Gaps = 17/120 (14%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXX----PPPPPXPXPXPXPPXP-------XPPPPXXPP- 762 P PP P P P P P P PP P P P P P P P Sbjct: 156 PAGPPGPPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPPGPAGPAGNDGAAGTPGPDGPAG 215 Query: 763 ----PXPXPPPPXXPPXXXXPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P PP PP P P P P PP P P P PP Sbjct: 216 ESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGPP 275 Score = 48.4 bits (110), Expect = 8e-06 Identities = 31/114 (27%), Positives = 31/114 (27%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PP PP P P P P P PP P PP P Sbjct: 143 PCEAKTPPPCQPCPAGPPGPPGPDGPAGPAGPDGEA--GSPAAPSPPGPPGPPGPAGPAG 200 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P PP Sbjct: 201 NDGAAGTPGPDGPAGESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPP 254 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 8/122 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P PP PP P P P Sbjct: 118 PGKPGKPGKPGAPGAPGAAGKGASAPCEAKTPPPCQPCPAGPP--GPPGPDGPAGPAGPD 175 Query: 799 XXXXPP--PXXXXPPXPP-PXPP-----PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXX 954 P P PP PP P P P P P P P PP P Sbjct: 176 GEAGSPAAPSPPGPPGPPGPAGPAGNDGAAGTPGPDGPAGESTYPEPAGPGPAGPPGPAG 235 Query: 955 PP 960 PP Sbjct: 236 PP 237 Score = 42.7 bits (96), Expect = 4e-04 Identities = 35/125 (28%), Positives = 35/125 (28%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX--PXPPPPXX 792 P P P P P P P P PPP P P P PP P Sbjct: 109 PGPPGPGGSPGKPGKPGKPGAPGAPGAAGKGASA-PCEAKTPPPCQPCPAGPPGPPGPDG 167 Query: 793 PPXXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P PP P P P P P P P P P Sbjct: 168 PAGPAGPDGEAGSPAAPSPPGPPGPPGPAGPAGNDGAAGTP-GPDGPAGESTYPEPAGPG 226 Query: 967 PXXPP 981 P PP Sbjct: 227 PAGPP 231 Score = 37.1 bits (82), Expect = 0.019 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 4/120 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPX-PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPX 791 P PP PP P P P P P PP P P P Sbjct: 156 PAGPPG-PPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPPGPAGPAGNDGAAGTPGPDGPA 214 Query: 792 PXP--PXPXXPXXXXPP-PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P P PP P P P P PP P P P P P Sbjct: 215 GESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGP 274 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP-XPPPPXXPPPXPXPP 780 P P P P PP P P P P PP P P P P PP Sbjct: 220 PEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGPP 275 Score = 32.7 bits (71), Expect = 0.41 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 12/109 (11%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXX 871 PPP P P P P P P P P P PP Sbjct: 149 PPPCQPCPAGPPGPPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPPGPAGPAGNDGAAGTP 208 Query: 872 XXXXPP----------PXPXXXPXP--PPXPXXPXPPXPXPPXXPPXPP 982 P P P P P PP P P PP PP Sbjct: 209 GPDGPAGESTYPEPAGPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPP 257 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXG---XGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG G G G GGG G G G G G G G G G G G Sbjct: 84 GGPDAGAGAGAADAAAGGGCTGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGAAGKG 139 >Z68301-5|CAA92620.1| 301|Caenorhabditis elegans Hypothetical protein W01B6.7 protein. Length = 301 Score = 52.0 bits (119), Expect = 6e-07 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P PP P P PP P P Sbjct: 104 PGPPGPGGSPGKPGKPGKPGAPGAPGNPGKGASA-PCEPVTQPPCQPCPG-GPPGPAGPA 161 Query: 799 XXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP--PX 966 PP P P P P P PP P P P P P P P P Sbjct: 162 GPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPG 221 Query: 967 PXXPP 981 P PP Sbjct: 222 PAGPP 226 Score = 49.2 bits (112), Expect = 4e-06 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPP-PPX 789 P PP P P P P P PP PP P P P P P P PP P Sbjct: 141 PVTQPPCQPCPGGPPGPAGP--AGPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDG 198 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP P P P P P P PP Sbjct: 199 APGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGP---GPAGPKGPPGAA 255 Query: 970 XXP 978 P Sbjct: 256 GAP 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 3/117 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PP P P P PP P P P P P P PP P Sbjct: 138 PCEPVTQPPCQPCPGGPPGPAGPAGPPGPPGPDGNP--GSPAGPSGPGPAGPPGPAGPAG 195 Query: 820 XXXXP--PXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P PP Sbjct: 196 NDGAPGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGPGPAGPKGPP 252 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGGG G GGG G G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPG--KPGAPGAPGNPGKG 134 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXG 726 GG GGG GGG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G GGG GGG G GG G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GGG GGG GG G G G G G G G G G Sbjct: 86 GAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGG 851 GGGG G GGG G G G G G G G G G G G Sbjct: 88 GGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G GGG G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGP-PGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXG 711 GG GGG GG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GG GGGG G G G GG G G G G Sbjct: 89 GGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPG 129 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G G G GG G G G G G G Sbjct: 85 GGAGGGGGGG----GGG---CDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 >V00148-1|CAA23464.1| 301|Caenorhabditis elegans protein ( Caenorhabditis elegansgene Col-2 coding for a collagen. ). Length = 301 Score = 52.0 bits (119), Expect = 6e-07 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P PP P P PP P P Sbjct: 104 PGPPGPGGSPGKPGKPGKPGAPGAPGNPGKGASA-PCEPVTQPPCQPCPG-GPPGPAGPA 161 Query: 799 XXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP--PX 966 PP P P P P P PP P P P P P P P P Sbjct: 162 GPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPG 221 Query: 967 PXXPP 981 P PP Sbjct: 222 PAGPP 226 Score = 49.2 bits (112), Expect = 4e-06 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPP-PPX 789 P PP P P P P P PP PP P P P P P P PP P Sbjct: 141 PVTQPPCQPCPGGPPGPAGP--AGPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDG 198 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP P P P P P P PP Sbjct: 199 APGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGP---GPAGPKGPPGAA 255 Query: 970 XXP 978 P Sbjct: 256 GAP 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 3/117 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PP P P P PP P P P P P P PP P Sbjct: 138 PCEPVTQPPCQPCPGGPPGPAGPAGPPGPPGPDGNP--GSPAGPSGPGPAGPPGPAGPAG 195 Query: 820 XXXXP--PXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P PP Sbjct: 196 NDGAPGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGPGPAGPKGPP 252 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGGG G GGG G G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPG--KPGAPGAPGNPGKG 134 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXG 726 GG GGG GGG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G GGG GGG G GG G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GGG GGG GG G G G G G G G G G Sbjct: 86 GAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGG 851 GGGG G GGG G G G G G G G G G G G Sbjct: 88 GGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G GGG G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGP-PGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXG 711 GG GGG GG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GG GGGG G G G GG G G G G Sbjct: 89 GGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPG 129 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G G G GG G G G G G G Sbjct: 85 GGAGGGGGGG----GGG---CDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 >U64609-1|AAB04598.1| 405|Caenorhabditis elegans Sperm-specific family, class qprotein 2 protein. Length = 405 Score = 52.0 bits (119), Expect = 6e-07 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G GG G G G GGG G G G GG GGG G Sbjct: 309 GAPGGGASALGAAPPAGSMSGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGA 368 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGG 687 GGGG G G G GGGGG Sbjct: 369 KTGGGGGGGIPGQSMYMGAGGGGG 392 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/114 (28%), Positives = 32/114 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GG G GG G G G GG G Sbjct: 283 GAAPGGASTMTAVGGAPRGASTMTAVGAPGGGASALGAAPPAGSMSGGGGGATSGYFGVG 342 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGG G GGG G G G GG G GG G G G Sbjct: 343 QGVMGGGGAVGQSAYFGVGGGAAGGAKTGGGGGGGIPGQSMYMGAGGGGGAGGG 396 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -3 Query: 857 GGXGGGXG--GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGX 684 G GGG G G GG G G G G GGGG G G GG G Sbjct: 309 GAPGGGASALGAAPPAGSMSGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVG-GGAAGG 367 Query: 683 XXXGXGGGXGXXGXGXXGGXXGG 615 G GGG G G G GG Sbjct: 368 AKTGGGGGGGIPGQSMYMGAGGG 390 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 2/69 (2%) Frame = -1 Query: 985 GGGGGXGXG--GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGX 812 GGGGG G G G GG G G G GGG G GGG G G G Sbjct: 329 GGGGGATSGYFGVGQGVMGGGG-AVGQSAYFGVGGGAAGGAKTGGGGGGGIPGQSMYMGA 387 Query: 811 XGXGGXGXG 785 G GG G G Sbjct: 388 GGGGGAGGG 396 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 5/96 (5%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-- 762 G GG G G G GG GG G G G G GGGG Sbjct: 7 GVAGGSNTGAQSAYFGVGGGPAGGGGGASKVGGGAAPPPGTSVYMGAGGGGGGGGAQSAY 66 Query: 761 ---GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG GG G GGGG GG Sbjct: 67 FAVGGAPVGGAPAAVSIGAPPPAGGGGASTMTALGG 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXGGXGXGXGX 702 G GG G GGG G G G G GGG G G G G Sbjct: 309 GAPGGGASALGAAPPAGSMSGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGA 368 Query: 701 --GGGGGXXXXGXGGGXGXXGXGXXGG 627 GGGGG G G G G GG Sbjct: 369 KTGGGGGGGIPGQSMYMGAGGGGGAGG 395 Score = 40.3 bits (90), Expect = 0.002 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 4/120 (3%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGGXX 786 GG G G G G GG GG G GG Sbjct: 257 GGAPRGASTMTAVGGAPTGASTMTAVGAAPGGASTMTAVGGAPRGASTMTAVGAPGGGAS 316 Query: 785 GGGGXGXGGGXXGGGGXGXGGX-GXGXGXGGGGGXXXXG--XGGGXGXXGXGXXGGXXGG 615 G G GGGG G G G G GGGG G G G G GG GG Sbjct: 317 ALGAAPPAGSMSGGGGGATSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGAKTGGGGGG 376 Score = 35.5 bits (78), Expect = 0.058 Identities = 35/127 (27%), Positives = 35/127 (27%), Gaps = 5/127 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGG-----GXGGGXGGGXGGXXXXG 816 G G G GGG GG G G GG G G GGG GGG Sbjct: 11 GSNTGAQSAYFGVGGGPAGGGG--GASKVGGGAAPPPGTSVYMGAGGGGGGGGAQSAYFA 68 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GG G GGG G G G G G Sbjct: 69 VGGAPVGGAPAAVSIGAPPPAGGGGASTMTALG---GAPSGASTMTAVGGAPRGASTMTA 125 Query: 635 XGGXXGG 615 GG G Sbjct: 126 VGGVPSG 132 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGG G GGG GG G G GGGG G GG GG Sbjct: 24 GGGPAGGGGGASKVGGGAAPPPGTSVYMGAGGGGGG--GGAQSAYFAVGG 71 Score = 31.5 bits (68), Expect = 0.95 Identities = 27/103 (26%), Positives = 27/103 (26%), Gaps = 4/103 (3%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXX----GGGGXGXGGGXXGGGGXGXGGXGXGXGX 702 G GG G GGG GG GG G G G G GG G Sbjct: 7 GVAGGSNTGAQSAYFGVGGGPAGGGGGASKVGGGAAPPPGTSVYMGAGGGGGGGGAQSAY 66 Query: 701 GGGGGXXXXGXGGGXGXXGXGXXGGXXGGXXXXXXXAXSXRST 573 GG G GG A S ST Sbjct: 67 FAVGGAPVGGAPAAVSIGAPPPAGGGGASTMTALGGAPSGAST 109 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 GGGGG GG G G GG GGGG G GG Sbjct: 29 GGGGGASKVGGGAAPPPGTSVYMG---AGGGGGGGGAQSAYFAVGGAPVGG 76 >J01048-1|AAA27990.1| 301|Caenorhabditis elegans protein ( C.elegans (nematode)collagen 2 (col-2) gene, complete cds. ). Length = 301 Score = 52.0 bits (119), Expect = 6e-07 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P PP P P PP P P Sbjct: 104 PGPPGPGGSPGKPGKPGKPGAPGAPGNPGKGASA-PCEPVTQPPCQPCPG-GPPGPAGPA 161 Query: 799 XXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP--PX 966 PP P P P P P PP P P P P P P P P Sbjct: 162 GPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPG 221 Query: 967 PXXPP 981 P PP Sbjct: 222 PAGPP 226 Score = 49.2 bits (112), Expect = 4e-06 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPP-PPX 789 P PP P P P P P PP PP P P P P P P PP P Sbjct: 141 PVTQPPCQPCPGGPPGPAGP--AGPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDG 198 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP P P P P P P PP Sbjct: 199 APGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGP---GPAGPKGPPGAA 255 Query: 970 XXP 978 P Sbjct: 256 GAP 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 3/117 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PP P P P PP P P P P P P PP P Sbjct: 138 PCEPVTQPPCQPCPGGPPGPAGPAGPPGPPGPDGNP--GSPAGPSGPGPAGPPGPAGPAG 195 Query: 820 XXXXP--PXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P PP Sbjct: 196 NDGAPGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGPGPAGPKGPP 252 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGGG G GGG G G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPG--KPGAPGAPGNPGKG 134 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXG 726 GG GGG GGG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G GGG GGG G GG G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GGG GGG GG G G G G G G G G G Sbjct: 86 GAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGG 851 GGGG G GGG G G G G G G G G G G G Sbjct: 88 GGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G GGG G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGP-PGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXG 711 GG GGG GG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GG GGGG G G G GG G G G G Sbjct: 89 GGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPG 129 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G G G GG G G G G G G Sbjct: 85 GGAGGGGGGG----GGG---CDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 >AY347575-1|AAP97869.1| 301|Caenorhabditis elegans COLlagen structural gene, probabledorsal and ventral cuticle component, from embryo to adult,but maximal in dauer (28.0 kD) (col-2) protein. Length = 301 Score = 52.0 bits (119), Expect = 6e-07 Identities = 38/125 (30%), Positives = 38/125 (30%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P PP P P PP P P Sbjct: 104 PGPPGPGGSPGKPGKPGKPGAPGAPGNPGKGASA-PCEPVTQPPCQPCPG-GPPGPAGPA 161 Query: 799 XXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP--PX 966 PP P P P P P PP P P P P P P P P Sbjct: 162 GPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDGAPGAPGGPGEPGASEQGGPGEPG 221 Query: 967 PXXPP 981 P PP Sbjct: 222 PAGPP 226 Score = 49.2 bits (112), Expect = 4e-06 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPP-PPX 789 P PP P P P P P PP PP P P P P P P PP P Sbjct: 141 PVTQPPCQPCPGGPPGPAGP--AGPPGPPGPDGNPGSPAGPSGPGPAGPPGPAGPAGNDG 198 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP P P P P P P PP Sbjct: 199 APGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGP---GPAGPKGPPGAA 255 Query: 970 XXP 978 P Sbjct: 256 GAP 258 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 3/117 (2%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P PP P PP P P P PP P P P P P P PP P Sbjct: 138 PCEPVTQPPCQPCPGGPPGPAGPAGPPGPPGPDGNP--GSPAGPSGPGPAGPPGPAGPAG 195 Query: 820 XXXXP--PXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P PP Sbjct: 196 NDGAPGAPGGPGEPGASEQGGPGEPGPAGPPGPAGPAGNDGAPGTGGPGPAGPKGPP 252 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G GGGG G GGG G G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPG--KPGAPGAPGNPGKG 134 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGGGXGXG 726 GG GGG GGG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G GGG GGG G GG G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GGG GGG GG G G G G G G G G G Sbjct: 86 GAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXG--XXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGG 851 GGGG G GGG G G G G G G G G G G G Sbjct: 88 GGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G GGG G G G G G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGP-PGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG-XGGXGXG 711 GG GGG GG G G GG G G G G G G G Sbjct: 85 GGAGGGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GG GGGG G G G GG G G G G Sbjct: 89 GGGGGGGGGCDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPG 129 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G G G GG G G G G G G Sbjct: 85 GGAGGGGGGG----GGG---CDGCCNPGPPGPGGSPGKPGKPGKPGAPGAPGNPGKG 134 >AL110490-3|CAB54449.1| 892|Caenorhabditis elegans Hypothetical protein Y48B6A.3 protein. Length = 892 Score = 51.6 bits (118), Expect = 8e-07 Identities = 38/104 (36%), Positives = 38/104 (36%), Gaps = 13/104 (12%) Frame = -3 Query: 890 GGGXGXGGGXGG------GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-------GGXX 750 GGG G GG G G GGG GG GG GGG GG Sbjct: 768 GGGGGGGGYRGNSYDDRRGGGGGGGGYNDRQDFGRNYGGRDGGGPQRYHDQQQQRQGGYQ 827 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G G G G G GGGGG G G GG G Sbjct: 828 GGGYGGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPG 871 Score = 51.2 bits (117), Expect = 1e-06 Identities = 39/117 (33%), Positives = 39/117 (33%), Gaps = 8/117 (6%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG-----XXGGG 777 GGG GG GG G GGG G GGG G Sbjct: 768 GGGGGGGGYRGNSYDDRRGGGGGGGGYNDRQDFGRNYGGRDGGGPQRYHDQQQQRQGGYQ 827 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG---XGXXGGXXGG 615 G G GGG GGGG G GG G G GGG G G GG GG Sbjct: 828 GGGYGGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPGYQRPPYRGGGGGG 884 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/102 (34%), Positives = 35/102 (34%), Gaps = 9/102 (8%) Frame = -3 Query: 977 GXXGXGGGXX-------GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX 819 G G GGG GG GG G GGG GGG GGG GG Sbjct: 786 GGGGGGGGYNDRQDFGRNYGGRDGGGPQRYHDQQQQRQGGYQGGGYGGGYGGGGGGGGGG 845 Query: 818 GGGXXXX--GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 GGG GG G GGG G G G G G Sbjct: 846 GGGSYHQPYNQDQRRGGRGGGGGPPGYQRPPYRGGGGGGYHG 887 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -3 Query: 980 GGXXGXG-GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G GG G GGG GG G GG GGG G GGG Sbjct: 824 GGYQGGGYGGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPGYQRPPYRGGG 881 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 GGG G G GGG G GG G GG G GG G Sbjct: 828 GGGYGGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPG 871 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG------GXGGGXGXXG 836 GGG G G GGG G G G GGG G G GGG G G Sbjct: 832 GGGYGGGGGGGGGGGGGSYHQPYNQDQRRGGRGGGGGPPGYQRPPYRGGGGGGYHG 887 >Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical protein C02C6.1a protein. Length = 830 Score = 51.2 bits (117), Expect = 1e-06 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +1 Query: 661 PPPXPXXXXPPPP--PXPXPXPXPPXP----XPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 PPP P P P P P P P P P P PP P P PPP PP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAP-PPPGMRPPPGAPGGGG 806 Query: 823 XXXPPXPPPXPPPXPPPXPXPPP 891 PP P P P PP PP Sbjct: 807 GMYPPLIPTRPGPGGPPPNMAPP 829 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 1/90 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P PP P PP P PP PP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPA--PPGGRQAP----MPPRGGPGAPP--PPGMRPPP 799 Query: 892 XXXXXPXXPXPPXXPP-PXPXXPPPXPXXP 978 PP P P P PPP P Sbjct: 800 GAPGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXP--PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P P P PP P PP P P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPA----PAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGA 801 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P PP PP Sbjct: 802 PGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +1 Query: 694 PPPXPX----PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P P P P P PP P P PPP PP P Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGG 807 Query: 862 XPPPXPXPPPXXXXXPXXPXPP 927 PP P P PP Sbjct: 808 MYPPLIPTRPGPGGPPPNMAPP 829 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P PP P PP P PPP P P P P Sbjct: 765 PVPRPAPAPPGGRQAPMPPRGGPGAPPPPG---MRPPPGAPGGGGGMYPPLIPTRPGPGG 821 Query: 960 PXPXPPPP 983 P P PP Sbjct: 822 PPPNMAPP 829 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 834 PPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXX-PXXPPPXPXPPPP 983 PP P P P P P P P P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPP 799 >U53333-6|AAA96159.2| 304|Caenorhabditis elegans Collagen protein 33 protein. Length = 304 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX----PXPPPPXXPPPXPXPPPP 786 P PP P PP P P PP P P P P PP P P Sbjct: 134 PGKPPVQPCEPITPPPCKPCPDGPAGPPGPPGAPGDAGTNGAPGAPGGDAPPGEAGPKGP 193 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXP----PPXPXPPPXXXXXPXXPXPPXXP-PPXPX 951 PP P P P P P P P PP P P P P Sbjct: 194 PGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQGPPGPPGQAGPDGQPGAPGGPGTPGSK 253 Query: 952 XPPPXPXXP 978 PP P P Sbjct: 254 GPPGNPGAP 262 Score = 49.6 bits (113), Expect = 3e-06 Identities = 36/121 (29%), Positives = 36/121 (29%), Gaps = 4/121 (3%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPP-XPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P PP P PP P P P PP P P Sbjct: 112 PAGAPGNPGRPGKPGAPGLPGNPGKPPVQPCEPITPPPCKPCPDGPAGPPGPPGAPGDAG 171 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP-PXXXXXPXXPXPPXXP-PPXPXXPPPX 966 P P P PP PP P P P P P P P PP Sbjct: 172 TNGAPGAPGGDAPPGEAGPKGPPGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQGPPGP 231 Query: 967 P 969 P Sbjct: 232 P 232 Score = 48.0 bits (109), Expect = 1e-05 Identities = 38/126 (30%), Positives = 38/126 (30%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPP P P P P PP P P P Sbjct: 122 PGKPGAPGLPGNPGKPPVQPCEPITPPPCK-PCPDGPAGPPGPPGAPGDAGTNGAPGAP- 179 Query: 799 XXXXPPPXXXXPPXPPPXP-PPXPPPXPXPP----PXXXXXPXXPXPPXXP-PPXPXXPP 960 PP P PP P P P P P P P P P P PP P Sbjct: 180 -GGDAPPGEAGPKGPPGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQGPPGPPGQAGPD 238 Query: 961 PXPXXP 978 P P Sbjct: 239 GQPGAP 244 Score = 47.2 bits (107), Expect = 2e-05 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 9/123 (7%) Frame = +1 Query: 640 PXPXXPXPPPX-PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP-XPXPPPPXXPPXXXXP 813 P P P P P P P P P P P PPP P P P PP Sbjct: 107 PGPAGPAGAPGNPGRPGKPGAPGLPGNPGKPPVQPCEPITPPPCKPCPDGPAGPPGPPGA 166 Query: 814 P--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP----PPXPXXP-PPXPX 972 P P P P P PP P P P P P P P P P Sbjct: 167 PGDAGTNGAPGAPGGDAPPGEAGPKGPPGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQ 226 Query: 973 XPP 981 PP Sbjct: 227 GPP 229 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 P P P P P P P P PP P P PPP P P P PP P Sbjct: 109 PAGPAGAPGNPGRPGKPGAPGLPGNPGKPPVQPCEPITPPPCKPCPDGPAGPPGPPGAPG 168 Query: 951 XPPPXPXPPPP 983 P P Sbjct: 169 DAGTNGAPGAP 179 Score = 39.1 bits (87), Expect = 0.005 Identities = 31/126 (24%), Positives = 31/126 (24%), Gaps = 3/126 (2%) Frame = +3 Query: 615 PXXPPXXP--PXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P PP P P P P P PP P P Sbjct: 134 PGKPPVQPCEPITPPPCKPCPDGPAGPPGPPGAPGDAGTNGAPGAPGGDAPPGEAGPKGP 193 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPX 965 P P P P P P P P PP PP P P P P P Sbjct: 194 PGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQGPPGPPGQAGPDGQPGAPGGPGTPGSK 253 Query: 966 PXPPPP 983 P P Sbjct: 254 GPPGNP 259 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/97 (26%), Positives = 26/97 (26%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P PP PP PP P P P P P P PP PP Sbjct: 179 PGGDAPPGEAGPKGPPGPPGSPGAPGEPGRPGDDAPSEPLIPGEPGPQGPPG----PPGQ 234 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P P P PP P P P Sbjct: 235 AGPDGQPGAPGGPGTPGSKGPPGNPGAPGADGKPGAP 271 >L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. Length = 830 Score = 51.2 bits (117), Expect = 1e-06 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +1 Query: 661 PPPXPXXXXPPPP--PXPXPXPXPPXP----XPPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 PPP P P P P P P P P P P PP P P PPP PP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAP-PPPGMRPPPGAPGGGG 806 Query: 823 XXXPPXPPPXPPPXPPPXPXPPP 891 PP P P P PP PP Sbjct: 807 GMYPPLIPTRPGPGGPPPNMAPP 829 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 1/90 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P PP P PP P PP PP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPA--PPGGRQAP----MPPRGGPGAPP--PPGMRPPP 799 Query: 892 XXXXXPXXPXPPXXPP-PXPXXPPPXPXXP 978 PP P P P PPP P Sbjct: 800 GAPGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 2/88 (2%) Frame = +1 Query: 616 PPXXP--PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P P P PP P PP P P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPA----PAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGA 801 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P PP PP Sbjct: 802 PGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +1 Query: 694 PPPXPX----PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P P P P P PP P P PPP PP P Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGG 807 Query: 862 XPPPXPXPPPXXXXXPXXPXPP 927 PP P P PP Sbjct: 808 MYPPLIPTRPGPGGPPPNMAPP 829 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P PP P PP P PPP P P P P Sbjct: 765 PVPRPAPAPPGGRQAPMPPRGGPGAPPPPG---MRPPPGAPGGGGGMYPPLIPTRPGPGG 821 Query: 960 PXPXPPPP 983 P P PP Sbjct: 822 PPPNMAPP 829 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 834 PPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXX-PXXPPPXPXPPPP 983 PP P P P P P P P P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPP 799 >AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical protein Y116A8C.32 protein. Length = 699 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G GGG GG GG G GG GGG G GG GG G G G GG G Sbjct: 499 GAGAGGGGGGHVASAGG--GISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGGRG 554 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GGG GG GG G G GGG G GGG GG G G G G G Sbjct: 499 GAGAGGGGGGHVASAGGGISAMTGA---GGEAPGGGAGGRGGGAHGGAGRGGGYQG---G 552 Query: 704 XGGGGG 687 GGG G Sbjct: 553 RGGGRG 558 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G GGG GG GG GG G GG GG GGG G Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Query: 728 GGXGXG 711 G G G Sbjct: 553 RGGGRG 558 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GGG G GG GGG GG GG GG GG Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Query: 800 XGGXXG 783 GG G Sbjct: 553 RGGGRG 558 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 985 GGGGGX--GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG GGG G G G GG GGG G G GG G GGG Sbjct: 504 GGGGGHVASAGGGISAMTGAGGEAPG-GGAGGRGGGAHGGAGRGGGYQGGRGGG 556 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G GGG G GGG G G G GGG G G GG G G G Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAG-GEAPGGGAGGRGGGAHGGAG-RGGGYQ 550 Query: 632 GGXXGG 615 GG GG Sbjct: 551 GGRGGG 556 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXG 783 G G G GG G G GGG G GG GGG GG GGG G G Sbjct: 493 GETPAAGAGAGGGGG--GHVASAGGGISAMTGAGGEAPGGGAGGR---GGGAHGGAGRGG 547 Query: 782 GGGXGXGGG 756 G G GGG Sbjct: 548 GYQGGRGGG 556 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXG---XGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 G G G G GG GG G GG GG G G GG G G G GG Sbjct: 499 GAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PPP PPPP P P P PPP Sbjct: 662 PVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPPP 698 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P PPP P PPPP PP P PPP Sbjct: 660 PMPVPPPGGLGGFMPPPPPP--PPMPGDLSSLLAAAPPPPP 698 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GG GGG G GG G G GGG G GG G Sbjct: 522 GAGGEAPGGGAGGRGGGAHGG------AGRGGGYQGGRGGGRG 558 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXG 845 GGG G G GG G G G GG G GGG G GGG G Sbjct: 514 GGGISAMTGAGGEAPGGGAG-GRGGGAHGGAGRGGGYQG--GRGGGRG 558 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Frame = +1 Query: 835 PXPPPXP-----PPXPPPXPXPPPXXXXXPXXPXPP 927 P PPP PP PPP P P P PP Sbjct: 662 PVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPP 697 >AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein protein. Length = 699 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G GGG GG GG G GG GGG G GG GG G G G GG G Sbjct: 499 GAGAGGGGGGHVASAGG--GISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGGRG 554 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GGG GG GG G G GGG G GGG GG G G G G G Sbjct: 499 GAGAGGGGGGHVASAGGGISAMTGA---GGEAPGGGAGGRGGGAHGGAGRGGGYQG---G 552 Query: 704 XGGGGG 687 GGG G Sbjct: 553 RGGGRG 558 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G GGG GG GG GG G GG GG GGG G Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Query: 728 GGXGXG 711 G G G Sbjct: 553 RGGGRG 558 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G G G GGG G GG GGG GG GG GG GG Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Query: 800 XGGXXG 783 GG G Sbjct: 553 RGGGRG 558 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 985 GGGGGX--GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG GGG G G G GG GGG G G GG G GGG Sbjct: 504 GGGGGHVASAGGGISAMTGAGGEAPG-GGAGGRGGGAHGGAGRGGGYQGGRGGG 556 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXX 633 G G GGG G GGG G G G GGG G G GG G G G Sbjct: 493 GETPAAGAGAGGGGGGHVASAGGGISAMTGAG-GEAPGGGAGGRGGGAHGGAG-RGGGYQ 550 Query: 632 GGXXGG 615 GG GG Sbjct: 551 GGRGGG 556 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGG-GXGGGXGGXXXXGGGXXXXGGXXG 783 G G G GG G G GGG G GG GGG GG GGG G G Sbjct: 493 GETPAAGAGAGGGGG--GHVASAGGGISAMTGAGGEAPGGGAGGR---GGGAHGGAGRGG 547 Query: 782 GGGXGXGGG 756 G G GGG Sbjct: 548 GYQGGRGGG 556 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXG---XGXGXXXXGGXGGGGXGXXGGXGGGXGXXGG 833 G G G G GG GG G GG GG G G GG G G G GG Sbjct: 499 GAGAGGGGGGHVASAGGGISAMTGAGGEAPGGGAGGRGGGAHGGAGRGGGYQGG 552 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PPP PPPP P P P PPP Sbjct: 662 PVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPPP 698 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 P P PPP P PPPP PP P PPP Sbjct: 660 PMPVPPPGGLGGFMPPPPPP--PPMPGDLSSLLAAAPPPPP 698 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGG 854 G GG GGG G GG G G GGG G GG G Sbjct: 522 GAGGEAPGGGAGGRGGGAHGG------AGRGGGYQGGRGGGRG 558 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXG 845 GGG G G GG G G G GG G GGG G GGG G Sbjct: 514 GGGISAMTGAGGEAPGGGAG-GRGGGAHGGAGRGGGYQG--GRGGGRG 558 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Frame = +1 Query: 835 PXPPPXP-----PPXPPPXPXPPPXXXXXPXXPXPP 927 P PPP PP PPP P P P PP Sbjct: 662 PVPPPGGLGGFMPPPPPPPPMPGDLSSLLAAAPPPP 697 >U53155-5|AAC48270.1| 303|Caenorhabditis elegans Collagen protein 43 protein. Length = 303 Score = 50.4 bits (115), Expect = 2e-06 Identities = 36/128 (28%), Positives = 36/128 (28%), Gaps = 11/128 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX----PXPPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P P Sbjct: 133 PGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGP 192 Query: 787 XXPPXXXXPP-------PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP P P P P P PP P PP P P Sbjct: 193 PGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPK 252 Query: 946 PXXPPPXP 969 P P Sbjct: 253 GSPGPDGP 260 Score = 49.2 bits (112), Expect = 4e-06 Identities = 38/129 (29%), Positives = 38/129 (29%), Gaps = 7/129 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P P P P PP P P P P P PP P PP P Sbjct: 111 PAGVPGKPGKPGRPGAPGQP--GVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGD 168 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPXX 954 P P P P P P PP PP P P P P Sbjct: 169 PGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDA 228 Query: 955 PPPXPXXPP 981 P P PP Sbjct: 229 GPAGPPGPP 237 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 5/88 (5%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPP----PPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXX 897 P PP P P P P P P PP P PPP P P PP P PP Sbjct: 106 PGPPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGA 165 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P PP Sbjct: 166 PGDPGEAGTPGRPGTDATPGLPGPRGPP 193 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P P P P PP P P PPP P P P PP P Sbjct: 108 PPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPG 167 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 168 DPGEAGTPGRP 178 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 1/94 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P PP P PPP P PP PP PP Sbjct: 106 PGPPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPP--GPPGPP 163 Query: 871 PXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPPXP 969 P P P P P P P PP P Sbjct: 164 GAPG-DPGEAGTPGRPGTDATPGLPGPRGPPGPP 196 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 6/115 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P P P P P P P P PP P Sbjct: 143 PTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQP 202 Query: 781 -PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP P P P P P P P Sbjct: 203 GPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPKGSPGP 257 Score = 41.9 bits (94), Expect = 7e-04 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 1/121 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPP P P P P PP P P P Sbjct: 121 PGRPGAPGQPGVPGKPPTAPCEPTTPPP-CKPCPQGPPGPPGPPGAPGDPGEAGTPGRPG 179 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXX 975 P P PP P P P P P P PP P Sbjct: 180 TDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGA 239 Query: 976 P 978 P Sbjct: 240 P 240 Score = 37.1 bits (82), Expect = 0.019 Identities = 29/123 (23%), Positives = 29/123 (23%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 130 PGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGP 189 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P PP P P P P Sbjct: 190 RGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGP-PGP 248 Query: 975 PPP 983 P P Sbjct: 249 PGP 251 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PP P PP PP P P P P PP P Sbjct: 234 PGPPGAPGNDGPPGPPGPKGSPGPDGPAGVDGQAGPPGP 272 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P PP P P PP P P Sbjct: 192 PPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGP 251 Query: 796 PXXXXPP-PXXXXPPXPPPXPP 858 P P PP PP Sbjct: 252 KGSPGPDGPAGVDGQAGPPGPP 273 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/107 (22%), Positives = 24/107 (22%), Gaps = 1/107 (0%) Frame = +2 Query: 662 PXPXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXX 841 P P P PP P P P P P P P P Sbjct: 151 PCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGT 210 Query: 842 XXXXXXXXXXXXXXP-PPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 P P PP P PP P P P P Sbjct: 211 PAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPKGSPGP 257 Score = 30.3 bits (65), Expect = 2.2 Identities = 28/121 (23%), Positives = 28/121 (23%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P PP P P Sbjct: 159 PPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLT 218 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP P P P P P P P P Sbjct: 219 ----PGAPGEAGDA--GPAGPPGPPGAPGNDGPPGPPGPKGSPGPDGPAGVDGQAGPPGP 272 Query: 975 P 977 P Sbjct: 273 P 273 >AL132898-7|CAC14410.1| 413|Caenorhabditis elegans Hypothetical protein Y59A8B.10 protein. Length = 413 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 G G GGG GGG GG GGGG G G G G GG G G Sbjct: 230 GSANSGPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGGGQGYGGP 289 Query: 704 XGGGGGXXXXGXG 666 GG G G G Sbjct: 290 QFGGQGGPQFGNG 302 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G G G GG GG GGG GG GGGG G G G Sbjct: 223 GKGSGPSGSANSGPSGGGGGG---GGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFG 279 Query: 710 XGXGGG-GGXXXXGXGG 663 G G G GG G GG Sbjct: 280 GGGGQGYGGPQFGGQGG 296 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G GGG G GGG GGG G G G G GG Sbjct: 223 GKGSGPSGSANSGPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFG-GG 281 Query: 758 GXXGGGGXGXGGXGXGXGXGGG 693 G G GG GG G G G G Sbjct: 282 GGQGYGGPQFGGQG-GPQFGNG 302 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/89 (31%), Positives = 28/89 (31%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG GG G GG GGG G G GGG Sbjct: 227 GPSGSANSGPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGGGQGY 286 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GG G G GG G G G G Sbjct: 287 GGPQFG---GQGGPQFGNGNNKYPMSGLG 312 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG-XGXGGGG 690 G G G G GGG GG GGG G GG G G GGGG Sbjct: 223 GKGSGPSGSANSGPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGG 282 Query: 689 GXXXXGXG-GGXGXXGXG 639 G G GG G G Sbjct: 283 GQGYGGPQFGGQGGPQFG 300 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G GGG GG GGG G GGG G GG G G Sbjct: 238 GGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGGGQGYGGPQFGGQGG 296 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GGG G GGG G GGGGG G G G G G G GG Sbjct: 238 GGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGGGQGYGGPQFGG 293 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G GGG G G GGGG G G G G G G G Sbjct: 235 GPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGGGQGYGGPQFGGQ 294 Query: 802 GGXGXGXG 779 GG G G Sbjct: 295 GGPQFGNG 302 Score = 39.5 bits (88), Expect = 0.004 Identities = 29/87 (33%), Positives = 29/87 (33%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G GG GG G G GG GGG GG Sbjct: 225 GSGPSGSANSGPSGGGGGGGG--GGQSNNNSSFSSVPAFNGGGGGG-------GGMNVGA 275 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G GGGG G GG GG G G G Sbjct: 276 AGFGGGGGQGYGGPQFGGQGGPQFGNG 302 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G G G G G GG GGGG G G G G GGG Sbjct: 223 GKGSGPSGSANSGPS----GG--GGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAA 276 Query: 674 GXGGGXGXXGXGXXGGXXGG 615 G GGG G G G GG Sbjct: 277 GFGGGGGQGYGGPQFGGQGG 296 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = -1 Query: 958 GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXG-----GGXGXXGGGXXXXGXXGXGGX 794 G G G G GG GGG G G GGG GG Sbjct: 223 GKGSGPSGSANSGPSGGGGGGGGGGQSNNNSSFSSVPAFNGGGGGGGGMNVGAAGFGGGG 282 Query: 793 GXGXGG 776 G G GG Sbjct: 283 GQGYGG 288 >AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical protein Y113G7B.23 protein. Length = 789 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 4/77 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP----PXPXPPPPXXPPXXXXPPPX 822 P PPP PPP P PP PP PP P P PPPP PPP Sbjct: 680 PPPPPQGQQYYGGPPPPGQPY-GPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPP 738 Query: 823 XXXPPXPPPXPPPXPPP 873 P P PPP Sbjct: 739 QPGHPYQQPYGQMPPPP 755 Score = 45.2 bits (102), Expect = 7e-05 Identities = 33/118 (27%), Positives = 33/118 (27%), Gaps = 1/118 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXX 804 P P PP P PPP PP PPPP Sbjct: 630 PGGPPQQAYRYPPQQGQQYSPYPPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQY 689 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PP P PP PP PP P PP PPP P P Sbjct: 690 YGGPP----PPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQPGHP 743 Score = 44.8 bits (101), Expect = 1e-04 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 9/114 (7%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX---PPPPXXPPPXPXPPPPXXP- 795 PP P PPP PP PPPP PPPP P Sbjct: 641 PPQQGQQYSPYPPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYYGGPPPPGQPY 700 Query: 796 -PXXXXPPPXXXXPPXPPPXPPPXPPPXP----XPPPXXXXXPXXPXPPXXPPP 942 P PP P P P P PP PPP P PPP Sbjct: 701 GPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQPGHPYQQPYGQMPPP 754 Score = 41.5 bits (93), Expect = 9e-04 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 2/105 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P PPPP P PPPP P PP PP PP P P PP P Sbjct: 674 PGGGQGPPPP---PQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYP---GPPPPQ 727 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PP P P PP Sbjct: 728 QQRGYGYPPPPQPGHPYQQPYGQMPPPPHGQYQPQQQQGGPMGPP 772 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP--- 947 PP PP P P P P PP P PP P P P PP Sbjct: 673 PPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGY 732 Query: 948 -XXPPPXPXPP 977 PPP P P Sbjct: 733 GYPPPPQPGHP 743 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P PP PP P PPPP P P P P P Sbjct: 694 PPPGQPYGPPGGYPPQQQ-RPPYQAQPYPGPPPPQQQRGYG-YPPPPQPGHPYQQPYGQM 751 Query: 972 PPPP 983 PPPP Sbjct: 752 PPPP 755 Score = 38.7 bits (86), Expect = 0.006 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 16/123 (13%) Frame = +1 Query: 661 PPPXPXXXXPPP-PPXPXPXPXPPXPXPPP--------PXXPPPXPXP-PPPXXPPXXXX 810 PP P PP P P P P PP P PP PP Sbjct: 592 PPSTPQAPQAPPVQAAPAPVQAPQAPQAPPQAYQGYGGPGGPPQQAYRYPPQQGQQYSPY 651 Query: 811 PPPXXXXPPXPPPXP------PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 PPP PP P PPP P PP P P PP Sbjct: 652 PPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQ 711 Query: 973 XPP 981 PP Sbjct: 712 RPP 714 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 PP P P PP P PP P P P PPP PPP Sbjct: 680 PPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQ 739 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP P P PP Sbjct: 740 PGHPYQQPYGQMPPPPHGQYQPQQQQGGPMGPP 772 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPX---PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP PPP P PPPP P P P P P PPPP Sbjct: 673 PPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPP 726 >AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like protein protein. Length = 789 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 4/77 (5%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP----PXPXPPPPXXPPXXXXPPPX 822 P PPP PPP P PP PP PP P P PPPP PPP Sbjct: 680 PPPPPQGQQYYGGPPPPGQPY-GPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPP 738 Query: 823 XXXPPXPPPXPPPXPPP 873 P P PPP Sbjct: 739 QPGHPYQQPYGQMPPPP 755 Score = 45.2 bits (102), Expect = 7e-05 Identities = 33/118 (27%), Positives = 33/118 (27%), Gaps = 1/118 (0%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXX 804 P P PP P PPP PP PPPP Sbjct: 630 PGGPPQQAYRYPPQQGQQYSPYPPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQY 689 Query: 805 XXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP PP P PP PP PP P PP PPP P P Sbjct: 690 YGGPP----PPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQPGHP 743 Score = 44.8 bits (101), Expect = 1e-04 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 9/114 (7%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX---PPPPXXPPPXPXPPPPXXP- 795 PP P PPP PP PPPP PPPP P Sbjct: 641 PPQQGQQYSPYPPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYYGGPPPPGQPY 700 Query: 796 -PXXXXPPPXXXXPPXPPPXPPPXPPPXP----XPPPXXXXXPXXPXPPXXPPP 942 P PP P P P P PP PPP P PPP Sbjct: 701 GPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQPGHPYQQPYGQMPPP 754 Score = 41.5 bits (93), Expect = 9e-04 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 2/105 (1%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P PPPP P PPPP P PP PP PP P P PP P Sbjct: 674 PGGGQGPPPP---PQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYP---GPPPPQ 727 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PP P P PP Sbjct: 728 QQRGYGYPPPPQPGHPYQQPYGQMPPPPHGQYQPQQQQGGPMGPP 772 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXP--- 947 PP PP P P P P PP P PP P P P PP Sbjct: 673 PPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGY 732 Query: 948 -XXPPPXPXPP 977 PPP P P Sbjct: 733 GYPPPPQPGHP 743 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P PP PP P PPPP P P P P P Sbjct: 694 PPPGQPYGPPGGYPPQQQ-RPPYQAQPYPGPPPPQQQRGYG-YPPPPQPGHPYQQPYGQM 751 Query: 972 PPPP 983 PPPP Sbjct: 752 PPPP 755 Score = 38.7 bits (86), Expect = 0.006 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 16/123 (13%) Frame = +1 Query: 661 PPPXPXXXXPPP-PPXPXPXPXPPXPXPPP--------PXXPPPXPXP-PPPXXPPXXXX 810 PP P PP P P P P PP P PP PP Sbjct: 592 PPSTPQAPQAPPVQAAPAPVQAPQAPQAPPQAYQGYGGPGGPPQQAYRYPPQQGQQYSPY 651 Query: 811 PPPXXXXPPXPPPXP------PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPX 972 PPP PP P PPP P PP P P PP Sbjct: 652 PPPQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQ 711 Query: 973 XPP 981 PP Sbjct: 712 RPP 714 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP-PPPXXPPPXPXPPPPXX 792 PP P P PP P PP P P P PPP PPP Sbjct: 680 PPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPPQQQRGYGYPPPPQ 739 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P PP P P PP Sbjct: 740 PGHPYQQPYGQMPPPPHGQYQPQQQQGGPMGPP 772 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPX---PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PP PPP P PPPP P P P P P PPPP Sbjct: 673 PPGGGQGPPPPPQGQQYYGGPPPPGQPYGPPGGYPPQQQRPPYQAQPYPGPPPP 726 >AB072926-1|BAB69889.1| 303|Caenorhabditis elegans collagen protein. Length = 303 Score = 50.4 bits (115), Expect = 2e-06 Identities = 36/128 (28%), Positives = 36/128 (28%), Gaps = 11/128 (8%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX----PXPPPPXXPPPXPXPPPP 786 P PP P PP P PP PP P P P P P P P P P Sbjct: 133 PGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGP 192 Query: 787 XXPPXXXXPP-------PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP P P P P P PP P PP P P Sbjct: 193 PGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPK 252 Query: 946 PXXPPPXP 969 P P Sbjct: 253 GSPGPDGP 260 Score = 49.2 bits (112), Expect = 4e-06 Identities = 38/129 (29%), Positives = 38/129 (29%), Gaps = 7/129 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 P P P P P P P PP P P P P P PP P PP P Sbjct: 111 PAGVPGKPGKPGRPGAPGQP--GVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGD 168 Query: 793 PPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPP----PXXXXXPXXPXPPXXPPPXPXX 954 P P P P P P PP PP P P P P Sbjct: 169 PGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDA 228 Query: 955 PPPXPXXPP 981 P P PP Sbjct: 229 GPAGPPGPP 237 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 5/88 (5%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPP----PPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXX 897 P PP P P P P P P PP P PPP P P PP P PP Sbjct: 106 PGPPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGA 165 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P PP Sbjct: 166 PGDPGEAGTPGRPGTDATPGLPGPRGPP 193 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPX 950 PP P P P P P P P PP P P PPP P P P PP P Sbjct: 108 PPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPG 167 Query: 951 XPPPXPXPPPP 983 P P P Sbjct: 168 DPGEAGTPGRP 178 Score = 48.0 bits (109), Expect = 1e-05 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 1/94 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P PP P PPP P PP PP PP Sbjct: 106 PGPPGPAGVPGKPGKPGRPGAPGQPGVPGKPPTAPCEPTTPPPCKPCPQGPP--GPPGPP 163 Query: 871 PXPXPPPXXXXXPXXPXPPXXPP-PXPXXPPPXP 969 P P P P P P P PP P Sbjct: 164 GAPG-DPGEAGTPGRPGTDATPGLPGPRGPPGPP 196 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 6/115 (5%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPP-----PPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P PP P P P PP P P P P P P P P PP P Sbjct: 143 PTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQP 202 Query: 781 -PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP P P P P P P P Sbjct: 203 GPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPKGSPGP 257 Score = 41.9 bits (94), Expect = 7e-04 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 1/121 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPP P P P P PP P P P Sbjct: 121 PGRPGAPGQPGVPGKPPTAPCEPTTPPP-CKPCPQGPPGPPGPPGAPGDPGEAGTPGRPG 179 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXX 975 P P PP P P P P P P PP P Sbjct: 180 TDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGA 239 Query: 976 P 978 P Sbjct: 240 P 240 Score = 37.1 bits (82), Expect = 0.019 Identities = 29/123 (23%), Positives = 29/123 (23%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P PP P P P P P Sbjct: 130 PGVPGKPPTAPCEPTTPPPCKPCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGP 189 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P PP P P P P Sbjct: 190 RGPPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGP-PGP 248 Query: 975 PPP 983 P P Sbjct: 249 PGP 251 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PP P PP PP P P P P PP P Sbjct: 234 PGPPGAPGNDGPPGPPGPKGSPGPDGPAGVDGQAGPPGP 272 Score = 32.7 bits (71), Expect = 0.41 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P PP P P PP P P Sbjct: 192 PPGPPGEAGQPGPQGDAGTPAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGP 251 Query: 796 PXXXXPP-PXXXXPPXPPPXPP 858 P P PP PP Sbjct: 252 KGSPGPDGPAGVDGQAGPPGPP 273 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/107 (22%), Positives = 24/107 (22%), Gaps = 1/107 (0%) Frame = +2 Query: 662 PXPXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXX 841 P P P PP P P P P P P P P Sbjct: 151 PCPQGPPGPPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGT 210 Query: 842 XXXXXXXXXXXXXXP-PPXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 P P PP P PP P P P P Sbjct: 211 PAQSEPLTPGAPGEAGDAGPAGPPGPPGAPGNDGPPGPPGPKGSPGP 257 Score = 30.3 bits (65), Expect = 2.2 Identities = 28/121 (23%), Positives = 28/121 (23%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P PP P P P P P PP P P Sbjct: 159 PPGPPGAPGDPGEAGTPGRPGTDATPGLPGPRGPPGPPGEAGQPGPQGDAGTPAQSEPLT 218 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP PP P P P P P P P P Sbjct: 219 ----PGAPGEAGDA--GPAGPPGPPGAPGNDGPPGPPGPKGSPGPDGPAGVDGQAGPPGP 272 Query: 975 P 977 P Sbjct: 273 P 273 >Z70208-2|CAA94136.1| 304|Caenorhabditis elegans Hypothetical protein F54B11.2 protein. Length = 304 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 1/95 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PX 822 P P PP P P P P P P P P P P PP PP P Sbjct: 180 PAAPSPPGPPGPSGPAGPAGNDGAAGTPGPDGPAGESTYPEPAAPGPAGPPGPAGPPGPD 239 Query: 823 XXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P PP P P P PP Sbjct: 240 GASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGPP 274 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 2/116 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPX--PXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 PP P P P PP P P P P P PP P P P Sbjct: 149 PPCKPCPAGPPGPPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPSGPAGPAGNDGAAGTPG 208 Query: 802 XXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P PP P PP P PP P P P Sbjct: 209 PDGPAGESTYP--EPAAPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAP 262 Score = 46.0 bits (104), Expect = 4e-05 Identities = 36/125 (28%), Positives = 36/125 (28%), Gaps = 4/125 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX--PXPPPPXX 792 P P P P P P P P P PPP P P P PP P Sbjct: 108 PGPPGVAGNPGKPGKPGKPGAPGNPGAPGKGAA-VPCEAKTPPPCKPCPAGPPGPPGPDG 166 Query: 793 PPXXXXPPPXXXXP--PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P P P P PP P P P P P P P P P Sbjct: 167 PAGPAGPDGEAGSPAAPSPPGPPGPSGPAGPAGNDGAAGTP-GPDGPAGESTYPEPAAPG 225 Query: 967 PXXPP 981 P PP Sbjct: 226 PAGPP 230 Score = 46.0 bits (104), Expect = 4e-05 Identities = 34/128 (26%), Positives = 34/128 (26%), Gaps = 7/128 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXP------PPXPXP 777 P P P P PP P P P PP P P P P P P P Sbjct: 126 PGAPGNPGAPGKGAAVPCEAKTPPPCKPCPAGPPGPPGPDGPAGPAGPDGEAGSPAAPSP 185 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P P P P P P P P Sbjct: 186 PGPPGPSGPAGPAGNDGAAGTPGPDGPAGESTYPEPAAPGPAGPPGPAGPPGPDGASPTA 245 Query: 958 PPXPXXPP 981 P PP Sbjct: 246 APGAAGPP 253 Score = 39.1 bits (87), Expect = 0.005 Identities = 32/120 (26%), Positives = 32/120 (26%), Gaps = 6/120 (5%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--P--PXXPPPXPXPPPP 786 P P P P P P P P P P P P P P P P Sbjct: 117 PGKPGKPGKPGAPGNPGAPGKGAAVPCEAKTPPPCKPCPAGPPGPPGPDGPAGPAGPDGE 176 Query: 787 XXPPXXXXP--PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P PP P P P P P P P PP P PP Sbjct: 177 AGSPAAPSPPGPPGPSGPAGPAGNDGAAGTPGPDGPAGESTYPEPAAPGPAGPPGPAGPP 236 Score = 35.5 bits (78), Expect = 0.058 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 4/120 (3%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPX-PXXXXXXP--PPPPXXXPPXXPXXXXXXXXXXXXXXXXPPX 785 P PP PP P P P P P PP P P P Sbjct: 155 PAGPPG-PPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPSGPAGPAGNDGAAGTPGPDGPA 213 Query: 786 PXPXPPXPXXPXXXXPP-PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 P P P PP P P P P PP P P P P P Sbjct: 214 GESTYPEPAAPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGP 273 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP-XPPPPXXPPPXPXPP 780 P P P P PP P P P P PP P P P P PP Sbjct: 219 PEPAAPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPPGPAGAPGPDGNPGTAGPP 274 Score = 31.5 bits (68), Expect = 0.95 Identities = 28/110 (25%), Positives = 28/110 (25%), Gaps = 15/110 (13%) Frame = +2 Query: 698 PPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXXX 877 PP P P P PP P P P P P P PP Sbjct: 148 PPPCKPCPA-GPPGPPGPDGPAGPAGPDGEAGSPAAPSPPGPPGPSGPAGPAGNDGAAGT 206 Query: 878 XXPP-------------PXPXXXPXP--PPXPXXPXPPXPXPPXXPPXPP 982 P P P P P PP P P PP PP Sbjct: 207 PGPDGPAGESTYPEPAAPGPAGPPGPAGPPGPDGASPTAAPGAAGPPGPP 256 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P P P P PP P P P P P P P P Sbjct: 207 PGPDGPAGESTYPEPAAPGPAGPPGPAGPP--GPDGASPTAAPGAAGPPGPPGPAGAPGP 264 >AL022716-5|CAB97232.1| 291|Caenorhabditis elegans Hypothetical protein C24F3.6 protein. Length = 291 Score = 50.0 bits (114), Expect = 3e-06 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P PP P P P P P PP PP P Sbjct: 99 PPGTPGSAGRPGKPGAPGL--NGNPGRPPKEPCEPLTPPPCKPCPEGPPGPAGPPGPDGN 156 Query: 796 PXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P P P P PP P P P P P P P Sbjct: 157 KGPLGPPGPPGPEGPNGEPGNKGPAGPPGPGGKPGPAGPPGENGNNGEPQPGAPGEPGQP 216 Query: 970 XXP 978 P Sbjct: 217 GQP 219 Score = 45.2 bits (102), Expect = 7e-05 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 12/106 (11%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPP-------PXXPPPXPXPPPPXXPPXXXXPPP 819 PP P PPP P P PP P PP P PP P P P P P Sbjct: 124 PPKEPCEPLTPPPCKPCPE-GPPGPAGPPGPDGNKGPLGPPGPPGPEGPNGEPGNKGPA- 181 Query: 820 XXXXPPXPPPXPPPXPPPXPX-----PPPXXXXXPXXPXPPXXPPP 942 PP P P P PP P P P P P P Sbjct: 182 ---GPPGPGGKPGPAGPPGENGNNGEPQPGAPGEPGQPGQPGQRGP 224 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/101 (30%), Positives = 31/101 (30%), Gaps = 2/101 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPP-P 819 P PP P P P P P P P P P P P PP PP P Sbjct: 94 PGAQGPPGTPGSAGRPGKPGAPGLNGNPGRPPKEPCEPLTPPPCKPCPEGPPGPAGPPGP 153 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PP PP P P P P P P P Sbjct: 154 DGNKGPLGPPGPP--GPEGPNGEPGNKGPAGPPGPGGKPGP 192 Score = 39.1 bits (87), Expect = 0.005 Identities = 34/105 (32%), Positives = 34/105 (32%), Gaps = 9/105 (8%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXP- 867 PP P P P P P P P P P PPP P PP P PP P Sbjct: 99 PPGTPGSAGRPGKPGAPGLNGNPGRP-PKEPCEP---LTPPPCKPCPEGPPGPAGPPGPD 154 Query: 868 -------PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P P P PP P P P PP Sbjct: 155 GNKGPLGPPGPPGPEGPNGEPGNKGPAG--PPGPGG-KPGPAGPP 196 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP P P PPP P P PP P P PP Sbjct: 121 PGRPPKEPCEPLTPPPCKPCPEGPPGPAGPPGPDGNKGPLGPPGPP 166 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 10/76 (13%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPX--------PXPPPPXXP--PPX 768 P PP P P P P PP P P P P P P P P P Sbjct: 159 PLGPPGPPGPEGPNGEPGNKGPAGPPGPGGKPGPAGPPGENGNNGEPQPGAPGEPGQPGQ 218 Query: 769 PXPPPPXXPPXXXXPP 816 P P P P Sbjct: 219 PGQRGPAGEPGKDGSP 234 >Z69386-1|CAA93430.1| 241|Caenorhabditis elegans Hypothetical protein ZK596.1 protein. Length = 241 Score = 49.6 bits (113), Expect = 3e-06 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 2/83 (2%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGG--XGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGX 714 GG G GG GG GG G GG GG GG G GG GG G G Sbjct: 160 GGQGPFGGFPGGHQGGFPGGNQGGFGGNQGGFGGNQGGFPFGNQGG--NQGGFPFGNPGN 217 Query: 713 GXGXGGGGGXXXXGXGGGXGXXG 645 G GG G G GG G G Sbjct: 218 QGGFGGNQGGNQGGFGGNRGGRG 240 Score = 46.8 bits (106), Expect = 2e-05 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG-GGXGX 765 G G GG GG G GG GG GG GG G G G G G Sbjct: 161 GQGPFGGFPGGHQGGFPGGNQGGFGGNQGGFGGNQGGFPFGNQGGNQGGFPFGNPGNQGG 220 Query: 764 GGGXXGGGGXGXGGXGXGXG 705 GG GG G GG G G Sbjct: 221 FGGNQGGNQGGFGGNRGGRG 240 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG GG G GG GG G G GG G GG GG G Sbjct: 160 GGQGPFGGFPGGHQGGFPGGNQGGFGGNQGGFGGNQGGFPFGNQGGNQGGFPFGNPGNQG 219 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 G GG G GG GG G Sbjct: 220 GFGGNQGGNQGGFGGNRGGRG 240 Score = 41.5 bits (93), Expect = 9e-04 Identities = 31/80 (38%), Positives = 31/80 (38%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXX 675 G GG G GG GG GG G GG GG G GG G GG G Sbjct: 157 GEHGGQGPFGGFPGGHQ--GGFPGGNQGGFGGNQ-GGFGGNQGGFPFG-NQGGNQGGFPF 212 Query: 674 GXGGGXGXXGXGXXGGXXGG 615 G G G G G GG GG Sbjct: 213 GNPGNQGGFG-GNQGGNQGG 231 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G G G GG GG GG GG GG G GG G G Sbjct: 157 GEHGGQGPFGGFPGGHQG-GFPGGNQGGFGGNQGGFGGNQGGFPF--GNQGGNQGGFPFG 213 Query: 755 XXGGGGXGXGGXGXGXGXGGG 693 G G G G G GG Sbjct: 214 NPGNQGGFGGNQGGNQGGFGG 234 >U21320-5|AAA62536.2| 332|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 7 protein. Length = 332 Score = 49.6 bits (113), Expect = 3e-06 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GGG GG GGG G GG GG GG GG G GGG G Sbjct: 262 GGGGGFGGGGRDRFNDRSGGGGYGGDRDRGGDRGGDRGGSRYSTGGGSGGGYRSGGGSSG 321 Query: 767 XGGGXXGG 744 GGG G Sbjct: 322 GGGGGRYG 329 Score = 48.0 bits (109), Expect = 1e-05 Identities = 35/114 (30%), Positives = 35/114 (30%), Gaps = 1/114 (0%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG-GGXGGGXGGXXXXGGGXXXXGG 792 G GGG G GGG GG GG GGG Sbjct: 217 GFGGGYEDRDRERSGSRDRRQDSYRNGGGNDRDRRESSGGFRDNRGGGGGFGGGGRDRFN 276 Query: 791 XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GGG G GG GG G G GGG G GG G G G G Sbjct: 277 DRSGGG-GYGGDRDRGGDRGGDRGGSRYSTGGGSGGGYRSGGGSSGGGGGGRYG 329 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG-XGGXXXXGGGXX 804 GG GG G GGG GG GG GG GG GGG Sbjct: 255 GGFRDNRGGGGGFGGGGRDRFNDRSGGGGYGGDRDRGGDRGGDRGGSRYSTGGGSGGGYR 314 Query: 803 XXGGXXGGGGXGXGG 759 GG GGGG G G Sbjct: 315 SGGGSSGGGGGGRYG 329 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/87 (34%), Positives = 30/87 (34%), Gaps = 1/87 (1%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GGG GG GG GG GGG GGG G G G G Sbjct: 243 GGGNDRDRRESSGGFRDNRGGG---GGFGGGGRDRFNDRSGGGGYGGDRDRGGDRGGDRG 299 Query: 692 GGXXXXGXGGGXG-XXGXGXXGGXXGG 615 G G G G G G G GG GG Sbjct: 300 GSRYSTGGGSGGGYRSGGGSSGGGGGG 326 Score = 37.9 bits (84), Expect = 0.011 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 6/69 (8%) Frame = -1 Query: 985 GGGGGXGXGGGXX--GXXGGXGXGX----GXXXXGGXGGGGXGXXGGXGGGXGXXGGGXX 824 GGGGG G GG GG G G G G GG GG GGG GGG Sbjct: 262 GGGGGFGGGGRDRFNDRSGGGGYGGDRDRGGDRGGDRGGSRYSTGGGSGGGY-RSGGGSS 320 Query: 823 XXGXXGXGG 797 G G G Sbjct: 321 GGGGGGRYG 329 >U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 3 protein. Length = 302 Score = 49.2 bits (112), Expect = 4e-06 Identities = 39/128 (30%), Positives = 39/128 (30%), Gaps = 10/128 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP----XPXPPPPXXPPPXPXPPP 783 PP P P P P P P P P PP P PP P PP P Sbjct: 115 PPGPPGRDGRPGAPGRPGNPGPPGRDGALLPGPPPKPPCQKCPPGPPGPAGPPGPKGLPG 174 Query: 784 PXXPPXXXXPP--PXXXXPPXP--PPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXP-PPX 945 P P PP P P P P P P P PP P PP Sbjct: 175 PQGDAGTSGQDGVPGLPGPPGPSGPQGAPGVPGEKGPTGEPGKVINGAPPGPPGPPGPPG 234 Query: 946 PXXPPPXP 969 P PP P Sbjct: 235 PQGPPGPP 242 Score = 48.0 bits (109), Expect = 1e-05 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 2/120 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P P P P P PP P P PP P PP Sbjct: 112 PPGPPGPPGRDGRPGAPGRPGNPGPPGRDGALLPGPPPKPPCQKCP-PGPPGPAGPPGPK 170 Query: 808 X-PPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P PP P P P P P PP P PP Sbjct: 171 GLPGPQGDAGTSGQDGVPGLPGPPGPSGPQGAPGVPGEKGPTGEPGKVINGAPPGPPGPP 230 Score = 48.0 bits (109), Expect = 1e-05 Identities = 42/143 (29%), Positives = 42/143 (29%), Gaps = 22/143 (15%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX-----------PPXPXPPPPXXPPP 765 P PP P P PP P PP P P P P P PP P P Sbjct: 145 PGPPPKPPCQKCPPGPPGPAG---PPGPKGLPGPQGDAGTSGQDGVPGLPGPPGPSGPQG 201 Query: 766 XPXPPPPXXPPXXXXP-----PPXXXXPPXPP-PXPPPXPP-----PXPXPPPXXXXXPX 912 P P P PP PP PP P PP PP P PP P Sbjct: 202 APGVPGEKGPTGEPGKVINGAPPGPPGPPGPPGPQGPPGPPGKDGQPGKAGPPGLPGDPG 261 Query: 913 XPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P Sbjct: 262 EKGSDGLPGPHGGTGPRGPPGQP 284 Score = 35.1 bits (77), Expect = 0.077 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 5/91 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXX 804 P P PP P PP PP P P PP P PP P P Sbjct: 211 PTGEPGKVINGAPPGPPG---PPGPPGPQGPPGPPGKDGQPGKAGPPG-LPGDPGEKGSD 266 Query: 805 XXPPPXXXXPPXPPPXPP----PXPPPXPXP 885 P P P PP P PPP P Sbjct: 267 GLPGPHGGTGPRGPPGQPGSCDHCPPPRTGP 297 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPX-PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPX 789 P PP P P P PP P P P P P P P PP Sbjct: 223 PPGPPGPPGPPGPQGPPGPPGKDGQPGKAGPPGLPGDPGEKGSDGLPGPHGGTGPRGPPG 282 Query: 790 XPPXXXXPPPXXXXP 834 P PP P Sbjct: 283 QPGSCDHCPPPRTGP 297 >AL110484-17|CAB54408.1| 586|Caenorhabditis elegans Hypothetical protein Y38E10A.17 protein. Length = 586 Score = 49.2 bits (112), Expect = 4e-06 Identities = 43/133 (32%), Positives = 43/133 (32%), Gaps = 11/133 (8%) Frame = -3 Query: 980 GGXXGXGGGXX------GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX 819 GG GGG G G GG GGG G GG G G GGG GG Sbjct: 424 GGNNAGGGGSSAEVRSVGFGAQQFGG-SQFARPIPAGGGGGGSGGYGAG-GGGSGGYGAG 481 Query: 818 GGGXXXXGGXXGG-GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG----XGGGXG 654 G G G G G G GG G GGG G G G Sbjct: 482 GAGGARNSASNGSYGSSANEVKSVGFGAQQYGGSVFAKPSGTGGGYVSAGSSARKSGESG 541 Query: 653 XXGXGXXGGXXGG 615 G G GG GG Sbjct: 542 AGGGGAGGGKAGG 554 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/105 (29%), Positives = 31/105 (29%), Gaps = 1/105 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG-GXXXXGGGXXX 801 G G G G G GGG GG G G G G G GG Sbjct: 459 GGGGGGSGGYGAGGGGSGGYGAGGAGGARNSASNGSYGSSANEVKSVGFGAQQYGGSVFA 518 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GGG G G G GG G G G GG G Sbjct: 519 KPSGTGGGYVSAGSSARKSGESGAGGGGAGGG-KAGGAKNSASYG 562 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G G G GGGG G G GGG G G G Sbjct: 430 GGGSSAEVRSVGFGAQQFGGSQFARPIPAGGGGGGSGGYGAGGGGSGGYGAG 481 Score = 33.1 bits (72), Expect = 0.31 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 19/88 (21%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGG-------------------XGGGGXGXXGG 863 GG GG G GGG G G G G GG G Sbjct: 463 GGSGGYGAGGGGSGGYGAGGAGGARNSASNGSYGSSANEVKSVGFGAQQYGGSVFAKPSG 522 Query: 862 XGGGXGXXGGGXXXXGXXGXGGXGXGXG 779 GGG G G G GG G G G Sbjct: 523 TGGGYVSAGSSARKSGESGAGGGGAGGG 550 >AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. Length = 468 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPX---PPXXXX--PXPXPXPPXXPXXPPPXPXPPPP 983 PPP P P P PPPP P P P P PP PPP P PPPP Sbjct: 201 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPPP 256 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPPP 891 P PPP P PP PP P P PPP PP PPP P PPP Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 255 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PPPP P PPPP PP PPP PP Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP---- 253 Query: 811 PPP 819 PPP Sbjct: 254 PPP 256 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPX-----PPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PPPP P P P PPP P PPPP PP PP P PPP P Sbjct: 201 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP-----PPPPPPP 255 Query: 856 P 858 P Sbjct: 256 P 256 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXX---PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP P P P P PPPP P PP PP PPP PPP P Sbjct: 201 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 255 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P PPP P P PP PP PP PPP PPP Sbjct: 202 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPP---LPPVGAGAPPPPPPPPPP 256 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PP P P P PP P PP PP P PPPP Sbjct: 202 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAP---PPPPLPPVGAGAPPPPPPPPP 255 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP PPP P P PP PP PPP P PP Sbjct: 201 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAH--GAPPPPPLPPVGAGAPPPPPPPPP 255 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PPP P P P P P PP P PPPP PP PP Sbjct: 198 PHAP-PPPVPLTSNIPQAP---PAPPPPIGGIAPVN---AHGAPPPPPLPPVGAGAPP-- 248 Query: 826 XXPPXPPPXP 855 PP PPP P Sbjct: 249 --PPPPPPPP 256 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PPP P P PP P P PPP P PP PPP Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 255 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PPP P P P PP PP P PP PPP P P P Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPP-----PPIGGIAPVNAHGAPP-PPPLP---PVGAGAP- 247 Query: 913 XPXPPXXPPPXP 948 PP PPP P Sbjct: 248 ---PPPPPPPPP 256 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P P P PP PPP P P P P PP P PPP Sbjct: 198 PHAPPP---PVPLTSNIPQAPPAPPP-PIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP 253 Query: 964 XP 969 P Sbjct: 254 PP 255 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXP----PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P PP P P P PPPP PP P PP P PP Sbjct: 201 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP---PPPPP--PP 255 Query: 960 P 962 P Sbjct: 256 P 256 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 837 PXXPXPP-PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PP P P PP PP P P PPP P PP Sbjct: 198 PHAPPPPVPLTSNIPQAPPAPPP----PIGGIAPVNAHGAPPPPPLPP 241 >AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical protein R148.3a protein. Length = 1115 Score = 49.2 bits (112), Expect = 4e-06 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 4/97 (4%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPP----XXPPPXPXPPPPXXPPXXXXPPPXXXX 831 P P P P P P P P P P PPP P PP P P P P Sbjct: 341 PDAPKVEEPEPAPTPAPAPAEDPVVTPAPEELTTPPPPAPPPPAPAVPEEAQAPTP---A 397 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P P P P PPP Sbjct: 398 PEEAPEAQIPAETAQIPPENAVPEAPEEPAPTTTPPP 434 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/98 (29%), Positives = 29/98 (29%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P P P P P P P PP PPP P P P P Sbjct: 341 PDAPKVEEPEPAPT-PAPAPAEDPVVTPAPEELTTPPPPAPPPP---APAVPEEAQAPTP 396 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P PP Sbjct: 397 APEEAPEAQIPAETAQIPPENAVPEAPEEPAPTTTPPP 434 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/90 (32%), Positives = 29/90 (32%), Gaps = 2/90 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXX 804 P P P P P P P P P PP PP P P P P P P Sbjct: 349 PEPAPTPA-PAPAEDPVVTPAPEELTTPPPPAPP---PPAPAVPEEAQAPTPAPEEAPEA 404 Query: 805 XXPPPXXXXPP-XPPPXPPPXPPPXPXPPP 891 P PP P P P P PPP Sbjct: 405 QIPAETAQIPPENAVPEAPEEPAPTTTPPP 434 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXX-PXPPPXPXXXXPPPPPX-PXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 P P P P P P P PPPP P P P P P P P Sbjct: 349 PEPAPTPAPAPAEDPVVTPAPEELTTPPPPAPPPPAPAVPEEAQAP---TPAPEEAPEAQ 405 Query: 790 XPPXXXXPPPXXXXPPXP-PPXPPPXPPP 873 P PP P P P P PPP Sbjct: 406 IPAETAQIPPENAVPEAPEEPAPTTTPPP 434 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +3 Query: 780 PXPXPXP-PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P PP PP P P P P P P P P Sbjct: 349 PEPAPTPAPAPAEDPVVTPAPEELTTPP-PPAPPPPAPAVPEEAQAPTPAPEEAPEAQIP 407 Query: 957 PPXPXPPP 980 PP Sbjct: 408 AETAQIPP 415 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P PP PP PP P P P P P P P Sbjct: 359 PAEDPVVTPAPEELTTPP------PPAPPPPAP------AVPEEAQAPTPAPEEAPEAQI 406 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P P Sbjct: 407 PAETAQIPPENAVPEAPEEPAPTTTPPP 434 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/94 (22%), Positives = 21/94 (22%), Gaps = 2/94 (2%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPP--XXXPPXXPXXXXXXXXXXXXXXXXPPXP 788 P P P P P P P P PP P P Sbjct: 341 PDAPKVEEPEPAPTPAPAPAEDPVVTPAPEELTTPPPPAPPPPAPAVPEEAQAPTPAPEE 400 Query: 789 XPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP 890 P P P P P P PPP Sbjct: 401 APEAQIPAETAQIPPENAVPEAPEEPAPTTTPPP 434 >AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated protein 34, isoform b protein. Length = 310 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPX---PPXXXX--PXPXPXPPXXPXXPPPXPXPPPP 983 PPP P P P PPPP P P P P PP PPP P PPPP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPPP 242 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPPP 891 P PPP P PP PP P P PPP PP PPP P PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PPPP P PPPP PP PPP PP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP---- 239 Query: 811 PPP 819 PPP Sbjct: 240 PPP 242 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPX-----PPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PPPP P P P PPP P PPPP PP PP P PPP P Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP-----PPPPPPP 241 Query: 856 P 858 P Sbjct: 242 P 242 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXX---PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP P P P P PPPP P PP PP PPP PPP P Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P PPP P P PP PP PP PPP PPP Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPP---LPPVGAGAPPPPPPPPPP 242 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PP P P P PP P PP PP P PPPP Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAP---PPPPLPPVGAGAPPPPPPPPP 241 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP PPP P P PP PP PPP P PP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAH--GAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PPP P P P P P PP P PPPP PP PP Sbjct: 184 PHAP-PPPVPLTSNIPQAP---PAPPPPIGGIAPVN---AHGAPPPPPLPPVGAGAPP-- 234 Query: 826 XXPPXPPPXP 855 PP PPP P Sbjct: 235 --PPPPPPPP 242 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PPP P P PP P P PPP P PP PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PPP P P P PP PP P PP PPP P P P Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPP-----PPIGGIAPVNAHGAPP-PPPLP---PVGAGAP- 233 Query: 913 XPXPPXXPPPXP 948 PP PPP P Sbjct: 234 ---PPPPPPPPP 242 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P P P PP PPP P P P P PP P PPP Sbjct: 184 PHAPPP---PVPLTSNIPQAPPAPPP-PIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP 239 Query: 964 XP 969 P Sbjct: 240 PP 241 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXP----PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P PP P P P PPPP PP P PP P PP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP---PPPPP--PP 241 Query: 960 P 962 P Sbjct: 242 P 242 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 837 PXXPXPP-PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PP P P PP PP P P PPP P PP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPP----PIGGIAPVNAHGAPPPPPLPP 227 >AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated protein 34, isoform a protein. Length = 454 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPX---PPXXXX--PXPXPXPPXXPXXPPPXPXPPPP 983 PPP P P P PPPP P P P P PP PPP P PPPP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPPP 242 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP---PXPPPXPXPPP 891 P PPP P PP PP P P PPP PP PPP P PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PPPP P PPPP PP PPP PP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP---- 239 Query: 811 PPP 819 PPP Sbjct: 240 PPP 242 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPX-----PPPPXXPPXXXXPPPXXXXPPXPPPXP 855 PPPP P P P PPP P PPPP PP PP P PPP P Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP-----PPPPPPP 241 Query: 856 P 858 P Sbjct: 242 P 242 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXX---PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PP P P P P PPPP P PP PP PPP PPP P Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPP P P P PPP P P PP PP PP PPP PPP Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPP---LPPVGAGAPPPPPPPPPP 242 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P P PP P P P PP P PP PP P PPPP Sbjct: 188 PPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAP---PPPPLPPVGAGAPPPPPPPPP 241 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P PP PPP P P PP PP PPP P PP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAH--GAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PPP P P P P P PP P PPPP PP PP Sbjct: 184 PHAP-PPPVPLTSNIPQAP---PAPPPPIGGIAPVN---AHGAPPPPPLPPVGAGAPP-- 234 Query: 826 XXPPXPPPXP 855 PP PPP P Sbjct: 235 --PPPPPPPP 242 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 P PPP P P PP P P PPP P PP PPP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPPPP 241 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPX 912 P PPP P P P PP PP P PP PPP P P P Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPP-----PPIGGIAPVNAHGAPP-PPPLP---PVGAGAP- 233 Query: 913 XPXPPXXPPPXP 948 PP PPP P Sbjct: 234 ---PPPPPPPPP 242 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P P P PP PPP P P P P PP P PPP Sbjct: 184 PHAPPP---PVPLTSNIPQAPPAPPP-PIGGIAPVNAHGAPPPPPLPPVGAGAPPPPPPP 239 Query: 964 XP 969 P Sbjct: 240 PP 241 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXP----PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P PP P P P PPPP PP P PP P PP Sbjct: 187 PPPPVPLTSNIPQAPPAPPPPIGGIAPVNAHGAPPPPPLPPVGAGAPP---PPPPP--PP 241 Query: 960 P 962 P Sbjct: 242 P 242 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 837 PXXPXPP-PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P PP P P PP PP P P PPP P PP Sbjct: 184 PHAPPPPVPLTSNIPQAPPAPPP----PIGGIAPVNAHGAPPPPPLPP 227 >Z82083-3|CAB04971.1| 756|Caenorhabditis elegans Hypothetical protein ZK1010.5 protein. Length = 756 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PP PP P P P P P P P P P P P PPP P Sbjct: 586 PPSPPSPEPEPEPKSTPEPVTDGPNESQSTALPQQTTDAPVDPVTEASPLNPQPPPPPSP 645 Query: 868 PPXPXPPPXXXXXP 909 P P P P P Sbjct: 646 SPEPEPEPKPPVTP 659 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/87 (29%), Positives = 26/87 (29%) Frame = +1 Query: 700 PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P PP P P P P P P P P P P P P Sbjct: 582 PNPQP-PSPPSPEPEPEPKSTPEPVTDGPNESQSTALPQQTTDAPVDPVTEASPLNPQPP 640 Query: 880 XPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P PP PP P Sbjct: 641 PPPSPSPEPEPEPKPPVTPPKNETVDP 667 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 5/88 (5%) Frame = +1 Query: 631 PXXPXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPXPXPPP----PXXPPPXPXPPPPXXP 795 P P P P PP P P P P P P P P P P Sbjct: 574 PEEPATEVPNPQPPSPPSPEPEPEPKSTPEPVTDGPNESQSTALPQQTTDAPVDPVTEAS 633 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PPP P P P P P PP P Sbjct: 634 PLNPQPPPPPS--PSPEPEPEPKPPVTP 659 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/98 (28%), Positives = 28/98 (28%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P Sbjct: 577 PATEVPNPQPPSPPSPEPEPEPKSTPEPVTDGPNESQSTAL---PQQTTDAPVDPVTEAS 633 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 P PPP PP P P P P P P PP P Sbjct: 634 PLNPQPPP----PPSPSPEPEPEPKPPVTPPKNETVDP 667 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P P PP P P P P P P P P P P Sbjct: 577 PATEVPNPQPPSPPSPEPEPEPKSTPEPVTDGPNESQSTALPQQTTDAPVDPVTEASPLN 636 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P PP P P P P P PP Sbjct: 637 PQPP----PPPSPSPEPEPEPKPPVTPP 660 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 1/95 (1%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P P P P PP P P P P P P P P P Sbjct: 567 PDETTDAPEEPATEVPNPQPPSPPSPEPE-PEPKSTPEPVTDGPNESQSTALPQQTTDAP 625 Query: 847 PXPPPXPPPX-PXPPPXXXXXPXXPXPPXXPPPXP 948 P P P PPP P P P PP P Sbjct: 626 VDPVTEASPLNPQPPPPPSPSPE-PEPEPKPPVTP 659 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P P P P P P PP P P Sbjct: 589 PPSPEPEPEPKSTPEPVTDGPNESQSTALPQQTTDAPVDPVTEASPLNPQPPPPPSP-SP 647 Query: 957 PPXPXPPPP 983 P P P PP Sbjct: 648 EPEPEPKPP 656 >U29096-1|AAA68406.1| 105|Caenorhabditis elegans Neuropeptide-like protein protein32 protein. Length = 105 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 797 GGXXGGGGXGXGGG-XXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG G GG G GGG GG G G GG G G G GGGG G G G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 45.2 bits (102), Expect = 7e-05 Identities = 28/55 (50%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXG 726 GG G GG G G G G GG GGG GG GG G G GG G GGG G G Sbjct: 56 GGWGGRGGWGRGGGRGYGG---RGGG---WGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GG G GG GGG G GG G G G GGG GGG G G G G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGG---WGRGGGGRGFYGGGRRG 102 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXG-GXGGGGXGXXGGXGGGXG 845 GG GG G GGG GG G G G G G GGGG G GG G G Sbjct: 59 GGRGGWGRGGGR--GYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 G GG G G GGG G GG GGG GG GG GGG GG G G Sbjct: 56 GGWGGRGGWGR----GGGRGYGG-RGGGWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 958 GGXXGXXG-GXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXG 815 GG G G G G G G GG GG G G GGG G GGG G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 GG G GG G G G G G G GGG G GGG G GGG G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGR---GGGWGRGGGGRGFYGGGRRG 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXG 795 G G GG G G G G G GG GGG G G GG GGG G Sbjct: 57 GWGGRGGWGRGGGRGYGGRGGGWGG-RGGGWGRGGGGRGFYGGGRRGWG 104 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GG G G GG GG GG G GG G G G GGG GG G G Sbjct: 56 GGWGGRGGWGRGGGRGYGG----RGG--GWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXG-GGGXGXXGXGXGXXXGGGGG 688 GG G G G G G GGG G GGG G G G G GG G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRG 102 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGX-GGXGXGXGXGGGGGXXXXG 672 GG GG GGG G GG G GG G G G G GGG G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGGRGFYGGGRRGWG 104 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G G GGG G GGG G G G G G Sbjct: 56 GGWGGRGGWGRGGGRGYGGRGGGWGGRGGGWGRGGGG 92 >Z77662-5|CAB01192.2| 579|Caenorhabditis elegans Hypothetical protein F47B8.5 protein. Length = 579 Score = 46.8 bits (106), Expect = 2e-05 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP---PPXXXXPPXPPPXPP 858 P P P P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAP-APAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVA 535 Query: 859 PXPPPXPXPP 888 P P P P P Sbjct: 536 PAPAPAPAAP 545 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/111 (28%), Positives = 32/111 (28%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPP--------PXPXPPPPXXPPXXX 807 P PP PPP P P P P P P P P P P Sbjct: 408 PSSPPADAAPAPPPAPEPVPAPAPAPEAAPVAPSADAGGYAAAAAPAGGGSYPAKKRRVA 467 Query: 808 XPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P P P P P P P P P P P P P Sbjct: 468 RDYAEGEAAPAAPAEPAPAPAPAPAPAPEAAPAP-EPAPAPAPAPAPEAAP 517 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXP-XPPXPXPPPPXXPPPXPXPPP---PXXPPXXXXPPPXXXX 831 P P P P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAP 536 Query: 832 PPXPPPXPP 858 P P P P Sbjct: 537 APAPAPAAP 545 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAPA--------PAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEP 528 Query: 919 XPPXXPPPXPXXPPPXP 969 P P P P P Sbjct: 529 APVPEVAPAPAPAPAAP 545 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P P P P P P P P P P P Sbjct: 480 PAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAP-AP 538 Query: 957 PPXPXPP 977 P P P Sbjct: 539 APAPAAP 545 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXX 807 P P P P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAP---APAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPE 533 Query: 808 XPPPXXXXPPXP 843 P P P Sbjct: 534 VAPAPAPAPAAP 545 Score = 39.5 bits (88), Expect(2) = 6e-06 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP-XXPXPPXXPPPXPX 951 P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAP 536 Query: 952 XPPPXPXXP 978 P P P P Sbjct: 537 APAPAPAAP 545 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +1 Query: 616 PPXXPPXXPXP-XXPXPPPXPXXXXPPPP---PXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P P P P P Sbjct: 485 PAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAPAPAPAPAA 544 Query: 784 P 786 P Sbjct: 545 P 545 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P P P P P P P P P P P P P P P P P Sbjct: 480 PAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAPAPA 539 Query: 889 P 891 P Sbjct: 540 P 540 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 816 PXXXXPPPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVP 532 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PP PP P P PP P P P P P P P Sbjct: 407 PPSSPPADAAPAP----PPAPEPVPAPAPAPEAAP 437 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P P Sbjct: 483 PAPAPAPAPAPA-PEAAPAPEPA-PAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAPAPAP 540 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 817 PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P PPP P P P P P P P Sbjct: 407 PPSSPPADAAPAPPPAPEPVPAPAPAPEAAPVAP 440 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 1/64 (1%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P P Sbjct: 477 PAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAPAAAPDAAPAEPAPVPEVAP 536 Query: 969 XPPP 980 P P Sbjct: 537 APAP 540 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/111 (24%), Positives = 27/111 (24%), Gaps = 16/111 (14%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXP-PPPXXPPXXXXPPPXXXXPPXPPPXP------ 855 PP P P P P P P P P P P P P P Sbjct: 407 PPSSPPADAAPAPPPAPEPVPAPAPAPEAAPVAPSADAGGYAAAAAPAGGGSYPAKKRRV 466 Query: 856 ---------PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P P P P Sbjct: 467 ARDYAEGEAAPAAPAEPAPAPAPAPAPAPEAAPAPEPAPAPAPAPAPEAAP 517 Score = 28.7 bits (61), Expect(2) = 6e-06 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P PP P P P P P P P Sbjct: 407 PPSSPPADAAPAPP-PAPEPVPAPAPAPEAAP 437 >Z67990-1|CAA91932.1| 316|Caenorhabditis elegans Hypothetical protein F02D10.1 protein. Length = 316 Score = 48.4 bits (110), Expect = 8e-06 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 5/126 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP P P P PP P P P P P P P P P PP PP Sbjct: 156 PSTPPPCQPCPAGPPGPPGPDGT-PGEPGGPGPAGSPAGPSGPGPAGPPGPAGPPGNDGQ 214 Query: 796 PXXXXPP-----PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P PP P P P P PP P P Sbjct: 215 PGQPGGPGQDGASSAGGEAGPGPAGPPG-PAGPAGPDGQSGSGSAGGPGPKGPPGPAGQP 273 Query: 961 PXPXXP 978 P Sbjct: 274 GSDGNP 279 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/66 (40%), Positives = 27/66 (40%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G GGG G G GGG GG GGG G G G GG G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCT-GCCNPGPPGPGGRPGKPGTPGKPGAPGNP 143 Query: 707 GXGGGG 690 G G G Sbjct: 144 GASGKG 149 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG GGGG G GGG GGGG GG G G G G G G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 1/97 (1%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P PP P P P P P P PPP P PP P P Sbjct: 119 PGPPGPGGRPGKPGTPGKPGAPGNPGASGKGAAAPCEPSTPPPCQPCPAGPPGPPGPDGT 178 Query: 871 PXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P PP P PP P Sbjct: 179 PGEPGGPGPAGSPAGPSGPGPAGPPGPAGPPGNDGQP 215 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 3/115 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP PP P P P P P P P P P P PP PP Sbjct: 153 PCEPSTPPPCQPCPAGPPGPPGPDGTPGEPGGPGPAGSPAGPSGPGPAGPPGPAGPPGND 212 Query: 826 XXPPXPPPXPPPXPPP---XPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P P PP Sbjct: 213 GQPGQPGGPGQDGASSAGGEAGPGPAGPPGPAGPAGPDGQSGSGSAGGPGPKGPP 267 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/69 (39%), Positives = 27/69 (39%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG GG GGG GG GGGG GGG G G G G G G G Sbjct: 85 GGAGG----GGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAP 140 Query: 665 GGXGXXGXG 639 G G G G Sbjct: 141 GNPGASGKG 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 GG GG GGG G GGG GGG G G G GG G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Query: 635 XGG 627 G Sbjct: 145 ASG 147 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/103 (30%), Positives = 31/103 (30%), Gaps = 9/103 (8%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX---PPPPXXPPP-XPXPPPPXXPPXXXXP 813 P P P P P P P P P PPP P P P PP Sbjct: 119 PGPPGPGGRPGKPGTPGKPGAPGNPGASGKGAAAPCEPSTPPPCQPCPAGPPGPPGPDGT 178 Query: 814 P-----PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P P P P P P PP P PP P P P Sbjct: 179 PGEPGGPGPAGSPAGPSGPGPAGPPGPAGPPGNDGQPGQPGGP 221 Score = 39.9 bits (89), Expect = 0.003 Identities = 34/115 (29%), Positives = 34/115 (29%), Gaps = 2/115 (1%) Frame = -3 Query: 956 GXXGXGG--GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G G GG G G G G G G G G GG G Sbjct: 171 GPPGPDGTPGEPGGPGPAGSPAGPSG-PGPAGPPGPAGPPGNDGQPGQPGGPGQDGASSA 229 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G G G G G G GG G G G G G G Sbjct: 230 GGEAGPGPAGPPGPA-GPAGPDGQSGSGSAGGPGPKGPPGPAGQPGSDGNPGTAG 283 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GG G G GGG G GG GG GG G G G G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Query: 746 GGGXG 732 G G Sbjct: 145 ASGKG 149 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G GGG G G GG GGG GG G G G GG G G G G Sbjct: 86 GAGGGGGYGAGGGG---GGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGN 142 Query: 692 GGXXXXG 672 G G Sbjct: 143 PGASGKG 149 Score = 38.3 bits (85), Expect = 0.008 Identities = 33/113 (29%), Positives = 33/113 (29%), Gaps = 1/113 (0%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXX 804 G G G G G G G GG G GG G G G G Sbjct: 189 GSPAGPSGPGPAGPPGPAGPPGNDGQPGQPGGPGQDGASSAGGEAGPGPAGPPGPAG--- 245 Query: 803 XXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G G G GG G G G G G G G GG G G Sbjct: 246 -PAGPDGQSGSGSAGGPGPKGPPGPAGQPGSDGNPGTAG--PPGNPGGEGEKG 295 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -3 Query: 917 GXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG-GGGXGXGGGXXGGG 741 G G G G G GGG G GGG G G GG G G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Query: 740 GXGXG 726 G G Sbjct: 145 ASGKG 149 Score = 37.9 bits (84), Expect = 0.011 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG G G GG GGG GG GG G G G G GG G G Sbjct: 85 GGAGGGGGYGAGGG---GGG----GGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKP 137 Query: 689 GXXXXGXGGGXG 654 G G G Sbjct: 138 GAPGNPGASGKG 149 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G GGG G G GGG G GG G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Query: 755 XXGGG 741 G G Sbjct: 145 ASGKG 149 Score = 36.7 bits (81), Expect = 0.025 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P P P P P P P PP P PP PP P Sbjct: 121 PPGPGGR-PGKPGTPGKPGAPGNPGASGKGAAAPCEPSTPPPCQPCPAGPP----GPPGP 175 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P PP PP P P P Sbjct: 176 DGTPGEPGGPGPAGSPAGPSGPGPAGPPGPAGPPGNDGQPGQPGGP 221 Score = 36.3 bits (80), Expect = 0.033 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 4/69 (5%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXG--GXGGGXGXXG--GGXXXX 818 G GGG G G G GG G G G GG G G G G GG G G G Sbjct: 86 GAGGGGGYGAG-----GGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAP 140 Query: 817 GXXGXGGXG 791 G G G G Sbjct: 141 GNPGASGKG 149 Score = 36.3 bits (80), Expect = 0.033 Identities = 34/126 (26%), Positives = 34/126 (26%), Gaps = 6/126 (4%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXX 792 P P P P P P P P P P P P P PP P P Sbjct: 121 PPGPGGRPGKPGTPGKPGAPGNPGASGKGAAAPCEPSTPPPCQPCPAGPPGPPGPDGTPG 180 Query: 793 PPXXXXPPPXXXXPPXP-PPXPP-PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP--P 960 P P P P P PP P PP P P P P Sbjct: 181 EPGGPGPAGSPAGPSGPGPAGPPGPAGPPGNDGQPGQPGGPGQDGASSAGGEAGPGPAGP 240 Query: 961 PXPXXP 978 P P P Sbjct: 241 PGPAGP 246 Score = 33.5 bits (73), Expect = 0.24 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G GGG G GGG GG G GGG G G G G GG G Sbjct: 85 GGAGGGGGY-GAGGGGGGGGGEAA-----GGGGGCTGCCNPGP-PGPGGRPGKPGTPGKP 137 Query: 797 GGXXGGGGXGXG 762 G G G G Sbjct: 138 GAPGNPGASGKG 149 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G GGG GG GG G G GG G G G G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTGCCNPGPPGPGGRPGKPGTPGKPGAPGNPG 144 Query: 758 GXXGG 744 G Sbjct: 145 ASGKG 149 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPX-PPPXPPXXPXPP-PPXPPXXXXPXPXPXPPXXPXX 953 P P P P P PPP P PP PP P P P P Sbjct: 134 PGKPGAPGNPGASGKGAAAPCEPSTPPPCQPCPAGPPGPPGPDGTPGEPGGPGPAGSPAG 193 Query: 954 PP-PXPXPPP 980 P P P PP Sbjct: 194 PSGPGPAGPP 203 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 707 GXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG G GGG G GG G Sbjct: 85 GGAGGGGGYGAGGGGGGGGGEAAGGGGGCTG 115 >Z78013-8|CAN99686.1| 373|Caenorhabditis elegans Hypothetical protein F15B9.10 protein. Length = 373 Score = 47.2 bits (107), Expect = 2e-05 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 3/108 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXX---GGGXXXXGGXXGGGGX 771 GGG GGG GG GGG GG GG G G Sbjct: 251 GGGNQNRQQVPTNPMGGGGGYPQPPPQQGGGGGGAGGMFRNILSSGGGAAAGSMLGRFLS 310 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 GGG GGGG G G G G GGG G G G GG Sbjct: 311 NRGGGGGGGGGMGGGNRGYGY---QGGGSNPSGQQGPVYDDNGGQGGG 355 Score = 39.1 bits (87), Expect = 0.005 Identities = 31/97 (31%), Positives = 31/97 (31%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G GGG G G GGG G G GG GGG Sbjct: 266 GGGGGYPQPPPQQGGGGGGAGGMFRNILSSGGGAAAGSMLGRFLSNRGGG----GGGGGG 321 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G G GG G G GGGG Sbjct: 322 MGG--GNRGYGYQGGGSNPSGQQGPVYDDNGGQGGGG 356 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 8/78 (10%) Frame = -1 Query: 985 GGGGGX--------GXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG G GGG G G G G GG GGG G GGG Sbjct: 266 GGGGGYPQPPPQQGGGGGGAGGMFRNILSSGGGAAAGSMLGRFLSNRGGGGGGGGGMGGG 325 Query: 829 XXXXGXXGXGGXGXGXGG 776 G G G G G Sbjct: 326 NRGYGYQGGGSNPSGQQG 343 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGG G GGG G G G G G G GG GGG Sbjct: 313 GGGGGGGGGMGGGNRGYGYQGGGSNPSGQQGPVYDDNGGQGGG 355 Score = 33.9 bits (74), Expect = 0.18 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 8/91 (8%) Frame = -3 Query: 980 GGXXGXGG---GXXGXGGGXXGGXGXXGXXXXXGGGXGX-----GGGXGGGXGGGXGGXX 825 GG G GG GGG G GGG G GG G G GG Sbjct: 280 GGGGGAGGMFRNILSSGGGAAAGSMLGRFLSNRGGGGGGGGGMGGGNRGYGYQGGGSNPS 339 Query: 824 XXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G G GGGG GG G Sbjct: 340 GQQGPVYDDNGGQGGGGLYPSQEVKDRGGGG 370 Score = 31.5 bits (68), Expect = 0.95 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 7/106 (6%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXG-------XXGGXGGGXGXXGGGX 827 GGGG GG G G GGGG G GG G Sbjct: 250 GGGGNQNRQQVPTNPMGGGGGYPQPPPQQGGGGGGAGGMFRNILSSGGGAAAGSMLGRFL 309 Query: 826 XXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGG 689 G G GG G G G G G G GGG Sbjct: 310 SNRGGGGGGGGGMGGGNRGYGYQGGGSNPSGQQGPVYDDNGGQGGG 355 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG-----XXXXGGXGGGG 881 GGGGG G G G GG G GG GGGG Sbjct: 317 GGGGGMGGGNRGYGYQGGGSNPSGQQGPVYDDNGGQGGGG 356 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 5/74 (6%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG-----XGGGXGXXGGGXXXX 818 G GG G G G G GGG G GG G G G Sbjct: 248 GRGGGGNQNRQQVPTNPMGGGGGYPQPPPQQGGGGGGAGGMFRNILSSGGGAAAGSMLGR 307 Query: 817 GXXGXGGXGXGXGG 776 GG G G GG Sbjct: 308 FLSNRGGGGGGGGG 321 >Z74033-3|CAA98477.1| 407|Caenorhabditis elegans Hypothetical protein F38B7.3 protein. Length = 407 Score = 47.2 bits (107), Expect = 2e-05 Identities = 30/71 (42%), Positives = 30/71 (42%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GG GG G G G G G G G G GG GG GG Sbjct: 227 GYGGGGYGGYGGGGGGFGSTGLGF--GSGILAGSLLGYGLGSMWGGHHSYGG----WGGG 280 Query: 788 XGGGGXGXGGG 756 GGGG G GG Sbjct: 281 YGGGGYGMAGG 291 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/66 (40%), Positives = 27/66 (40%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G G G GG GGG GGG G G G G G GG GG G G G G Sbjct: 227 GYGGGGYGGYGGG-GGGFGSTGLGFGSGILAGSLLGYGLGSMWGGHHSYGGWGGGYGGGG 285 Query: 710 XGXGGG 693 G GG Sbjct: 286 YGMAGG 291 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/64 (42%), Positives = 27/64 (42%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG GG GGGG G G G G G G G GG G GGG G G G Sbjct: 230 GGGYGGYGG--GGGGFGSTGLGFGSGILAGSLLGYGLGSMWGGHHSYGGWGGGYGGGGYG 287 Query: 638 XXGG 627 GG Sbjct: 288 MAGG 291 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -3 Query: 935 GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G GG G G GGG G G G G G G G G G G G GG Sbjct: 226 GGYGGGGYGGY----GGGGGGFGSTGLGFGSGILAGSLLGYGLGSMWG--GHHSYGGWGG 279 Query: 755 XXGGGGXGXGG 723 GGGG G G Sbjct: 280 GYGGGGYGMAG 290 Score = 37.5 bits (83), Expect = 0.014 Identities = 25/79 (31%), Positives = 25/79 (31%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXX 906 P P PPP P P PP PP P PPP P P P Sbjct: 135 PKPANPPPNAPQQGPGAQPPQQQNNGGYVPP-TVYPSAPPPVQPGY-NPRPASGQSYPSG 192 Query: 907 PXXPXPPXXPPPXPXXPPP 963 P P P P P P P Sbjct: 193 PQVP-PAYGQYPQPGYPQP 210 Score = 37.1 bits (82), Expect = 0.019 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXG-XXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXX 809 GGGG G GGG G G G G G G G G G G G GGG G Sbjct: 229 GGGGYGGYGGG-GGGFGSTGLGFGSGILAGSLLGYGLGSMWGGHHSYGGWGGGYGGGGYG 287 Query: 808 GXGG 797 GG Sbjct: 288 MAGG 291 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = -3 Query: 770 GXGGGXXGGGGXGXGGXG-XGXGXGGG---GGXXXXGXGG-GXGXXGXGXXGGXXGG 615 G GGG GG G G GG G G G G G G G G G G GG GG Sbjct: 227 GYGGGGYGGYGGGGGGFGSTGLGFGSGILAGSLLGYGLGSMWGGHHSYGGWGGGYGG 283 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/71 (35%), Positives = 25/71 (35%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGGXXXXXXXXXXXXXGXXGX 722 GG GGGG G GG GGG G G G G G G G Sbjct: 226 GGYGGGGYGGYGGGGGGFGSTGLGF---------GSGILAGSLLGYGLGSMWGGHHSYGG 276 Query: 721 XGGXXXGGGGG 689 GG GGG G Sbjct: 277 WGGGYGGGGYG 287 Score = 32.7 bits (71), Expect = 0.41 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPX 921 P P PPP P P P P PPP P P P P Sbjct: 135 PKPANPPPNAPQQGPGAQPPQQQNNGGYVPPTVYPSAPPPVQPGYNPRPASGQSYPSGPQ 194 Query: 922 PPXXPPPXPXXPPPXPXXPP 981 P P P P P Sbjct: 195 VPPAYGQYPQPGYPQPAGVP 214 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G G GGG GG G GG GG GGG G G Sbjct: 363 GNAGYDSGDFGGGDYGGGGYDSGDFGGGDFGGGDFGGGDFGGG 405 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGG---GXXGGGGXGXGGXGXGXGXGG 696 G G GGG G GG G GGG G G G G GG Sbjct: 363 GNAGYDSGDFGGGDYGGGGYDSGDFGGGDFGGGDFGGGDFGGG 405 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 G G GGG GGGG G G G GG G G G Sbjct: 363 GNAGYDSGDFGGGDYGGGGYDSGDFGGGDFGGGDFGGGDFGGG 405 Score = 32.3 bits (70), Expect = 0.54 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG--GGXXGGGG 738 G G G G G GG GGG G GGG G G GG GGG Sbjct: 355 GNDYGNDYGNAGYDSGDFGGGDYGGGGYD--SGDFGGGDFGGGDFGGGDFGGG 405 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG 884 GGG G GG G GG G G G GGG Sbjct: 373 GGGDYGGGGYDSGDFGGGDFGGGDFGGGDFGGG 405 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G GG G G G GGGGG G G G G G G Sbjct: 226 GGYGGGGYG-GYG-GGGGGFGSTGLGFGSGILAGSLLGYGLG 265 Score = 31.9 bits (69), Expect = 0.72 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G G G G G GG G G GGG G GG GGG G GGG Sbjct: 355 GNDYGNDYGNAGYDSGDFGG-GDYG-----GGGYDSGDFGGGDFGGGDFGGGDFGGG 405 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 4/80 (5%) Frame = +1 Query: 640 PXPXXPXP-PPXPXXXXPPPPPXPXPXPXPPX--PXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P PP PP P PPP P P P P Sbjct: 135 PKPANPPPNAPQQGPGAQPPQQQNNGGYVPPTVYPSAPPPVQPGYNPRPASGQSYPSGPQ 194 Query: 811 PPPXXXXPPXPP-PXPPPXP 867 PP P P P P P Sbjct: 195 VPPAYGQYPQPGYPQPAGVP 214 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P PP PP PP P P P P P PP P P P Sbjct: 149 PGAQPPQQQNNGGYVPPTVYPSAPPPVQPGYNPRPASGQSYPSGPQVPPAYGQYPQPGYP 208 Query: 796 PXXXXP 813 P Sbjct: 209 QPAGVP 214 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG 777 G G G G GGG G G GGG GG GGG Sbjct: 363 GNAGYDSGDFGGGDYGGGGYDSGDFGGGDFGGG-DFGGGDFGGG 405 >AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily assigned gene nameprotein 268 protein. Length = 881 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PPPPP P P PPPP PPP PP P P P P P P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECP 124 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +1 Query: 724 PPXPXPPPPXXP--PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 PP P PPPP P PPPP PP PPP P P P P P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECP 124 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP P PPP P PP PPP PP P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPP 101 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PP P PPPP PPP PPP PPP P PP P P Sbjct: 67 PPPPPPPPPLISILQQAPPP-------PPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPR 119 Query: 940 P 942 P Sbjct: 120 P 120 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 865 PPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP P PP P PP PPP PPP P Sbjct: 68 PPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPP 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 P P P PP PPPP P P P P PPP Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPP 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PPPP PP P PP P PP PPPP Sbjct: 67 PPPPPPPPPLISILQQAP-PPPPPPPPPTLKAPPPP 101 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P PPPP PP PP P PP PP P P P P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECP 124 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP 750 P P PPP PP P P P P PPPP Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPP 101 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PPP P PPPPP P PP P P P P P Sbjct: 69 PPPPPPPLISILQQAPPPPP----PPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKECP 124 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +1 Query: 832 PPXPPPXPP------PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP PPP PP PPP P PPP P P P P P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPPILGLKTPSKSLKTPTP 118 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P PP PPPP PP P PP P P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPPPPTLKAPPPPPILGLKTPSKSLKTP 116 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP----XPPXXXXPXPXPXPPXX 944 PP P P P PPP PPP P PPPP P P P P Sbjct: 68 PPPPPPPPLISILQQAPPPPP----PPPPPTLKAPPPPPILGLKTPSKSLKTPTPRPKEC 123 Query: 945 P 947 P Sbjct: 124 P 124 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P PPP P P P P PP PP PPP P Sbjct: 67 PPPPPPPPPLISILQQAPPPPPPPP---PPTLKAPPPPP 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P P PP P PP PP Sbjct: 70 PPPPPPLISILQQAPPPPPPPPPPTLKAPPPPP 102 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPP----PPXPPXXXXPXP 923 P PP P P PPP PP P PP PP PP P Sbjct: 67 PPPPPPPPPLISI---LQQAPPPPPP--PPPPTLKAPPPPPILGLKTP 109 >Z70309-6|CAA94360.1| 324|Caenorhabditis elegans Hypothetical protein R102.6 protein. Length = 324 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PPP P PPPPP P P P P P PP PPP P P Sbjct: 244 PPPSPVCMPPPPPPCPMPIPCP--PPPPACSCPPPVTMYQPCMVP 286 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPP 861 PP P P P PPPP P P P PPP PP PPP P P P Sbjct: 243 PPPPSPVCMP----PPPPPCPMPIPCPPP---PPACSCPPPVTMYQPCMVPQYVP 290 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXP 909 PPPP P PPP PP P P P PP PP PPP P Sbjct: 243 PPPPS--PVCMPPPP----PPCPMPIPCPPPPPACSCPPPVTMYQP 282 Score = 37.5 bits (83), Expect = 0.014 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PPP P P PPPP P PPP P P P P P Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPPPPPACSCPPPVTMYQPCMVPQYVP 290 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PPP P P PPPP P P P PP PPP Sbjct: 244 PPPSPVCMPPPPPP----CPMPIPCPPPPPACSCPPP 276 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP P PP PPP P P P PPP P P P P Sbjct: 243 PPPPS--PVCMPPPPPPCPMPIPCPPPPPACSCPPPVTMYQPCMVPQYVP 290 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P PPP P P P PP PP Sbjct: 244 PPPSPVCMPPPPPPCPMPIPCPPPPPACSCPPP 276 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 856 PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PPP P PP PPP PPP P Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPP--PPPACSCPPPVTMYQP 282 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 885 PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP P P P P P P PPP PP Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPPPPPACSCPP 275 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 PP P P PPP P PPPP P PP P P P Sbjct: 244 PPPSPVCMPPPPPPCPMPIPCPPPPPACSCP-PPVTMYQPCMVPQYVP 290 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PP P PPP P P P PP P P P P P Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPPPPPACSCPPPVTMYQPCMVP 286 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 PP P P P P P P P PPPP P P Sbjct: 244 PPPSPVCMPPPPPPCPMPIPC--PPPPPACSCPPP 276 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXG 834 GG G GGG GGG GGG G Sbjct: 294 GGCGGCGGGYGGGYGGGCG 312 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPP 893 P PP P PP P P P PP PPP Sbjct: 243 PPPPSPVCMPPPPPPCPMPIPCPPPPPACSCPPP 276 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P PPP P P P P P P P P P P P P Sbjct: 243 PPPPSPVCMPPPPPPC---PMPIPCPPPPPACSCPPPVTMYQPCMVPQYVP 290 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P PP P PPP PPP P P P Sbjct: 252 PPPPPPCPMPIPCPPPPPACSCPPPVTMYQPCMVPQYVP 290 >Z68215-7|CAA92453.1| 289|Caenorhabditis elegans Hypothetical protein C53B4.5 protein. Length = 289 Score = 46.8 bits (106), Expect = 2e-05 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P PP P P P P P PP PP P Sbjct: 97 PPGTPGRAGRPGKPGAPGL--NGNPGRPPKEPCEPITPPPCKPCPEGPPGPAGPPGPQGN 154 Query: 796 PXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P P P PP P P P P P P P Sbjct: 155 KGPLGPPGPPGPEGPNGTAGNKGPAGPPGPGGKPGPAGPPGENGRNGEPQPGSPGEPGRP 214 Query: 970 XXP 978 P Sbjct: 215 GQP 217 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/113 (27%), Positives = 31/113 (27%), Gaps = 5/113 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P PP P P P P P P P P PP P Sbjct: 110 PGAPGLNGNPGRPPKEPCEPITPPPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPPGPEGP 169 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXP-----XPPPXXXXXPXXPXPPXXPPP 942 PP P P P PP P P P P P P Sbjct: 170 NGTAGNKGPAGPPGPGGKPGPAGPPGENGRNGEPQPGSPGEPGRPGQPGSRGP 222 Score = 43.2 bits (97), Expect = 3e-04 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 9/120 (7%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPP-P 819 P PP P P P P P P P P P P P PP PP P Sbjct: 92 PGAQGPPGTPGRAGRPGKPGAPGLNGNPGRPPKEPCEPITPPPCKPCPEGPPGPAGPPGP 151 Query: 820 XXXXPPXPPPXPP-PXPP------PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P PP PP P P P PP P PP P P P Sbjct: 152 QGNKGPLGPPGPPGPEGPNGTAGNKGPAGPPGPGGKPGPAGPPGENGRNGEPQPGSPGEP 211 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP P P PPP P P PP P P PP Sbjct: 119 PGRPPKEPCEPITPPPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPP 164 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +3 Query: 792 PXPPXPXXPXXXXPP-PXXPXPP---PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P PP P P P P P PP P P P P P P Sbjct: 129 PITPPPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPPGPEGPNGTAGNKGPAGPPGPGGKP 188 Query: 960 PXPXPP 977 PP Sbjct: 189 GPAGPP 194 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXP--PPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P PPP P P PP P P P P P P P Sbjct: 119 PGRPPKEPCEPIT--PPPCKPCPEGPPGPAGPPGPQGNKGPLGPPGPPGPEGPNGTAGNK 176 Query: 960 PXPXPPPP 983 PP P Sbjct: 177 GPAGPPGP 184 >AF039048-5|AAB94236.1| 76|Caenorhabditis elegans Hypothetical protein F16B4.5a protein. Length = 76 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G GGG G GGG G GG GGG GGG GGG GG Sbjct: 23 GRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 71 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-GGXXGGGGXG 732 G GGG GG GG G GG GGG G G GG GG G G Sbjct: 23 GRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 75 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G GGG G G GGG G GGG G G G Sbjct: 28 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGG-GMGGGSGGYGYG 75 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G GGG G GG GG GG GGG G GG Sbjct: 21 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 71 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX----GXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGG G GGG G G GG GGG G GG G G Sbjct: 28 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 75 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GG GG G GG GG G G G G GG Sbjct: 21 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 71 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GGG GGG G GG GG GG G G GG G Sbjct: 28 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 75 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GG GGG G G GG G G GGG G G G G Sbjct: 21 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 75 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G GG G G G G G Sbjct: 28 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFG-GGMGGGSGGYGYG 75 >AF039048-4|AAK68333.1| 101|Caenorhabditis elegans Hypothetical protein F16B4.5b protein. Length = 101 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G GGG G GGG G GG GGG GGG GGG GG Sbjct: 48 GRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 96 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG-GGXXGGGGXG 732 G GGG GG GG G GG GGG G G GG GG G G Sbjct: 48 GRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 100 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G GGG G G GGG G GGG G G G Sbjct: 53 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGG-GMGGGSGGYGYG 100 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 G G GGG G GG GG GG GGG G GG Sbjct: 46 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 96 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGX----GXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGG G GGG G G GG GGG G GG G G Sbjct: 53 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 100 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 842 GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GG GG G GG GG G G G G GG Sbjct: 46 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGG 96 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 GGG GGG G GG GG GG G G GG G Sbjct: 53 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 100 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGG--GGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G GG GGG G G GG G G GGG G G G G Sbjct: 46 GYGRPSYGGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFGGGMGGGSGGYGYG 100 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG GGG GG GGG G GG G G G G G Sbjct: 53 GGGDFGGGGGQWGSQSSSFQQNQMSGGFQNGGGFG-GGMGGGSGGYGYG 100 >Z82274-16|CAC70096.1| 1119|Caenorhabditis elegans Hypothetical protein JC8.10b protein. Length = 1119 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1045 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1104 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1105 PPPPRPVIPP 1114 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1045 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1103 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1104 PPPPPRPVIPPRP 1116 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1046 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1105 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1106 PPPRPVIPP 1114 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1084 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1045 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1100 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1101 RKAPPPPPRPVIPPRP 1116 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1072 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1114 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1072 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1093 PGPPAVPVRKAPPPPPRPVIPPRP 1116 >Z82274-15|CAB05234.2| 1113|Caenorhabditis elegans Hypothetical protein JC8.10a protein. Length = 1113 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1039 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1098 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1099 PPPPRPVIPP 1108 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1039 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1097 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1098 PPPPPRPVIPPRP 1110 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1040 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1099 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1100 PPPRPVIPP 1108 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1078 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1039 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1094 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1095 RKAPPPPPRPVIPPRP 1110 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1066 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1108 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1066 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1087 PGPPAVPVRKAPPPPPRPVIPPRP 1110 >Z74036-2|CAA98487.1| 266|Caenorhabditis elegans Hypothetical protein F55C10.3 protein. Length = 266 Score = 46.4 bits (105), Expect = 3e-05 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 12/132 (9%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P PP P P P P P PP P PP P Sbjct: 74 PAGTPGKPGRPGKPGAPGLPGN--PGHPPQQPCDPITPPPCQPCPQGPPGPPGPPGPSGD 131 Query: 796 PXXXXPP--PXXXXPPXPP----PXPPPXPPPXPXPP-PXXXXXPXXPXPPXXP----PP 942 P P P P P P P P P P P P P P Sbjct: 132 AGGNGNPGSPGQDGQPGAPGNKGPSGPNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGTP 191 Query: 943 XPXXPPPXPXXP 978 P PP P P Sbjct: 192 GPQGPPGQPGQP 203 Score = 44.8 bits (101), Expect = 1e-04 Identities = 38/130 (29%), Positives = 38/130 (29%), Gaps = 13/130 (10%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX--------PPXPXPPPPXXPPPXPX 774 P PP P PP P PP PP P P P P P P Sbjct: 96 PGHPPQQPCDPITPPPCQPCPQGPPGPPGP-PGPSGDAGGNGNPGSPGQDGQPGAPGNKG 154 Query: 775 PPPPXXPPXXXXPP--PXXXXPPXP--PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-P 939 P P P P P P P P P P P P PP P P P P Sbjct: 155 PSGPNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGTPGPQGPPGQPGQPGHDGQPGAPGP 214 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 215 KGPNGNPGQP 224 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P P P P P PP P P PPP P P P PP Sbjct: 74 PAGTPGKPGRPGKPGAPGLPGNPGHPPQQPCDPITPPPCQPCPQGPPGPPGPP 126 Score = 37.5 bits (83), Expect = 0.014 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 6/100 (6%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P PP P PPP P PP P P P Sbjct: 69 PGAAGPAGTPGKPGRPGKPGAPGLPGNPGHPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 128 Query: 871 PXPXPPPXXXXXPXXPXPPXXP----PPXPXXPPPXPXXP 978 P P P P P P P P Sbjct: 129 SGDAGGNGNPGSPGQDGQPGAPGNKGPSGPNGNPGAPGAP 168 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/78 (24%), Positives = 19/78 (24%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P PP P P P P P Sbjct: 162 PGAPGAPGQPGQDAPSEPITPGAPGPQGTPGPQGPPGQPGQPGHDGQPGAPGPKGPNGNP 221 Query: 835 PXPPPXPPPXPPPXPXPP 888 P P P P Sbjct: 222 GQPGADGNPGAPGQSGTP 239 >Z74036-1|CAA98486.1| 299|Caenorhabditis elegans Hypothetical protein F55C10.2 protein. Length = 299 Score = 46.4 bits (105), Expect = 3e-05 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 12/132 (9%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P PP P P P P P PP P PP P Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGN--PGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGPSGD 164 Query: 796 PXXXXPP--PXXXXPPXPP----PXPPPXPPPXPXPP-PXXXXXPXXPXPPXXP----PP 942 P P P P P P P P P P P P P P Sbjct: 165 AGGNGNPGSPGQDGQPGAPGNKGPSGPNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGTP 224 Query: 943 XPXXPPPXPXXP 978 P PP P P Sbjct: 225 GPQGPPGQPGQP 236 Score = 44.8 bits (101), Expect = 1e-04 Identities = 38/130 (29%), Positives = 38/130 (29%), Gaps = 13/130 (10%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX--------PPXPXPPPPXXPPPXPX 774 P PP P PP P PP PP P P P P P P Sbjct: 129 PGRPPQQPCDPITPPPCQPCPQGPPGPPGP-PGPSGDAGGNGNPGSPGQDGQPGAPGNKG 187 Query: 775 PPPPXXPPXXXXPP--PXXXXPPXP--PPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-P 939 P P P P P P P P P P P P PP P P P P Sbjct: 188 PSGPNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGTPGPQGPPGQPGQPGHDGQPGAPGP 247 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 248 KGPNGNPGQP 257 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P P P P P PP P P PPP P P P PP Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPP 159 Score = 37.5 bits (83), Expect = 0.014 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 6/100 (6%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P P P PP P PPP P PP P P P Sbjct: 102 PGAAGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 161 Query: 871 PXPXPPPXXXXXPXXPXPPXXP----PPXPXXPPPXPXXP 978 P P P P P P P P Sbjct: 162 SGDAGGNGNPGSPGQDGQPGAPGNKGPSGPNGNPGAPGAP 201 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/78 (24%), Positives = 19/78 (24%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P PP P P P P P Sbjct: 195 PGAPGAPGQPGQDAPSEPITPGAPGPQGTPGPQGPPGQPGQPGHDGQPGAPGPKGPNGNP 254 Query: 835 PXPPPXPPPXPPPXPXPP 888 P P P P Sbjct: 255 GQPGADGNPGAPGQSGTP 272 >Z68753-3|CAA92988.3| 984|Caenorhabditis elegans Hypothetical protein ZC518.2 protein. Length = 984 Score = 46.4 bits (105), Expect = 3e-05 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 8/121 (6%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXX---PPPXPXPPPP--XXP 795 P P P PP P P PPP PP P PPP Sbjct: 86 PNYPTAASAFPAHSAGFSHQPPSFSPATQPSMNGHHAPPPPAVSRPPAFPTPPPSVGSAA 145 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP--XXXXXPXXPXPPXXPPPXPXXP-PPX 966 P P P P P P PPP P P P P P PP PP Sbjct: 146 PSIQPPIPSALASARPAPFPAAQPPPAPTPTPSYQQQMAPRPQAPAAYPPASQQQGYPPQ 205 Query: 967 P 969 P Sbjct: 206 P 206 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPP-PPXXPPPXPXPPPP 786 P P P PP P PP P P P P PP P P P P Sbjct: 107 PSFSPATQPSMNGHHAPPPPAVSRPPAFPTPPPSVGSAAPSIQPPIPSALASARPAPFPA 166 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P PP Sbjct: 167 AQPPPAPTPTPSYQQQMAPRPQAPAAYPP 195 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/113 (24%), Positives = 28/113 (24%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P PPPP P P P P P P P P P Sbjct: 106 PPSFSPATQPSMNGHHAPPPPAVSRPPAFPTPPPSVGSAAPSIQPPIPSALASARPAPFP 165 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP P P P P P P P P P P Sbjct: 166 AAQPPPAPTPTPSYQQQMAPRPQAPAAYPPASQQQGYPPQPQQNSQYGQPQVP 218 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 2/85 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P PPP P PP P P P P PPP P P P Sbjct: 123 PPPPAVSRPPAFPTPPPSVGSAAPSIQPPIPSALASA-RPAPFPAAQPPPAPTPTPSYQQ 181 Query: 796 PXXXXPPPXXXXPPXPPPXP-PPXP 867 P PP PP P Sbjct: 182 QMAPRPQAPAAYPPASQQQGYPPQP 206 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP PP P PPP PP P P P P Sbjct: 123 PPPPAVSRPPAFPTPPPSVGSAAPSIQPPIPSALASARPAPFPAAQP 169 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP-----XPPXXPXXPPPXPXPPP 980 PPP PP P P P P P P PPP P P P Sbjct: 123 PPPPAVSRPPAFPTPPPSVGSAAPSIQPPIPSALASARPAPFPAAQPPPAPTPTP 177 >AL132951-13|CAC70127.1| 1119|Caenorhabditis elegans Hypothetical protein JC8.10b protein. Length = 1119 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1045 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1104 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1105 PPPPRPVIPP 1114 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1045 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1103 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1104 PPPPPRPVIPPRP 1116 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1046 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1105 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1106 PPPRPVIPP 1114 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1084 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1045 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1100 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1101 RKAPPPPPRPVIPPRP 1116 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1072 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1114 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1072 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1093 PGPPAVPVRKAPPPPPRPVIPPRP 1116 >AL132951-12|CAC44311.1| 1113|Caenorhabditis elegans Hypothetical protein JC8.10a protein. Length = 1113 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1039 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1098 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1099 PPPPRPVIPP 1108 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1039 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1097 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1098 PPPPPRPVIPPRP 1110 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1040 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1099 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1100 PPPRPVIPP 1108 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1078 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1039 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1094 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1095 RKAPPPPPRPVIPPRP 1110 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1066 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1108 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1066 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1087 PGPPAVPVRKAPPPPPRPVIPPRP 1110 >AF283323-1|AAG18575.1| 1113|Caenorhabditis elegans synaptojanin UNC-26B protein. Length = 1113 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1039 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1098 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1099 PPPPRPVIPP 1108 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1039 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1097 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1098 PPPPPRPVIPPRP 1110 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1040 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1099 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1100 PPPRPVIPP 1108 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1078 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1039 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1094 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1095 RKAPPPPPRPVIPPRP 1110 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1066 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1108 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1066 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1066 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1110 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1087 PGPPAVPVRKAPPPPPRPVIPPRP 1110 >AF283322-1|AAG18574.1| 1119|Caenorhabditis elegans synaptojanin UNC-26A protein. Length = 1119 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +1 Query: 781 PPXXPPXXXX---PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P P P PPP P P P PP P Sbjct: 1045 PPLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAP 1104 Query: 952 XPPPXPXXPP 981 PPP P PP Sbjct: 1105 PPPPRPVIPP 1114 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P P P P PPP P PP PP Sbjct: 1045 PPLAPPQSNNNKSP-PQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKA 1103 Query: 841 PPPXPPPXPPPXP 879 PPP P P PP P Sbjct: 1104 PPPPPRPVIPPRP 1116 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPX 864 P PP PP P P P PPP P PP P P Sbjct: 1046 PLAPPQSNNNKSPPQACLFNPFTQSAPSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPP 1105 Query: 865 PPPXPXPPP 891 PPP P PP Sbjct: 1106 PPPRPVIPP 1114 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP P PP P PPPPP P P P Sbjct: 1084 PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/76 (30%), Positives = 23/76 (30%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP PP P P P P PP P PP PP Sbjct: 1045 PPLAPPQS---NNNKSPPQACLFNPFTQSAPSPAP-PPSTIPLPPTRGASVGPGPPAVPV 1100 Query: 796 PXXXXPPPXXXXPPXP 843 PPP PP P Sbjct: 1101 RKAPPPPPRPVIPPRP 1116 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P P P PP P P P PPP P PP Sbjct: 1072 PSPAPPPSTIPLPPTRG--ASVGPGPPAVPVRKAPPPPPRPVIPP 1114 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP-XPXPPPP 983 P P PP P PP P P P PPP PP P Sbjct: 1072 PSPAPPPSTIPLPPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 P P PP P PP P PP P P PP P P Sbjct: 1072 PSPAPPPSTIPL---PPTRGASVGPGPPAVPVRKAPPPPPRPVIPPRP 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 908 PXPPPXPXXPXPPXPXPPXXPPXP 979 P PP P PP P P PP P Sbjct: 1093 PGPPAVPVRKAPPPPPRPVIPPRP 1116 >AF040642-7|AAB94952.1| 329|Caenorhabditis elegans Collagen protein 68 protein. Length = 329 Score = 46.4 bits (105), Expect = 3e-05 Identities = 31/101 (30%), Positives = 31/101 (30%), Gaps = 8/101 (7%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXP-----PPXPXPPPPXXPPXXXXPPPXXXXPPXPP--- 846 PP P P P P P P P P PP P PP P P P Sbjct: 190 PPGPPGKQGPKGPNGEPGAPGTPGGNALPGPPGPPGPQGPPGADGLPGNPGAPGVPGQVI 249 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P PP P P P P P PP P Sbjct: 250 EVPGTPGPAGPPGPPGPIGPPGQPGAPGSSQPGPQGPPGDP 290 Score = 44.4 bits (100), Expect = 1e-04 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 5/116 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP--XPPPPXXPPXXXXPPP 819 P P P P P P PP P P P P P P P Sbjct: 161 PGNPGTPGQDAVGDESPTAADFCFDCPTGPPGPPGKQGPKGPNGEPGAPGTPGGNALPGP 220 Query: 820 XXXXPPXPPPXPP--PXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P PP P P P P P P P P PP P PP P P Sbjct: 221 PGPPGPQGPPGADGLPGNPGAPGVPGQVIEVPGTPGPAGPPGPPGPIGPPGQPGAP 276 Score = 43.6 bits (98), Expect = 2e-04 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 5/126 (3%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX-PPPPXXP 795 P PP P P P P P P P P PP P PP P P P Sbjct: 187 PTGPPGPPGKQGPKGP----NGEPGAPGTPGGNALPGPPGPPGPQGPPGADGLPGNPGAP 242 Query: 796 --PXXXXPPPXXXXPPXPPPXPPPXPPP-XPXPPPXXXXXPXXPXPPXXPPPXPXXP-PP 963 P P P PP P P PP P P P P P P P Sbjct: 243 GVPGQVIEVPGTPGPAGPPGPPGPIGPPGQPGAPGSSQPGPQGPPGDPGIDGAPGNPGSP 302 Query: 964 XPXXPP 981 PP Sbjct: 303 GEPGPP 308 Score = 43.6 bits (98), Expect = 2e-04 Identities = 35/111 (31%), Positives = 35/111 (31%), Gaps = 7/111 (6%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXP----XPPXPXPP-PPXXPPPXPXPPPPXXPPXXXX 810 P P P PP PP P P P P P P P P P PP Sbjct: 206 PGAPGTPGGNALPGPPGPPGPQGPPGADGLPGNPGAPGVPGQVIEVPGTPGPAGPPG--- 262 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXP 957 PP PP P P P PP P P P P P P P P Sbjct: 263 -PPGPIGPPGQPGAPGSSQPGPQGPPGDPGIDGAPGNPGSPGEPGP-PGQP 311 Score = 35.5 bits (78), Expect = 0.058 Identities = 30/120 (25%), Positives = 30/120 (25%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P P P PP PP P Sbjct: 202 PNGEPGAPGTPGGNALPGP------PGPPGPQGPPGADGLPGNPGAPGVPGQVIEVPGTP 255 Query: 795 XPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P PP P P P P P P Sbjct: 256 GPAGPPGP----PGPIGPPGQPGAPGSSQPGPQGPPGDPGIDGAPGNPGSPGEPGPPGQP 311 Score = 35.5 bits (78), Expect = 0.058 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 7/95 (7%) Frame = +1 Query: 616 PPXXPP------XXPXPXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPXPPPPXXPPPXPX 774 PP P P P P P P P P P PP P PP P Sbjct: 220 PPGPPGPQGPPGADGLPGNPGAPGVPGQVIEVPGTPGPAGPPGPPGPIGPPGQPGAPGSS 279 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P PP P P P P PP P Sbjct: 280 QPGPQGPP---GDPGIDGAPGNPGSPGEPGPPGQP 311 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P PP P P P P P P P P P P P P Sbjct: 257 PAGPPGPPGPIGPPGQPGAPGSSQPGPQGPPGDPGIDGAPGNPGSPGEPGPPGQPGAGGG 316 Query: 799 XXXXPPP 819 PPP Sbjct: 317 CDHCPPP 323 >AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical protein Y40B1A.5 protein. Length = 134 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-----PXPXPPPPXX 792 PP P P P P P P PP PP P PPP Sbjct: 22 PPPPPPPAPPALPRELTQISTETAAAVAALVRKPPPSLPPSTMPPGPHGMPFMGGPPPHH 81 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPP PP PPP PPP P Sbjct: 82 QYHLQYPPPHGLGPPPPPPHYYTQPPPPP 110 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 6/89 (6%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX--PPPXPPPXPPPXPX---PPPXX 897 P PPPP PP P PP PP PP P P PPP Sbjct: 22 PPPPPPPAPPALPRELTQISTETAAAVAALVRKPPPSLPPSTMPPGPHGMPFMGGPPPHH 81 Query: 898 XXXPXXPXPPXX-PPPXPXXPPPXPXXPP 981 P P PPP P P PP Sbjct: 82 QYHLQYPPPHGLGPPPPPPHYYTQPPPPP 110 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP 899 PP PPP PPP PP PPP P Sbjct: 77 PPPHHQYHLQYPPPHGLGPPPPPPHYYTQPPPPP 110 Score = 31.9 bits (69), Expect = 0.72 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 1/98 (1%) Frame = +3 Query: 690 PPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPP 869 PPPPP PP P P PP P P P Sbjct: 22 PPPPPPPAPPALPRELTQISTETAAAVAA---------LVRKPPPSLPPSTMPPGPHGMP 72 Query: 870 XXPXPPPPXPPXXXXPXPXP-XPPXXPXXPPPXPXPPP 980 PPP P P PP P P PPP Sbjct: 73 FMGGPPPHHQYHLQYPPPHGLGPPPPPPHYYTQPPPPP 110 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +1 Query: 616 PPXXPPXXP--XPXXPXPPPXPXXXXP-PPPPXPXPXPXPPXPXPPPPXXPPP 765 PP P P P PPP PPP P P PP PP PPP Sbjct: 60 PPSTMPPGPHGMPFMGGPPPHHQYHLQYPPPHGLGPPPPPPHYYTQPP--PPP 110 >AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical protein Y54E2A.8 protein. Length = 485 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P PPP P P PP P P P P PPP P PP Sbjct: 154 PPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVPP 211 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP-PXPPPXPPPX 864 PPP P P P P P PPPP PP P P P P P P PP P Sbjct: 153 PPPTPIPTPVPI-LEPPPPPPPVPPLSPLYKVLEIP---ATPSPIFVAPLPPPPAYTTPD 208 Query: 865 PPPXP 879 PP P Sbjct: 209 VPPEP 213 Score = 41.5 bits (93), Expect = 9e-04 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX---PXPPPPXXPPXXXXPP 816 P P P P P PPPPP P P P P P P P PPPP P Sbjct: 154 PPTPIPTPVPILEPPPPPP-PVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVPPE 212 Query: 817 P 819 P Sbjct: 213 P 213 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PPP P P P P PPP PP PP P P P P P P Sbjct: 153 PPPTPIPTPV---PILEPPPPP---PPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTT 206 Query: 937 PPXPXXP 957 P P P Sbjct: 207 PDVPPEP 213 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXX 953 PP P P P P PPP P PP P P P P P P P P Sbjct: 154 PPTPIPTP----VPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDV 209 Query: 954 PP 959 PP Sbjct: 210 PP 211 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PPP P P P PP PP PP P P P PPP P P Sbjct: 153 PPPTPIPTPVPILEPP--PPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVP 210 Query: 919 XPP 927 P Sbjct: 211 PEP 213 Score = 35.9 bits (79), Expect = 0.044 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 8/61 (13%) Frame = +1 Query: 811 PPPXXXXPPXP--PPXPPPXPPPXPXPPPXXXXXPXXPXP----PXXPPPXPXXP--PPX 966 PPP P P P PPP P P P P P P P PPP P PP Sbjct: 153 PPPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVPPE 212 Query: 967 P 969 P Sbjct: 213 P 213 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PPP P PP P P P P PP P P P Sbjct: 153 PPPTPIPTPVPILEPPPPPP--PVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVP 210 Query: 796 P 798 P Sbjct: 211 P 211 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 PP P P P P P P PPP P P P P P P Sbjct: 154 PPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPP 202 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PPP P P P P P PP P P P P P PPP P Sbjct: 153 PPPTPIPT--PVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIF--VAPLPPPPAYTTPD 208 Query: 841 PPPXP 855 PP P Sbjct: 209 VPPEP 213 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = +3 Query: 852 PPPXPPXXPXP---PPPXPPXXXXPXPXPXPPXXPXXPPP---XPXPPPP 983 PPP P P P PPP PP P P P P P PPPP Sbjct: 153 PPPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPP 202 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 P P P PP P P P P P P PP P P P Sbjct: 168 PPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVPPEP 213 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 12/59 (20%) Frame = +1 Query: 841 PPPXPPPXPPPX-PXPPPXXXXXPXXP-----XPPXXPPP---XPXXPPP---XPXXPP 981 PPP P P P P PPP P P P P P P PPP P PP Sbjct: 153 PPPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTPDVPP 211 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 831 PPPXXPXPPPX---PPXXPXPPPPXPPXXXXPXP-XPXPPXXPXXPPPXPXPPP 980 PP P P P PP P PP P P P P PPP P Sbjct: 154 PPTPIPTPVPILEPPPPPPPVPPLSPLYKVLEIPATPSPIFVAPLPPPPAYTTP 207 >Z84574-5|CAB06541.1| 846|Caenorhabditis elegans Hypothetical protein F33E2.6 protein. Length = 846 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 9/82 (10%) Frame = +1 Query: 724 PPXPXPP---PPXXPPPXPXPP---PPXXPPXXXXPPPXXXXPPXPPPX-PPPXPPPXPX 882 PP PP PP PP PP PP P PPP PP PP PP Sbjct: 367 PPKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEPPTTE 426 Query: 883 PP--PXXXXXPXXPXPPXXPPP 942 PP P P PPP Sbjct: 427 PPNIPYCWQQQSRLFAPSPPPP 448 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP--PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 P PP P P P PP PP P P P P PP PP PP Sbjct: 368 PKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPPPTEP-PKTEPPKTTPPKTEPPTTE 426 Query: 790 XP--PXXXXPPPXXXXPPXPPP 849 P P P PPP Sbjct: 427 PPNIPYCWQQQSRLFAPSPPPP 448 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPP---PPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 PP PP P PP PP PP PP P PP PP PP P Sbjct: 367 PPKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPP-PTEPPKTEPP--KTTPPKTEPP 423 Query: 835 PXPPPXPP 858 PP P Sbjct: 424 TTEPPNIP 431 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +1 Query: 745 PPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXP 924 PP PP PP P PP P PP P P P P P P Sbjct: 367 PPKTDPPRTEPPKTEPPTTE---PPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEPP 423 Query: 925 PXXPPPXP 948 PP P Sbjct: 424 TTEPPNIP 431 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/131 (25%), Positives = 33/131 (25%), Gaps = 10/131 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP---PPPXPXPXPXPPXPXPP---PPXXPPPXPXP 777 P PP P P PP PP P P PP PP PP Sbjct: 576 PRTEPPKTEAPRTVRPKTEAPMTVPPRTEPPMTEAPRTEVPMTEPPKTEPPRTAPPRTEV 635 Query: 778 ----PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPX 945 PP PP P P PP P PP P Sbjct: 636 SMTLPPETVPPNTEAPRTEVPMTVPPRTEPPKTEAPRTVPPKTEAPMTEVPMTGPSRTEV 695 Query: 946 PXXPPPXPXXP 978 P PP P Sbjct: 696 PMTEPPKTEQP 706 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +1 Query: 778 PPPXXPPXXXXPPPXXXXPPXPPPX--PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 PP PP PP P PP PP PP PPP P PP PP Sbjct: 367 PPKTDPPRTE--PPKTEPPTTEPPKIEPPRTEPPKTEPPP---TEPPKTEPPKTTPPKTE 421 Query: 952 XPPPXPXXPP 981 P P P Sbjct: 422 PPTTEPPNIP 431 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PP P PP PP PP P P PP P PP PP Sbjct: 368 PKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPPPTEPP--KTEPPKTTPPKTEPP-T 424 Query: 949 XXPPPXP 969 PP P Sbjct: 425 TEPPNIP 431 Score = 36.3 bits (80), Expect = 0.033 Identities = 28/106 (26%), Positives = 28/106 (26%), Gaps = 4/106 (3%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXXXXPP-PXXXXPP 837 PP PP P PP PP P P P P PP Sbjct: 555 PPRTEPPRTIPPRTEAPRTEPPRTEPPKTEAPRTVRPKTEAPMTVPPRTEPPMTEAPRTE 614 Query: 838 XPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P PP PP PP P PP P P P Sbjct: 615 VPMTEPPKTEPPRTAPPRTEVSMTLPPETVPPNTEAPRTEVPMTVP 660 Score = 36.3 bits (80), Expect = 0.033 Identities = 30/116 (25%), Positives = 30/116 (25%), Gaps = 8/116 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXP---PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPP 783 P PP P P PP P P PP PP P P P Sbjct: 561 PRTIPPRTEAPRTEPPRTEPPKTEAPRTVRPKTEAPMTVPPRTEPPMTEAPRTEVPMTEP 620 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXP----PPXPXPPPXXXXXPXXPXPPXXPP 939 P P PP PP PP P P P P PP Sbjct: 621 PKTEPPRTAPPRTEVSMTLPPETVPPNTEAPRTEVPMTVPPRTEPPKTEAPRTVPP 676 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPX--PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 PP P P P PP P PP PP P P P PP Sbjct: 367 PPKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEPPTTE 426 Query: 972 PP 977 PP Sbjct: 427 PP 428 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPX--PPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P PP P P P PP P PPP PP P P P P Sbjct: 368 PKTDPPRTEPPKTEPPTTEPPKIEPPRTEPPKTEPPPTEPPKTEPPKTTPPKTEPPTTEP 427 Query: 960 P 962 P Sbjct: 428 P 428 Score = 34.7 bits (76), Expect = 0.10 Identities = 30/123 (24%), Positives = 30/123 (24%), Gaps = 5/123 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPP---PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PP P P PP P P PP PP P PP Sbjct: 621 PKTEPPRTAPPRTEVSMTLPPETVPPNTEAPRTEVPMTVPPRTEPPKTEAPRTV---PPK 677 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXPP 960 P P P PP P PP P PP P P Sbjct: 678 TEAPMTEVPMTGPSRTEVPMTEPPKTEQPRTAPPRTEVSMTLPPETVPPKTEAPRTEVPM 737 Query: 961 PXP 969 P Sbjct: 738 TGP 740 Score = 34.3 bits (75), Expect = 0.14 Identities = 34/127 (26%), Positives = 34/127 (26%), Gaps = 9/127 (7%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPX-PXPPXPXPPPPXXPPPXPXPPPPXX 792 P PP P P P PP P P P PP PP P Sbjct: 556 PRTEPPRTIPPRTEAPRTEPPRTEPPKTEAPRTVRPKTEAPMTVPPRTEPPMTEAPRTEV 615 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXP------PPXPXPPPXXXXXPXXP--XPPXXPPPXP 948 P PP PP PP PP PP P PP PP Sbjct: 616 P---MTEPPKTE----PPRTAPPRTEVSMTLPPETVPPNTEAPRTEVPMTVPPRTEPPKT 668 Query: 949 XXPPPXP 969 P P Sbjct: 669 EAPRTVP 675 >Z82064-2|CAI79180.1| 167|Caenorhabditis elegans Hypothetical protein W02B9.2 protein. Length = 167 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 G GG GGG GG GG G GG GG G GG G GG GG G G Sbjct: 79 GPDNNGGRGGGRGGDRGG-DRGGDRGGDRGGDRGGDRGGDRGGRRGRGGYRDGGGGRG 135 >Z81124-1|CAB03369.1| 312|Caenorhabditis elegans Hypothetical protein T21B4.2 protein. Length = 312 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG GGGG GG GGGG G GG G G G G G G G Sbjct: 89 GSGSYAAGGAGGGGG---GGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAA 145 Query: 638 XXGGXXG 618 G G Sbjct: 146 GNPGQAG 152 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G G GG GGG GG GGG GG G G G G G G G Sbjct: 89 GSGSYAAGGAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNP 148 Query: 698 GGGG 687 G G Sbjct: 149 GQAG 152 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 GGG G G GGG GGG GG G G G G G G G G Sbjct: 99 GGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNPG 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 35/131 (26%), Positives = 35/131 (26%), Gaps = 10/131 (7%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 G G GGG GGG GG G G G G G G G G Sbjct: 97 GAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNPGQAGADAS 156 Query: 800 XGG----------XXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGX 651 G G G G G G G G G G G GG G Sbjct: 157 QDAPSASDFCFDCPPGPAGPAGNAGPPGAPG-GPGAPGNTPSGGAAGPPGPPGPPGGPGN 215 Query: 650 XGXGXXGGXXG 618 G G G Sbjct: 216 DGQPGGPGNPG 226 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/98 (27%), Positives = 27/98 (27%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGX 729 G G G G GGG G GGG GG G G G G G G G Sbjct: 91 GSYAAGGAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNPGQ 150 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G GG Sbjct: 151 AGADASQDAPSASDFCFDCPPGPAGPAGNAGPPGAPGG 188 Score = 38.7 bits (86), Expect = 0.006 Identities = 35/120 (29%), Positives = 35/120 (29%), Gaps = 10/120 (8%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G GG G G GGG GGG GGG GGG G G G G Sbjct: 89 GSGSYAAGGAGGGG-----GGGYATGGGGGGG-GGGCCSCGIGAAGPAGPPGADGNPGTD 142 Query: 767 XGGGXXGGGGXGXGGXGXGXG----------XGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G GG G G GG G Sbjct: 143 GAAGNPGQAGADASQDAPSASDFCFDCPPGPAGPAGNAGPPGAPGGPGAPGNTPSGGAAG 202 Score = 38.7 bits (86), Expect = 0.006 Identities = 30/113 (26%), Positives = 30/113 (26%), Gaps = 3/113 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP--PX 801 PP P PP P P P P PP P P P P P Sbjct: 170 PPGPAGPAGNAGPPGAPGGPGAPGNTPSGGAAGPPGPPGPPGGPGNDGQPGGPGNPGAPG 229 Query: 802 XXXPPPXXXXPPXPP-PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P PP PP P PP P P P P P P Sbjct: 230 AVTEVPGQQGPPGPPGPAGPPGPAGNAGQAGYAQPGPAGPPGDAGPDGAPGNP 282 Score = 37.5 bits (83), Expect = 0.014 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 7/107 (6%) Frame = +1 Query: 628 PPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXP----XPPXP-XPPPPXXPPPXPXPPPPX 789 PP P P P P PP PP P P P P P P P P Sbjct: 182 PPGAPGGPGAPGNTPSGGAAGPPGPPGPPGGPGNDGQPGGPGNPGAPGAVTEVPGQQGPP 241 Query: 790 XPPXXXXPP-PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 PP PP P P P PP P P P P Sbjct: 242 GPPGPAGPPGPAGNAGQAGYAQPGPAGPPGDAGPDGAPGNPGQPGAP 288 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGX 782 G G G G G G GG GGGG G G G G G G G Sbjct: 89 GSGSYAAGGAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNP 148 Query: 781 G 779 G Sbjct: 149 G 149 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 979 GGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG 836 GG G GGG GG G G G G G G G G G G Sbjct: 96 GGAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDG 143 Score = 36.3 bits (80), Expect = 0.033 Identities = 31/119 (26%), Positives = 31/119 (26%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G GG G GG G G GG GGGG G G G G G Sbjct: 89 GSGSYAAGGAGGGGGGGYATGGG----GGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGA 144 Query: 802 GGXGXGXGGXXXXXXXXXXXXXGXXGXXGGXXXGGGGGXXXXXXGXGXXXXXGXGGXXG 626 G G G G G G G G GG G Sbjct: 145 AG-NPGQAGADASQDAPSASDFCFDCPPGPAGPAGNAGPPGAPGGPGAPGNTPSGGAAG 202 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGG-XGXGXGXXXXGG-XGGGGXGXXGGXGGGXGXXG 836 GGGGG GGG G GG G G G G G G G G G Sbjct: 101 GGGGGYATGGGGGGGGGGCCSCGIGAAGPAGPPGADGNPGTDGAAGNPGQAG 152 Score = 33.5 bits (73), Expect = 0.24 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 12/81 (14%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXP---PPXPPPXPPPXPXPP--PXXXXXPXXPXPPXXPP 939 PP P P PP P P P PP P PP P P P P P Sbjct: 170 PPGPAGPAGNAGPPGAPGGPGAPGNTPSGGAAGPPGPPGPPGGPGNDGQPGGPGNPGAPG 229 Query: 940 PXPXXP-------PPXPXXPP 981 P PP P PP Sbjct: 230 AVTEVPGQQGPPGPPGPAGPP 250 Score = 31.9 bits (69), Expect = 0.72 Identities = 28/116 (24%), Positives = 28/116 (24%), Gaps = 1/116 (0%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PP P P P P P P P PP P PP Sbjct: 192 PGNTPSGGAAGPPGPPGPPGGPGNDGQPGGPGNPGAPGAVTEVPGQQGP-PGPPGPAGPP 250 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXP-PPXXXXXPXXPXPPXXPPPXPXXPPP 963 P PP P P P P P PPP Sbjct: 251 GPAGNAGQAGYAQPGPAGPPGDAGPDGAPGNPGQPGAPGDAGAPGSGGGCDHCPPP 306 Score = 29.5 bits (63), Expect = 3.8 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 2/109 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP-PXPXPPPPXX 792 PP P P P P P P P P PP P PP P Sbjct: 203 PPGPPGPPGGPGNDGQPGGPGNPGAPGAVTEVPGQQGP-PGPPGPAGPPGPAGNAGQAGY 261 Query: 793 PPXXXXPPPXXXXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP P P P P P P P P P Sbjct: 262 AQPGPAGPPGDAGPDGAPGNPGQPGAPGDAGAPGSGGGCDHCPPPRTAP 310 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -3 Query: 743 GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G GGG G GGG G G G Sbjct: 89 GSGSYAAGGAGGGGGGGYATGGGGGGGGGGCCSCGIGAAGPAG 131 >U61948-2|AAB03143.2| 345|Caenorhabditis elegans Collagen protein 14 protein. Length = 345 Score = 45.6 bits (103), Expect = 5e-05 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 7/106 (6%) Frame = +1 Query: 646 PXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP--P 816 P P PP P P PP P P P P P PP P P P P Sbjct: 182 PGPPAPPGPDPHSLFPPQCPCEAPPGDGGPPGQPGPDGPPGAPGNAGEDGKPGDQGPRGP 241 Query: 817 PXXXXPPXPPPXP-PPXPP---PXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP P P P P PP P P Sbjct: 242 PGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGPPGQPGP 287 Score = 44.4 bits (100), Expect = 1e-04 Identities = 37/117 (31%), Positives = 37/117 (31%), Gaps = 14/117 (11%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXP--------PXPXPPPPXXPPPXPXPPPPXXPPXXXXP--PPX 822 P PP PP P P P P P PP PP P P P P P Sbjct: 176 PGEIGPPGPPAP-PGPDPHSLFPPQCPCEAPPGDGGPPGQPGPDGPPGAPGNAGEDGKPG 234 Query: 823 XXXPPXPPPXP-PPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXP-PPXPXXPP 981 P PP P P P P PP P P P P P P P PP Sbjct: 235 DQGPRGPPGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGPPGQPGPAGPP 291 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P PP P P P P P P P P P Sbjct: 233 PGDQGPRGP-PGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGP-PGQPGPAGP 290 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP 867 P P P PP P Sbjct: 291 PGENG--KGGGQGPSGLPGPPGQP 312 >M25480-1|AAA27986.1| 326|Caenorhabditis elegans collagen protein. Length = 326 Score = 45.6 bits (103), Expect = 5e-05 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 7/106 (6%) Frame = +1 Query: 646 PXXPXPP-PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP--P 816 P P PP P P PP P P P P P PP P P P P Sbjct: 163 PGPPAPPGPDPHSLFPPQCPCEAPPGDGGPPGQPGPDGPPGAPGNAGEDGKPGDQGPRGP 222 Query: 817 PXXXXPPXPPPXP-PPXPP---PXPXPPPXXXXXPXXPXPPXXPPP 942 P P P P PP P P P P PP P P Sbjct: 223 PGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGPPGQPGP 268 Score = 44.4 bits (100), Expect = 1e-04 Identities = 37/117 (31%), Positives = 37/117 (31%), Gaps = 14/117 (11%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXP--------PXPXPPPPXXPPPXPXPPPPXXPPXXXXP--PPX 822 P PP PP P P P P P PP PP P P P P P Sbjct: 157 PGEIGPPGPPAP-PGPDPHSLFPPQCPCEAPPGDGGPPGQPGPDGPPGAPGNAGEDGKPG 215 Query: 823 XXXPPXPPPXP-PPXPPPXPXPP--PXXXXXPXXPXPPXXPPPXPXXP-PPXPXXPP 981 P PP P P P P PP P P P P P P P PP Sbjct: 216 DQGPRGPPGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGPPGQPGPAGPP 272 Score = 29.5 bits (63), Expect = 3.8 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P PP P P P P P P P P P Sbjct: 214 PGDQGPRGP-PGIPGAPGQPGRPGPPGEPGTYKTEVGPAGRAGAPGRPGP-PGQPGPAGP 271 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP 867 P P P PP P Sbjct: 272 PGENG--KGGGQGPSGLPGPPGQP 293 >L23648-9|AAK95877.1| 466|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 38 protein. Length = 466 Score = 45.6 bits (103), Expect = 5e-05 Identities = 34/123 (27%), Positives = 34/123 (27%), Gaps = 2/123 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP PP P P PP P P P P P PP PPP P Sbjct: 6 PPNYPPGNPNQPPPFPPTPYYPMYQAGMPMPYIPQSPQYPQPGPPGGPPPFMGIQIKQEP 65 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPPXPXXPPPXP 969 P P PP P PP P P PP P P P Sbjct: 66 MWSQENRYGMQAGPSGMPGMPPSSHPYGY-PPMHGMPPGMPQGMPPMMDPNMPDFSSPPM 124 Query: 970 XXP 978 P Sbjct: 125 HHP 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +3 Query: 852 PPPXPPXXPXPPPPXPPXXXXPX-----PXPXPPXXPXXPPPXPXPPPP 983 PP PP P PPP PP P P P P P P P P PP Sbjct: 6 PPNYPPGNPNQPPPFPPTPYYPMYQAGMPMPYIPQSPQYPQPGPPGGPP 54 >AF068713-14|AAK73895.1| 172|Caenorhabditis elegans Ground-like (grd related) protein29 protein. Length = 172 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 G GG G GGG G G GGG GG GGG GG GGG G G Sbjct: 20 GLFNMLGGAGGCGGGGGCGGGGGCGGGCGYGGG----GGCGYGGGYGCG 64 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/34 (61%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGG 687 G GG G GGG GGGG G G G G G G G GGG Sbjct: 27 GAGGCGGGGGCGGGGGCGGGCGYGGGGGCGYGGG 60 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/37 (62%), Positives = 23/37 (62%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG GGGG G GGG GGG G GG G G G GGG G Sbjct: 29 GGCGGGGGCGGGGGC--GGGCGYGG-GGGCGYGGGYG 62 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 782 GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GG G GGG GGG GG G G G GGGGG G GGG G Sbjct: 26 GGAGGCGGGGGCGGG---GGCGGGCGYGGGGG---CGYGGGYG 62 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = -3 Query: 836 GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXG 705 GG GGG GG GGGG G G G GGGG G GG G G G Sbjct: 26 GGAGGCGGG----GGCGGGGGCGGGCGYGGGGGCGYGG-GYGCG 64 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXG 834 G G GG G G GGG G GGG G G GGG G Sbjct: 27 GAGGCGGGGGCGGGGGCGGGCGYGGGGGCGYGGGYG 62 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 854 GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXG 726 G GG GG GGG GG GG G G GGG GGG G G Sbjct: 26 GGAGGCGGGGGCGGG----GGCGGGCGYGGGGGCGYGGGYGCG 64 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G GGG G GGG GGG G G GG GGG Sbjct: 26 GGAGGCGG----GGGCGGGGGCGGGCGYGGGGGCGYGGG 60 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GG GG G GGG G GG G G G GGGG G GG G G Sbjct: 26 GGAGGCGGGGGCGGG-GGCGGGCGYG-----GGGGCGYGGGYGCG 64 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/44 (52%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 980 GGXXGXGGGXX-GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG 852 GG G GGG G GGG GG G G GGG G GGG G G Sbjct: 26 GGAGGCGGGGGCGGGGGCGGGCGYGG-----GGGCGYGGGYGCG 64 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGG 744 G GG GG GGG GG GGG G GGGG G GGG G Sbjct: 26 GGAGGCGG--GGGCGGGGGCGGGC----GYGGGGGCGYGGGYGCG 64 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG 846 GG GGG GG G G GGG G G G G G G Sbjct: 26 GGAGGCGGGGGCGGGGGCGGGCGYGGGGGCGYGGGYGCG 64 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 746 GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG G GG G G GG GG G GGG G G Sbjct: 26 GGAGGCGGGGGCGGGGGCGGGCGYGGGGGCGYGG 59 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 958 GGXXGXXGGXGXGXGXXXXGGXG-GGGXGXXGGXGGGXG 845 GG G GG G G G GG G GGG G G GGG G Sbjct: 26 GGAGGCGGGGGCGGGGGCGGGCGYGGGGGC--GYGGGYG 62 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 734 GXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GG G G G GGGGG GGG G G G G G Sbjct: 27 GAGGCGGGGGCGGGGGC-----GGGCGYGGGGGCGYGGG 60 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 946 GXXGGXGXGXGXXXXGGXGGGGXGXXG-GXGGGXGXXGG 833 G GG G G G G GGG G G G GGG G GG Sbjct: 26 GGAGGCGGGGGC----GGGGGCGGGCGYGGGGGCGYGGG 60 >AF067211-1|AAC16986.1| 455|Caenorhabditis elegans Hypothetical protein B0205.10 protein. Length = 455 Score = 45.6 bits (103), Expect = 5e-05 Identities = 28/94 (29%), Positives = 28/94 (29%), Gaps = 4/94 (4%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P Sbjct: 72 PAPAPTAPDVQQPGPAPVPVPEPAQLAPQSAPEPTPDAPAAAPVQETPQVAPAPETPAPA 131 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPP 888 P P P P P P P P P P P Sbjct: 132 PETPAPAPVQETPQVVAPAPEPTPEAAAPVPADP 165 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/113 (26%), Positives = 30/113 (26%), Gaps = 2/113 (1%) Frame = +1 Query: 646 PXXPXPPPXPXXXXP--PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P P P P P P Sbjct: 55 PAAPAPAPASVQQQPEAPAPAPTAPDVQQPGPAPVPVPEPAQLAPQSAPEPTPDAPAAAP 114 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P P P P P P P P Sbjct: 115 VQETPQVAPAPETPAPAPETPAPAPVQETPQVVAP--APEPTPEAAAPVPADP 165 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/117 (26%), Positives = 31/117 (26%), Gaps = 4/117 (3%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPP---PXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P P P Sbjct: 55 PAAPAPAPASVQQQPEAPAPAPTAPDVQQPGPAPVPVPEPAQLAPQSAPEPTPDAPAAAP 114 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P Sbjct: 115 --VQETPQVAPAPETPAPAPETPAPAPVQETPQVVAPAPEPTPEAAAPVPADPQSSP 169 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P P P P P P P P Sbjct: 69 PEAPAPAPTAPDVQQPGPAPVPVPEPAQLAPQSAPEPTPDAPAAAPVQETPQVAPAPETP 128 Query: 957 PPXPXPPPP 983 P P P P Sbjct: 129 APAPETPAP 137 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/92 (26%), Positives = 24/92 (26%), Gaps = 1/92 (1%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P P P Sbjct: 79 PDVQQPGPAP-VPVPEPAQLAPQSAPEPTPDAPAAAPVQETPQVAPAPETPAPAPETPAP 137 Query: 799 XXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPP 891 P P P P P P P P Sbjct: 138 APVQETPQVVAPAPEPTPEAAAPVPADPQSSP 169 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P Sbjct: 84 PGPAPVPVPEPAQLAPQSAPEPTPDAPAAAPVQETPQVAPAPETPAPAPETPAPAPVQET 143 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P P P P P Sbjct: 144 PQVVAPAPEPTPEAAAPVPADPQSSP 169 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 3/70 (4%) Frame = +3 Query: 780 PXPXPXP-PXPXXP-XXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP-PXXPX 950 P P P P P P P P P P P P P P P P P Sbjct: 86 PAPVPVPEPAQLAPQSAPEPTPDAPAAAPVQETPQVAPAPETPAPAPETPAPAPVQETPQ 145 Query: 951 XPPPXPXPPP 980 P P P P Sbjct: 146 VVAPAPEPTP 155 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 3/71 (4%) Frame = +3 Query: 777 PPXPXPXPPX-PXXPXXXXPPPXXPX-PPPXPPXXPXPPPPXPPXXXXPXPXP-XPPXXP 947 P P P P P P P P P P P P P P P P P P Sbjct: 55 PAAPAPAPASVQQQPEAPAPAPTAPDVQQPGPAPVPVPEPAQLAPQSAPEPTPDAPAAAP 114 Query: 948 XXPPPXPXPPP 980 P P P Sbjct: 115 VQETPQVAPAP 125 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P P P P P P P P P P P P Sbjct: 55 PAAPAPA-PASVQQQPEAPAPAPTAPDVQQPGPA-------PVPVPEPAQLAPQSAPEPT 106 Query: 972 PPPP 983 P P Sbjct: 107 PDAP 110 >AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical protein ZC123.1 protein. Length = 730 Score = 45.6 bits (103), Expect = 5e-05 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 9/85 (10%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXP------PPPPXPXPXPXPPXPXPPPPXXPPPXPXP---PPPXX 792 P P PPP P P P P P P P P P Sbjct: 68 PLACCPPPPPPKPCCQPAFGPCCPATPNCCPKPCCRGRRPEYEEYEDEEGNPGGVPAPPN 127 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXP 867 PP PPP PP PPP PPP P Sbjct: 128 PPRTCCPPPTPAAPPPPPPPPPPAP 152 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 1/90 (1%) Frame = +2 Query: 713 PXPXPXXPXPPPPXXP-PPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXXXXXXXPP 889 P P P PPPP P P P P P Sbjct: 66 PIPLACCPPPPPPKPCCQPAFGPCCPATPNCCPKPCCRGRRPEYEEYEDEEGNPGGVPAP 125 Query: 890 PXPXXXPXPPPXPXXPXPPXPXPPXXPPXP 979 P P PPP P P PP P PP P P Sbjct: 126 PNPPRTCCPPPTPAAPPPPPPPPPPAPEAP 155 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 P PP P PP P PPP PPP P P P Sbjct: 123 PAPPNPPRTCCPPPTPAAPPPPPPPPPPAPEAP 155 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/88 (30%), Positives = 27/88 (30%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P P PPPP PP P P P P P P P Sbjct: 66 PIPLACCPPPP---PPKPCCQPAFGP-CCPATPNCCPKPCCRGRRPEYEEYEDEEGNPGG 121 Query: 898 XXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PPP P PPP P PP Sbjct: 122 VPAPPNPPRTCCPPPTPAAPPPPPPPPP 149 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P PPP P PP PP P P P P P P P Sbjct: 119 PGGVPAPPNP--PRTCCPPPT-PAAPPPPPPPPPPAPEAPTQCCGSQPYGRTPCRSGCP 174 Score = 38.3 bits (85), Expect = 0.008 Identities = 34/105 (32%), Positives = 34/105 (32%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P PPPPP P P P P P P P P P P P Sbjct: 66 PIPLACCPPPPP-PKPCCQPAF-GPCCPATPNCCPKPCCRGRRPEYEEYEDEEGNPGGVP 123 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP PP PPP P PPP P PPP P Sbjct: 124 A--PPNPPRTCCPPPT----------PAAPPP-PPPPPPPAPEAP 155 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 668 PXXXXXXPPPPPXXXPXPXPXXPXPPPPXXPPPXXXP 778 P P PP P P P P PPPP PP P Sbjct: 119 PGGVPAPPNPPRTCCPPPTPAAPPPPPPPPPPAPEAP 155 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P P P P PP PPPPP P P P P Sbjct: 119 PGGVPAPPNPPRTCCPPPTPAAPPPPPPPPPPAPEAP 155 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP 780 P P PP P P P P P PPP PPP P P Sbjct: 119 PGGVPAPPNPPRTCCPPPTPAAPPPPPPP---PPPAPEAP 155 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP-PXXPPXXXXPPPXXXXP 834 P PP P P P P P PPP P PPP P P P P Sbjct: 123 PAPPNP---PRTCCPPPTPAAPPPPPPPPPPAPEAPTQCCGSQPYGRTP 168 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 882 PPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 P PP PP P P P P PP P PPPP Sbjct: 123 PAPPNPPRTCCPPPTPAAP------PPPPPPPPP 150 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PP P PPP P P P P PPPP P Sbjct: 123 PAPPNPPRTCCPPPTPAAPPPP----PPPPPPAPEAP 155 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP P P P PP P PPPPP P Sbjct: 125 PPNPPRTCCPPPTPAAPPPP---PPPPPPAP 152 >Z68219-2|CAA92476.1| 300|Caenorhabditis elegans Hypothetical protein T05A1.2 protein. Length = 300 Score = 45.2 bits (102), Expect = 7e-05 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 8/110 (7%) Frame = +1 Query: 673 PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP--PXXXXPPXPP 846 P P P P P P P PPP P PP PP P P PP PP Sbjct: 115 PGTPGRPGAPGAPGHPGKPPQSPCEPLTPPPCPACPP--GPPGAPGAPGKPGSEGPPGPP 172 Query: 847 ----PXPPPXPP--PXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P P PP P P P P Sbjct: 173 GHDGPNGGPGQPGQPGPHGPNGHPGKPGSQGPPGPPGHSDEPKPGQPGQP 222 Score = 45.2 bits (102), Expect = 7e-05 Identities = 36/125 (28%), Positives = 36/125 (28%), Gaps = 3/125 (2%) Frame = +1 Query: 616 PPXXPPXXP-XPXXPXPPPXPXXXXPP-PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P PP PP P P P P P P P P Sbjct: 143 PPPCPACPPGPPGAPGAPGKPGSEGPPGPPGHDGPNGGPGQPGQPGPHGPNGHPGKPGSQ 202 Query: 790 XPPXXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 PP PP P P P P P P P P P P P Sbjct: 203 GPP---GPPGHSDEPKPGQPGQPGRAGPRGPRGVAGIKGKDGAPGSPGQPGPRGGPGEPG 259 Query: 967 PXXPP 981 P Sbjct: 260 QDGAP 264 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/106 (27%), Positives = 29/106 (27%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPP P P PP P P PP P Sbjct: 118 PGRPGAPGAPGHPGKPPQSPCEPLTPPPCPACPPGPPGAPGAPGKPGSEGPPGPPGHDGP 177 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P P P P PP P P P P Sbjct: 178 NGGPGQPGQPGPHGPNGHPGKPGSQGPPGPPGHSDEP-KPGQPGQP 222 Score = 42.7 bits (96), Expect = 4e-04 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 6/110 (5%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX--PPPPXXP--PPXPXPPPPXXPPXXXXP 813 P P P P PP P PP P P PP P P P P PP P Sbjct: 118 PGRPGAPGAPGHPGKPPQSPCEPLTPPPCPACPPGPPGAPGAPGKPGSEGPPGPPGHDGP 177 Query: 814 PPXXXXPPXPPPXPPPXPP--PXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P P PP P P P P Sbjct: 178 NGGPGQPGQPGPHGPNGHPGKPGSQGPPGPPGHSDEPKPGQPGQPGRAGP 227 Score = 37.9 bits (84), Expect = 0.011 Identities = 28/98 (28%), Positives = 28/98 (28%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P P PP P PP P PP PP P P P Sbjct: 115 PGTPGRPGAPGAPGHPGKPPQSPCEPLTPPPCPACPPG----PPG---APGAPGKPGSEG 167 Query: 868 PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P P P P P PP Sbjct: 168 PPGPPGHDGPNGGPGQPGQPGPHGPNGHPGKPGSQGPP 205 >AF036699-5|AAB88359.1| 290|Caenorhabditis elegans Collagen protein 105 protein. Length = 290 Score = 45.2 bits (102), Expect = 7e-05 Identities = 29/93 (31%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = +1 Query: 706 PXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P P PP P PPP P PP P P P Sbjct: 96 PGPTGEPGRPGRPGKPGVPGMPGNPGKPPQQPCELVTPPPCSPCPAGPPGKPGPQGAPGD 155 Query: 880 XPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P PP P PP P P Sbjct: 156 IGQPGNPGERGMDGEPG--PPGPTGPPGEPGLP 186 Score = 37.9 bits (84), Expect = 0.011 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 3/107 (2%) Frame = +1 Query: 568 LHVDRXDXAXXXXXXXPPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP 747 L D D P P P P P P PP P PP P P Sbjct: 82 LDTDECDGCCIQGAPGPTGEPGRPGRPGKPGVPGMPGNPGKPPQQ-PCELVTPP-PCSPC 139 Query: 748 PXXPPPXPXP---PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PP P P P P P P P PP P P Sbjct: 140 PAGPPGKPGPQGAPGDIGQPGNPGERGMDGEPGPPGPTGPPGEPGLP 186 Score = 31.9 bits (69), Expect = 0.72 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXPPP-PXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXX 906 P P P P P P P PP PPP P P PP P Sbjct: 96 PGPTGEPGRPGRPGKPGVPGMPGNPGKPPQQPCELVTPPPCSPCPAGPPGKPGPQGAPGD 155 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P PP P PP Sbjct: 156 IGQPGNPGERGMDGEPGPPGPTGPP 180 Score = 31.5 bits (68), Expect = 0.95 Identities = 27/115 (23%), Positives = 27/115 (23%), Gaps = 1/115 (0%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXX 792 PP P P P P P P P P P P P P P Sbjct: 134 PPCSPCPAGPPGKPGPQGAPGDIGQPGNPGERGMDGEPGPPGPTGPPGEPGLPGAQGITG 193 Query: 793 PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P PP P P P P P PP P Sbjct: 194 QPGVNAEPVAYRAGAPGPPGEPGPPGAHGDPGDLGEEGPPGLPGPKGPPGASGIP 248 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXP---XPPPPXPPXXXXPXPXPXPPXXP 947 P P P P P P P P PP P PPP P P P P P Sbjct: 96 PGPTGEPGRPGRPGKPGVP-GMPGNPGKPPQQPCELVTPPPCSPCPAGPPGKPGPQGAP 153 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/91 (26%), Positives = 24/91 (26%), Gaps = 3/91 (3%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXXXXPPPX 822 P P P P P P P P PPP P P P P P Sbjct: 96 PGPTGEPGRPGRPGKPGVPGMPGNPGKPPQQPCELVTPPPCSPCPAGPPGKPGPQGAPGD 155 Query: 823 XXXP--PXPPPXPPPXPPPXPXPPPXXXXXP 909 P P PP P PP P Sbjct: 156 IGQPGNPGERGMDGEPGPPGPTGPPGEPGLP 186 Score = 28.3 bits (60), Expect = 8.9 Identities = 24/103 (23%), Positives = 24/103 (23%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P PP P P P P P PP PP Sbjct: 159 PGNPGERGMDGEPGPPGPTGPPGEPGLPGAQGITGQPGVNAEPVAYRAGAPGPPGEPGPP 218 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPP 927 P PP P P PP P P P Sbjct: 219 GAHG-DPGDLGEEGPPGLPGPKGPPGASGIPGNDGPPGARGQP 260 >U53153-1|AAC69039.4| 715|Caenorhabditis elegans Hypothetical protein T19A5.3a protein. Length = 715 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GG GGGG G GGG GGGG GG G G GG Sbjct: 475 GGFGSFGGGGGGGGFGGGGGGFGGGG---GGFGSGSPFGG 511 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXG 672 G GG G GG GGGG G GG G G G GG G G Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFG 510 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G GGG GGGG G GG G G G G G Sbjct: 475 GGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFG 510 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 G G G GGG GG GGG G GGGG G G G GG G GG Sbjct: 473 GAGGFGSFGGGGGGGGFGGGG-----GGFGGGGGGFGSGSPFGGAAPSPPSGPDPDFGG 526 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 892 GGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G GG G GG GGG G GGG G G G G GG Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G GGGG G GG GGGG G GG G G G GG Sbjct: 473 GAGGFGSFGGGGGGGGFGG--GGGGFGGGGGGFGSGSPFGG 511 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 GG GGG GGG GG GG GGG G GG G Sbjct: 475 GGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGGAAPSPPSG 519 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 749 GGGGXGX-GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G GG G G G GGGGG G GGG G G G G Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGG----GFGGGGGGFGSGSPFG 510 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G G G GGG G GGG GGG GGG GG Sbjct: 473 GAGGFGSFGGGGGGGGFGGG-GGGFGGGGGG 502 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 926 GGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGG 813 GG G G GG G GGG GGG GGG G GG Sbjct: 475 GGFGSFGGGGGGGGFGGGGGGFGGG-GGGFGSGSPFGG 511 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -3 Query: 968 GXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GG G G GGG G G G GGG G G GG G GG G Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGGAAPSPPSGPDPDFGGDTAAAG 532 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXG 783 G G G GG GG G G GGG GGG G G G G GG Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGG---GGGFGSGSPFGGAAPSPPSGPDPDFGGDTA 529 Query: 782 GGG 774 G Sbjct: 530 AAG 532 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 776 GXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G G GGGG G G G G GGGGG GG Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 978 GXGGXXGGXGXGGXGXXGXGGGXGXXXGXGG 886 G GG GG G GG G G GGG G GG Sbjct: 481 GGGGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 728 GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGGGG G GGG G G G G G Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFG 510 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGG 884 G GG G GGG G GG G G G G GG Sbjct: 478 GSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 G GG G GG G GG G G G GG G G GG Sbjct: 473 GAGGFGSFGG-GGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXG 836 GGGGG GGG GG G G G G G GG G Sbjct: 483 GGGGGGFGGGGGGFGGGGGGFGSGSPFGGAAPSPPSGPDPDFGGDTAAAG 532 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 758 GXXGGGGXGXGGXGXG-XGXGGGGGXXXXGXGGGXGXXG 645 G G G G GG G G G GGG G G G G G Sbjct: 473 GAGGFGSFGGGGGGGGFGGGGGGFGGGGGGFGSGSPFGG 511 >AC024775-6|AAK68452.2| 304|Caenorhabditis elegans Collagen protein 108 protein. Length = 304 Score = 44.8 bits (101), Expect = 1e-04 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 3/121 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP--PX 789 P PP P P P PP P P P P P P P P Sbjct: 144 PITPPPCKPCPQGPAGPPGPPG--PAGDAGSDGSPGAPGSDGQPGAAGDKGPAGPNGNPG 201 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPX 966 P P P P P P PP P PP P P P P P P Sbjct: 202 APGSPGKPGEDGKSEPITPGAPGPAGPPGPQGPPGAPGQPGHDGQPGTPGPKGPNGNPGA 261 Query: 967 P 969 P Sbjct: 262 P 262 Score = 42.7 bits (96), Expect = 4e-04 Identities = 31/112 (27%), Positives = 31/112 (27%), Gaps = 1/112 (0%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP PPP P P P P PP P P P Sbjct: 131 PGNPGRPPQQPCEPITPPPCK-PCPQGPAGPPGPPGPAGDAGSDGSPGAPGSDGQPGAAG 189 Query: 826 XXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-PPXPXXPPPXPXXP 978 P P P P P P P P PP P PP P P Sbjct: 190 DKGPAGPNGNPGAPGSPGKPGEDGKSEPITPGAPGPAGPPGPQGPPGAPGQP 241 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P P P P P PP P P PPP P P P PP Sbjct: 112 PAGTPGKPGRPGKAGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPAGPPGPP 164 Score = 33.9 bits (74), Expect = 0.18 Identities = 27/105 (25%), Positives = 27/105 (25%), Gaps = 7/105 (6%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXX 868 PP P P P P P P PP PP P P P Sbjct: 137 PPQQPCEPITPPPCKPCPQGPAGPP---GPPGPAGDAGSDGSPGAPGSDGQPGAAGDKGP 193 Query: 869 XXXXXPPPXPXXXPXP-------PPXPXXPXPPXPXPPXXPPXPP 982 P P P P P P P P P PP P Sbjct: 194 AGPNGNPGAPGSPGKPGEDGKSEPITPGAPGPAGPPGPQGPPGAP 238 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 1/76 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPP 888 P P P P P P P P PP P PPP P P P P P Sbjct: 107 PGAAGPAGTPGKPGRPGKAGAPGLPGNP---GRPPQQPCEPITPPPCKPCPQGPAGPPGP 163 Query: 889 PXXXXXPXXPXPPXXP 936 P P P Sbjct: 164 PGPAGDAGSDGSPGAP 179 Score = 30.7 bits (66), Expect = 1.7 Identities = 33/123 (26%), Positives = 33/123 (26%), Gaps = 14/123 (11%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPX-PXPPPPXXPPXXXXP------ 813 P P P P P P P P P PPP P P P PP P Sbjct: 116 PGKPGRPGKAGAPGLPG---NPGRPPQQPCEPITPPPCKPCPQGPAGPPGPPGPAGDAGS 172 Query: 814 --PPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP-XPXXP----PPXPX 972 P P P P P P P P P P PP P Sbjct: 173 DGSPGAPGSDGQPGAAGDKGPAGPNGNPGAPGSPGKPGEDGKSEPITPGAPGPAGPPGPQ 232 Query: 973 XPP 981 PP Sbjct: 233 GPP 235 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P PP P P P P P PP P Sbjct: 107 PGAAGPAGTPGKPGRPGKAGAPGLPGNPGRPPQQPCEPITPPPCKPCPQGPAGPPGPP 164 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 858 PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P PP P P P P P PP P P Sbjct: 128 PGLPGNPGRPPQQPCEPITPPPCKPCPQGPAGPPGPPGP 166 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P P P P P P PP P PP P P P P Sbjct: 200 PGAPGSPGKPGEDGKSEPITPGA---PGPAGPPGPQGPPGAPGQPGHDGQPGTPGPKGPN 256 Query: 826 XXPPXPPPXPPPXPP 870 P P P P Sbjct: 257 GNPGAPGADGNPGTP 271 >Z79596-2|CAC42251.1| 838|Caenorhabditis elegans Hypothetical protein C02C6.1b protein. Length = 838 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 1/93 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPP 837 PPP P P P P P P P P P PP P P PP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGAPG-G 804 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP P P P P P P P Sbjct: 805 GGGMYPPLIPTRVPTPSNGAPEIPARPQVPKRP 837 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 2/93 (2%) Frame = +1 Query: 616 PPXXP--PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P P P PP P PP P P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPA----PAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGA 801 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PP P P P P P Sbjct: 802 PGGGGGMYPPLIPTRVPTPSNGAPEIPARPQVP 834 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXX 915 PPP P P P P PP P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGG 807 Query: 916 PXPPXXPPPXPXXPPPXPXXP 978 PP P P P P Sbjct: 808 MYPPLIPTRVPTPSNGAPEIP 828 Score = 41.5 bits (93), Expect = 9e-04 Identities = 27/89 (30%), Positives = 27/89 (30%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P PP P P PP P PPP P Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPA--PPGGRQAPMPPRGGPGAPPPPGMRPPPG---AP 802 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P Sbjct: 803 GGGGGMYPPLIPTRVPTPSNGAPEIPARP 831 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 834 PPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXX-PXXPPPXPXPPPP 983 PP P P P P P P P P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPP 799 >U97407-6|AAB52481.1| 751|Caenorhabditis elegans Tyrosinase protein 4 protein. Length = 751 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GG G G GG GGG GG G G G GGGG G GG G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GG GG GGG G G G GGG G GGG GGGG G Sbjct: 688 GDNGGWGGNGGGGWGNNDPWG------GSRWGGGRGGWGGGGWGGGGWG 730 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 G GG G GGG G G GG G GGG GG G G Sbjct: 688 GDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 GG G GG G G GG GG GG GGGG G Sbjct: 691 GGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G GG G GG G G G GGG G GGG G G G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWG-GGGWGGGGWG 730 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGG 831 G G G GG G G GG GGG GG GGG GG Sbjct: 681 GWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGG 726 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG G GG G G GG GG G G G GGG Sbjct: 691 GGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGG 727 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 922 GXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G G GG G G GG G GG G G GG G G GG Sbjct: 681 GWGRDDFGDNGGWG-GNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGG 728 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 848 GGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GG GG G GG GGG G GG G G G G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GG G GG G GGG G G G G GGGG G G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -1 Query: 985 GGGGGXGXGG-GXXGXXGGX--GXGXGXXXXGGXGGGGXG 875 GG GG G GG G GG G G G GG GGGG G Sbjct: 691 GGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG-GXGXXGXGXXG 630 GG G GG G GG G G GG G GG G G G G G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 G GG G GG G G G GG GG G G GG G G Sbjct: 688 GDNGGWGGNGG--GGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 34.7 bits (76), Expect = 0.10 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = -1 Query: 985 GGGGGXGXG-GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G G G G GG G G G GGG G G GGG G GGG Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRG---GWGGG-GWGGGG 728 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 901 GGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GG GGGG G GG GGG G G GG G G Sbjct: 694 GGNGGGGWGNNDPWGGSR--WGGGRGGWGGGGWGGGGWG 730 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 958 GGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GG G G G GG G GGG G GGG G G Sbjct: 680 GGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -2 Query: 822 GXGXXGXXGXXXGXGGXXXGGGXXGGG---GXGXXGXGXGXXXGGGGG 688 G G G G GG G GG G G G G G GGG G Sbjct: 683 GRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWG 730 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G GGGG GG G G GG G Sbjct: 681 GWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWG 725 >AF167982-1|AAD50438.1| 838|Caenorhabditis elegans dynamin protein. Length = 838 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 1/93 (1%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPP 837 PPP P P P P P P P P P PP P P PP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGAPG-G 804 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 PP P P P P P P P Sbjct: 805 GGGMYPPLIPTRVPTPSNGAPEIPARPQVPKRP 837 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 2/93 (2%) Frame = +1 Query: 616 PPXXP--PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPX 789 PP P P P P P P P P PP P PP P P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPA----PAPPGGRQAPMPPRGGPGAP--PPPGMRPPPGA 801 Query: 790 XPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 PP P P P P P Sbjct: 802 PGGGGGMYPPLIPTRVPTPSNGAPEIPARPQVP 834 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPPPXXXXXPXX 915 PPP P P P P PP P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGG 807 Query: 916 PXPPXXPPPXPXXPPPXPXXP 978 PP P P P P Sbjct: 808 MYPPLIPTRVPTPSNGAPEIP 828 Score = 41.5 bits (93), Expect = 9e-04 Identities = 27/89 (30%), Positives = 27/89 (30%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P P P P P P P P PP P P PP P PPP P Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPA--PPGGRQAPMPPRGGPGAPPPPGMRPPPG---AP 802 Query: 892 XXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P P P Sbjct: 803 GGGGGMYPPLIPTRVPTPSNGAPEIPARP 831 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 834 PPXXPXPPPXP-PXXPXPPPPXPPXXXXPXPXPXPPXX-PXXPPPXPXPPPP 983 PP P P P P P P P P PP P PPP PPP Sbjct: 748 PPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPP 799 >AF039048-2|AAB94238.1| 85|Caenorhabditis elegans Hypothetical protein F16B4.7 protein. Length = 85 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 884 GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 G G GGG G GGG GG GG GGG GG G G GG G Sbjct: 28 GGGYGGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPGGGGWG 83 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G GGG GG GG GG GG GGG GGG G GG G G Sbjct: 28 GGGYGGGGGDFGG--GGSGGQWGSQSSSFQQSQSSGGFQNNAGGGF--GGGMGPGGGGWG 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -3 Query: 923 GXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG-XXG 747 G G GGG G G GGG GG G GG G G GGG G Sbjct: 21 GYGRPSYGGGYGGGGGDFG--GGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPG 78 Query: 746 GGGXG 732 GGG G Sbjct: 79 GGGWG 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGX 642 G G GG GGGG GGG GG G GG G GGG G G Sbjct: 21 GYGRPSYGGGYGGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPGGG 80 Query: 641 G 639 G Sbjct: 81 G 81 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG GGG G G G G GG GGG G GGG Sbjct: 32 GGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAG--GGFGGGMGPGGGG 81 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG GGG GG GG GG G GG G G G G G GGG Sbjct: 28 GGGYGGG-GGDFGGGGS----GGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPGGG 80 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG---GXGXGGXGXGXGXGGGGGXXXXGXGG 663 G GGG GG GGGG G G GG G G GGG G G Sbjct: 23 GRPSYGGGYGGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPGGGGW 82 Query: 662 G 660 G Sbjct: 83 G 83 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGG-XGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GGG GGGG G GG G G GG G G GG G Sbjct: 21 GYGRPSYGGGYGGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPG 78 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXG-----XGGGXGGGXGGGXGG 831 GG G GGG GGG G G G GGG GGG G G GG Sbjct: 28 GGGYGGGGGDF-GGGGSGGQWGSQSSSFQQSQSSGGFQNNAGGGFGGGMGPGGGG 81 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 922 GXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXGXGG 776 G G GG GGG G GG G G GG GG Sbjct: 21 GYGRPSYGGGYGGGGGDFGGGGSGGQWGSQSSSFQQSQSSGGFQNNAGG 69 >AC024810-3|AAU20831.1| 660|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform c protein. Length = 660 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG GG G G GG GGG GG G G Sbjct: 559 GGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGG 618 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G G GGGG Sbjct: 619 GGFSGPRRGGFNSGMNRQGGGGGG 642 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/94 (31%), Positives = 30/94 (31%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GG G G G GG GGG G Sbjct: 556 GRGGG--GSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTS 613 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G GG G G GGGGG Sbjct: 614 NSGGGGGFSGPRRGGFNSGMNRQG-----GGGGG 642 Score = 39.5 bits (88), Expect = 0.004 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 1/110 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXGX 765 GGG GG G G G GG GG G G G GG GGG Sbjct: 538 GGGQRGGNRRFGATDYRVG-RGGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRR 596 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GGGGG GG G GG GG Sbjct: 597 --PFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS--GMNRQGGGGGG 642 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GGG G G GG G GGG Sbjct: 586 GGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNSGMNRQGGGGGG 642 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G G G GG GGG GG G G Sbjct: 558 GGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGG 617 Query: 805 XGG-XGXGXGG 776 GG G GG Sbjct: 618 GGGFSGPRRGG 628 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG GG G G GGG G GG Sbjct: 573 GGATG-GFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS 631 Query: 800 XGGXXGGGGXG 768 GGGG G Sbjct: 632 GMNRQGGGGGG 642 >AC024810-2|AAK68520.1| 644|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform b protein. Length = 644 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG GG G G GG GGG GG G G Sbjct: 543 GGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGG 602 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G G GGGG Sbjct: 603 GGFSGPRRGGFNSGMNRQGGGGGG 626 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/94 (31%), Positives = 30/94 (31%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GG G G G GG GGG G Sbjct: 540 GRGGG--GSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTS 597 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G GG G G GGGGG Sbjct: 598 NSGGGGGFSGPRRGGFNSGMNRQG-----GGGGG 626 Score = 39.5 bits (88), Expect = 0.004 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 1/110 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXGX 765 GGG GG G G G GG GG G G G GG GGG Sbjct: 522 GGGQRGGNRRFGATDYRVG-RGGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRR 580 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GGGGG GG G GG GG Sbjct: 581 --PFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS--GMNRQGGGGGG 626 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GGG G G GG G GGG Sbjct: 570 GGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNSGMNRQGGGGGG 626 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G G G GG GGG GG G G Sbjct: 542 GGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGG 601 Query: 805 XGG-XGXGXGG 776 GG G GG Sbjct: 602 GGGFSGPRRGG 612 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG GG G G GGG G GG Sbjct: 557 GGATG-GFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS 615 Query: 800 XGGXXGGGGXG 768 GGGG G Sbjct: 616 GMNRQGGGGGG 626 >AC024810-1|AAF60764.1| 641|Caenorhabditis elegans Vasa- and belle-like helicase protein1, isoform a protein. Length = 641 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG GG G G GG GGG GG G G Sbjct: 540 GGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGG 599 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G G GGGG Sbjct: 600 GGFSGPRRGGFNSGMNRQGGGGGG 623 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/94 (31%), Positives = 30/94 (31%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G GG G G G GG GGG G Sbjct: 537 GRGGG--GSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTS 594 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GGG G G GG G G GGGGG Sbjct: 595 NSGGGGGFSGPRRGGFNSGMNRQG-----GGGGG 623 Score = 39.5 bits (88), Expect = 0.004 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 1/110 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXXXGGXXGGGGXGX 765 GGG GG G G G GG GG G G G GG GGG Sbjct: 519 GGGQRGGNRRFGATDYRVG-RGGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRR 577 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG GGGGG GG G GG GG Sbjct: 578 --PFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS--GMNRQGGGGGG 623 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GGG G G GG G GGG Sbjct: 567 GGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNSGMNRQGGGGGG 623 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG G G G GG GGG GG G G Sbjct: 539 GGGGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGG 598 Query: 805 XGG-XGXGXGG 776 GG G GG Sbjct: 599 GGGFSGPRRGG 609 Score = 28.7 bits (61), Expect = 6.7 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG GG G G GGG G GG Sbjct: 554 GGATG-GFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGGGFSGPRRGGFNS 612 Query: 800 XGGXXGGGGXG 768 GGGG G Sbjct: 613 GMNRQGGGGGG 623 >Z34533-2|CAA84296.1| 166|Caenorhabditis elegans Hypothetical protein B0285.3 protein. Length = 166 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G G G G G GG GG G G GGG G Sbjct: 23 GRGRGGGGWKGNDNRGGYRGGSSNDGGWSNFRDDGNLNFASPYQANRGNFRGNYRGGGGG 82 Query: 767 XGGGXXGGGGXGXGGXGXGXGXGGGGG 687 GG G G G G G GGGGG Sbjct: 83 GGGNQNNYGNRGRGRGGFDRGRGGGGG 109 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 G GG GG G G G G GGGG G G Sbjct: 33 GNDNRGGYRGGSSNDGGWSNFRDDGNLNFASPYQANRGNFRGNYRGGGGGGGGNQNNYGN 92 Query: 707 GXGGGGGXXXXGXGGGXGXXGXG 639 G GG GGG G G Sbjct: 93 RGRGRGGFDRGRGGGGGGNKNFG 115 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGG 881 GG G GGG G G G G G GGGG Sbjct: 78 GGGGGGGGNQNNYGNRGRGRGGFDRGRGGGGG 109 Score = 31.5 bits (68), Expect = 0.95 Identities = 23/79 (29%), Positives = 23/79 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G GGG GGG G G Sbjct: 38 GGYRGGSSNDGGWSNFRDDGNLNFASPYQANRGNFRGNYRGGG-GGGGGNQNNYGNRGRG 96 Query: 800 XGGXXGGGGXGXGGGXXGG 744 GG G G G GG G Sbjct: 97 RGGFDRGRGGGGGGNKNFG 115 Score = 28.7 bits (61), Expect = 6.7 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -3 Query: 968 GXGGGXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GG GG G G G G GGG GG G G Sbjct: 39 GYRGGSSNDGGWSNFRDDGNLNFASPYQANRGNFRGNYRGGGGGGGGNQNNYGN---RGR 95 Query: 791 XXGGGGXGXGGGXXGGGGXGXG 726 GG G GGG GGG G Sbjct: 96 GRGGFDRGRGGG--GGGNKNFG 115 >U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical protein F48C1.8 protein. Length = 343 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/85 (37%), Positives = 32/85 (37%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G GG GG GG GG GG GG G G G Sbjct: 25 GGGDHGGHDHGGHDH---GGHDHGGHDHGGWGGHDHHDHHHGG----WGGHDHDHGNGGG 77 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGG 687 GG G G G G GGGGG Sbjct: 78 GGDNGWGYRPFTGFGGRNYYGGGGG 102 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 4/80 (5%) Frame = -3 Query: 890 GGGXGXGGGXGG----GXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GGG GGG GG G GGG GG GGG G GGGG G Sbjct: 173 GGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHG---GGGGFHHHHHSSYSGSSSDYS 229 Query: 722 XGXGXGXGGGGGXXXXGXGG 663 G GGG G GG Sbjct: 230 SNNYYGGGGGFGLGRLLFGG 249 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGX--GGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXG 717 GGG G GG GG GG G G GG G GGG G G G Sbjct: 25 GGGDHGGHDHGGHDHGGHDHGGHDHGGWGGHDHHDHHHGGWGGHDHDHGNGGGGGDNGWG 84 Query: 716 XGXGXGGGGGXXXXGXGGG 660 G GG G GGG Sbjct: 85 YRPFTGFGGRNYYGGGGGG 103 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG GG G G GGG G G GG G GG GG G Sbjct: 173 GGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHGG---GGGFHHHHHSSYSGSSSDYS 229 Query: 761 GGXXGGGGXGXG 726 GGG G G Sbjct: 230 SNNYYGGGGGFG 241 Score = 36.7 bits (81), Expect = 0.025 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXG---GGGXGXXGGXGGGXGXXGGGXXXXG 815 GGG G GGG GG G G G GG G GGG G Sbjct: 173 GGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHGGGGGFHHHHHSSYSGSSSDYSSNN 232 Query: 814 XXGXGGXGXGXG 779 G GG G G G Sbjct: 233 YYG-GGGGFGLG 243 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GG GGG G G G G GGGGG G GG G G Sbjct: 173 GGGHHGGGGGGGSHHHG-GGGGGGGHHHHGGGGHYHGGGGG 212 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -3 Query: 980 GGXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXX 804 GG G G G GG GG G GG GG GG GGG Sbjct: 21 GGDHGGGDHGGHDHGGHDHGGHDHGGHDHGGWGGHDHHDHHHGGWGGHDHDHGNGGGGGD 80 Query: 803 XXGGXXGGGGXGXGGGXXGGGG 738 G G G GGGG Sbjct: 81 NGWGYRPFTGFGGRNYYGGGGG 102 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 749 GGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 GGG G GG G GGGGG GG G G G Sbjct: 173 GGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHGGGGG 212 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 725 GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G GGGG G GGG G G G GG Sbjct: 173 GGGHHGGGGGGGSHHHGGGGGGGGHHHHGGGGHYHGG 209 Score = 31.1 bits (67), Expect = 1.3 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG-GGXGGXXXXG-GGX 807 GG G G G GG GG G GGG G G G G GG Sbjct: 35 GGHDHGGHDHGGHDHGGWGGHDHHDHHHGGWGGHDHDHGNGGGGGDNGWGYRPFTGFGGR 94 Query: 806 XXXGGXXGGGG 774 GG GGGG Sbjct: 95 NYYGG--GGGG 103 >Z95559-15|CAB63361.1| 917|Caenorhabditis elegans Hypothetical protein Y41E3.11 protein. Length = 917 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/101 (29%), Positives = 30/101 (29%), Gaps = 9/101 (8%) Frame = +1 Query: 616 PPXXPPXXPXPXX---PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPP 786 PP P P PPP PPP PP P PPP PPP Sbjct: 812 PPTTTPVQQIPVMMNISQPPPQIMMSIPPPSMMVQHMRQPPVVFPIDVTVPPPNFSAPPP 871 Query: 787 XXPPXXXXPP------PXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP P PP P P PPP Sbjct: 872 MLPASAGIPPHLLMYHHHQMSAPPPPTTTPQQAPQFSYPPP 912 Score = 30.7 bits (66), Expect = 1.7 Identities = 28/114 (24%), Positives = 28/114 (24%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P PPP PP P PPP Sbjct: 806 PIPSVIPPTTTPVQQIPVMMNISQPPPQIMMSIPPPSMMVQHM-RQPPVVFPIDVTVPPP 864 Query: 820 XXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P P PP P P P P PP Sbjct: 865 NFSAPP------PMLPASAGIPPHLLMYHHHQMSAPPPPTTTPQQAPQFSYPPP 912 >Z74042-8|CAA98525.1| 299|Caenorhabditis elegans Hypothetical protein T11F9.9 protein. Length = 299 Score = 43.6 bits (98), Expect = 2e-04 Identities = 37/130 (28%), Positives = 37/130 (28%), Gaps = 13/130 (10%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX--------PPXPX----PPPPXXPP 762 P PP P PP P PP PP P P P P P P P Sbjct: 129 PGRPPQQPCDPITPPPCQPCPQGPPGPPGP-PGPSGDAGSNGNPGSPGQDGQPGAPGNKG 187 Query: 763 PXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP-P 939 P P P P P P P P P P PP P P P P Sbjct: 188 PSGQNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGAPGPQGPPGQPGQPGHDGQPGAPGP 247 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 248 KGPNGNPGQP 257 Score = 43.2 bits (97), Expect = 3e-04 Identities = 38/132 (28%), Positives = 38/132 (28%), Gaps = 12/132 (9%) Frame = +1 Query: 619 PXXPPXXPX-PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P PP P P P P P PP P PP P Sbjct: 107 PAGTPGKPGRPGKPGAPGLP--GNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGPSGD 164 Query: 796 PXXXXPP--PXXXXPPXPPPXPPP-----XPPPXPXPPPXXXXXPXXPXPPXXP----PP 942 P P P P P P P P P P P P Sbjct: 165 AGSNGNPGSPGQDGQPGAPGNKGPSGQNGNPGAPGAPGQPGQDAPSEPITPGAPGPQGAP 224 Query: 943 XPXXPPPXPXXP 978 P PP P P Sbjct: 225 GPQGPPGQPGQP 236 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPP--PXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPP 938 P P P P P P P PP P P PPP P P P PP Sbjct: 107 PAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPP 159 Score = 35.1 bits (77), Expect = 0.077 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPP--PPXXPPXXXXPPPXXXXPPXPP-PXPPPXP 867 P P P P P P P P PP P PPP P PP P PP P Sbjct: 102 PGAAGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPPGP 161 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP-PXPPPXPXPP 888 P P P P P P P P PP P PPP P P PP P P Sbjct: 102 PGAAGPAGTPGKPGRP---GKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGP 158 Query: 889 P 891 P Sbjct: 159 P 159 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P PP P P P P P PP P Sbjct: 102 PGAAGPAGTPGKPGRPGKPGAPGLPGNPGRPPQQPCDPITPPPCQPCPQGPPGPPGPP 159 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/78 (24%), Positives = 19/78 (24%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P P P P P P P PP P P P P P Sbjct: 195 PGAPGAPGQPGQDAPSEPITPGAPGPQGAPGPQGPPGQPGQPGHDGQPGAPGPKGPNGNP 254 Query: 835 PXPPPXPPPXPPPXPXPP 888 P P P P Sbjct: 255 GQPGADGNPGAPGQSGTP 272 >AL032627-8|CAB63354.2| 373|Caenorhabditis elegans Hypothetical protein Y41C4A.5 protein. Length = 373 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/105 (27%), Positives = 29/105 (27%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G G G G G G G Sbjct: 183 GGQLGGGELVVTNPGSVGSGSGNSGNSSNNNNSSG-NSNYGSNNSGSGNGNSNSGNGNSG 241 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 G G G G G G G G G G G G G G G Sbjct: 242 NGNGNNAGNSGNGNG-NSNGNNGNGSNGNGNGNNGNGNNGNNGNG 285 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 4/89 (4%) Frame = -3 Query: 869 GGXGGGXGG-GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 G G G G G G G G G G G G G G G G G Sbjct: 197 GSVGSGSGNSGNSSNNNNSSGNSNYGSNNSGSGNGNSNSGNGNSGNGNGNNAGNSGNGNG 256 Query: 692 ---GGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G G G G G G G Sbjct: 257 NSNGNNGNGSNGNGNGNNGNGNNGNNGNG 285 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/102 (24%), Positives = 25/102 (24%) Frame = -3 Query: 959 GGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 GG G G G G G G G G G G Sbjct: 183 GGQLGGGELVVTNPGSVGSGSGNSGNSSNNNNSSGNSNYGSNNSGSGNGNSNSGNGNSGN 242 Query: 779 GGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G G G G G G G G G G G Sbjct: 243 GNGNNAGNSGNGNGNSNGNNGNG-SNGNGNGNNGNGNNGNNG 283 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/104 (25%), Positives = 27/104 (25%), Gaps = 3/104 (2%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGG---GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGX 771 GG GG G G G G G G G G G G Sbjct: 183 GGQLGGGELVVTNPGSVGSGSGNSGNSSNNNNSSGNSNYGSNNSGSGNGNSNSGNGNSGN 242 Query: 770 GXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G G G G G G G G G G G G Sbjct: 243 G-NGNNAGNSGNGNGNSNGNNGNGSNGNGNGNNGNGNNGNNGNG 285 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G G G G G G G G G G G G G G G Sbjct: 222 GSNNSGSGNGNSNSGNGNSGNGNGNNAGNSGNGNGNSNGNNGNGSNGNGNGNNGNGNNGN 281 Query: 802 GGXG 791 G G Sbjct: 282 NGNG 285 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPP-PXXPPXXXXPPP 819 P P P PP PP P PP P PP PP Sbjct: 287 PQYPYPVPPHGYYPPGYPYPPGYPYPPPGAFYYPP 321 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP P P PP P PP PP Sbjct: 287 PQYPYPVPPHGYYPPGYPYPPGYPYPPPGAFYYPP 321 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPP 860 P P P PP P PP P PPP Sbjct: 287 PQYPYPVPPHGYYPPGYPYPPGYPYPPP 314 >Z68003-3|CAA91977.1| 849|Caenorhabditis elegans Hypothetical protein E02H4.4 protein. Length = 849 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXG 711 GGG G G GG G GG GG G G GGGG G G Sbjct: 720 GGGESVVPGGCGSSEGGGGESVVPGGRGSLEGGGGESVVPGGRGSAEGGGGASVVPDGRG 779 Query: 710 XGXGGGGGXXXXGXGGGXGXXGXG 639 GGGG G G G G G Sbjct: 780 SSDGGGGESVVPG-GRGSSDGGGG 802 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G G GG GG G GGG G G GG G G Sbjct: 720 GGGESVVPGGCGSSEGGGGESVVPGGRGSLEGGGGESVVPGGRGSAEGGGGASVVPDGRG 779 Query: 761 GGXXGGGGXGXGGXGXGXGXGGGG 690 GGGG G G GGGG Sbjct: 780 SS-DGGGGESVVPGGRGSSDGGGG 802 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 1/83 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXX 786 GGG GG G G GG G GGG GG G GG G Sbjct: 720 GGGESVVPGGCGSSEGGGGESVVPGGRGSLEGGGGESVVPGGRGSAEGGGGASVVPDGRG 779 Query: 785 GGGGXGXGGGXXGGGGXGXGGXG 717 G G GG G GG G Sbjct: 780 SSDGGGGESVVPGGRGSSDGGGG 802 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGG GG GG G G GGG G G GGG G Sbjct: 735 GGGGESVVPGGRGSLEGGGGESVVPGGRGSAEGGGGASVVPDGRGSSDGGGGESV--VPG 792 Query: 805 XGGXGXGXGG 776 G G GG Sbjct: 793 GRGSSDGGGG 802 Score = 31.5 bits (68), Expect = 0.95 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG-GXGXGGXGXGXGXGGGGGX 684 G GG G G GG G G GGG GG G G GGG Sbjct: 715 GPSVPGGGESVVPGGCGSSEGGGGESVVPGGRGSLEGGGGESVVPGGRGSAEG-GGGASV 773 Query: 683 XXXGXGGGXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 774 VPDGRGSSDGGGGESVVPGGRG 795 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGG GG GG G G GGG G GG GGG G Sbjct: 720 GGGESVVPGGCGSSEGGGGESVVPGGRGSLEGGG-GESVVPGGRGSAEGGGGASVVPDGR 778 Query: 802 GGXGXGXG 779 G G G Sbjct: 779 GSSDGGGG 786 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 13/91 (14%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPP--PPXXPPPX-----------PXPPPP 786 P P P P P P P PP PP PP P PPP Sbjct: 60 PTLPTLAPQQFQTLAPFTLAPLPGSPPGMAGPPLLPPAVAPPTNGQETLVGINNPVQPPP 119 Query: 787 XXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P P P PPP PPP PPP P Sbjct: 120 --PVQYQNQGPQYIEAPPPPPSPPPPPPPPP 148 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 691 PPPPXPXPXPXPPX-PXPPPPXXPPPXPXPPPP 786 PPPP P PPPP PPP P PPPP Sbjct: 117 PPPPVQYQNQGPQYIEAPPPPPSPPPPPPPPPP 149 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 2/75 (2%) Frame = +1 Query: 763 PXPXPPPPXXPPXXXXPP--PXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXP 936 P P P PP PP P PP PPP P P Sbjct: 75 PFTLAPLPGSPPGMAGPPLLPPAVAPPTNGQETLVGINNPVQPPPPVQYQNQGPQYIEAP 134 Query: 937 PPXPXXPPPXPXXPP 981 PP P PPP P PP Sbjct: 135 PPPPSPPPPPPPPPP 149 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 11/76 (14%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPX-----------PPPPXPPXXXXPXPXPX 932 P P P P PP P P PP PPPP P Sbjct: 75 PFTLAPLPGSPPGMAGPPLLP-PAVAPPTNGQETLVGINNPVQPPPPVQYQNQGPQYIEA 133 Query: 933 PPXXPXXPPPXPXPPP 980 PP P PPP P PPP Sbjct: 134 PPPPPSPPPPPPPPPP 149 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P P P PP PP PP PP P PP P P Sbjct: 75 PFTLAPLPGSPPGMAGPPLL--PPAVAPPTNGQETLVGINNPVQPPPPVQYQNQGPQYIE 132 Query: 892 XXXXXPXXPXPPXXPPP 942 P P PP PPP Sbjct: 133 APPPPPSPPPPPPPPPP 149 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPP 762 P PP P P P PP P PPPP PP Sbjct: 114 PVQPPPPVQYQNQGPQYIEAPPPPPSPPPPPPPPPP 149 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P PPP P P PPPP P P P P Sbjct: 114 PVQPPPPVQYQNQGPQYIEAPPPPPSPPPPPPPPPPQLQQQQVQLPLQDATTLRPSTLP 172 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXP 735 P P P P PPPP P P PP P Sbjct: 114 PVQPPPPVQYQNQGPQYIEAPPPPPSPPPPPPPPP 148 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 627 PXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXP 728 P PP P P PPPP PP P Sbjct: 114 PVQPPPPVQYQNQGPQYIEAPPPPPSPPPPPPPP 147 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 P PP P P PPP P P P P PP Sbjct: 114 PVQPPP-PVQYQNQGPQYIEAPPPPPSPPPPPPPPPP 149 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXP 708 PP P PP P PPPPP P Sbjct: 118 PPPVQYQNQGPQYIEAPPPPPSPPPPPPPPP 148 >AL132898-20|CAC14415.2| 243|Caenorhabditis elegans Hypothetical protein Y59A8B.19 protein. Length = 243 Score = 43.2 bits (97), Expect = 3e-04 Identities = 37/123 (30%), Positives = 37/123 (30%), Gaps = 2/123 (1%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXX--GXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGX 807 GG G G G G G G G GG G GG G GG GG Sbjct: 76 GGATGSLGAVTGVVDGVTGTVGDLTGGLGGATGGATGALGGLTGTVGGLTNALEGATGGL 135 Query: 806 XXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGG 627 G GG G GG GG G G G GGG G G G Sbjct: 136 GGLSGILGGAAGGATGG-LGGITGNVGQVAVTNLSGSSLGGLTGILGGGTGAEATGGLGA 194 Query: 626 XXG 618 G Sbjct: 195 VTG 197 Score = 31.9 bits (69), Expect = 0.72 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = -3 Query: 860 GGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXX 681 GG GG G G G G G GG G G G G G Sbjct: 72 GGVAGGATGSLGAVTGVVDGVTGTVGDLTGGLGGATGGATGALGGLTGTVGGLTNALEGA 131 Query: 680 XXGXGGGXGXXGXGXXGGXXGG 615 G GG G G G GG GG Sbjct: 132 TGGLGGLSGILG-GAAGGATGG 152 >U55366-2|AAA97981.1| 156|Caenorhabditis elegans Hypothetical protein F41F3.3 protein. Length = 156 Score = 42.7 bits (96), Expect = 4e-04 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 13/90 (14%) Frame = -3 Query: 890 GGGXGX----GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGG--------GXGXGGGXXG 747 GGG G GGG GGG GG GGG G G GG G Sbjct: 61 GGGGGCCPPPAPACGGGCGGGVAPAPIGGGYAQAPQAPIGGGYAAPQAPIGGGYGGAPIG 120 Query: 746 GGG-XGXGGXGXGXGXGGGGGXXXXGXGGG 660 GG G G G G GGG G GG Sbjct: 121 GGSYAGAGPIGGGAPIGGGAGYAGAAPAGG 150 Score = 36.7 bits (81), Expect = 0.025 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGX-GGGXGGGXGGXXXXGGGXXXXGGXX 786 GG G GG GGG GGG GG G G GG Sbjct: 76 GGCGGGVAPAPIGGGYAQAPQAPIGGGYAAPQAPIGGGYGGAPIGGGSYAGAGPIGGGAP 135 Query: 785 GGGGXGXGGGXXGGG 741 GGG G G GG Sbjct: 136 IGGGAGYAGAAPAGG 150 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/93 (27%), Positives = 26/93 (27%), Gaps = 2/93 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXG--GGXGGGXGGGXGGXXXXGGGXXXXG 795 G GG GG G GGG GGG GG G Sbjct: 62 GGGGCCPPPAPACGGGCGGGVAPAPIGGGYAQAPQAPIGGGYAAPQAPIGGGYGGAPIGG 121 Query: 794 GXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 G G G GG GGG G G G Sbjct: 122 GSYAGAGPIGGGAPIGGGAGYAGAAPAGGAYAG 154 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGG G GG G G G GGG GG G GG Sbjct: 100 GGGYAAPQAPIGGGYGGAPIGGGSYAGAGPIGGGAPIGGGAGYAGAAPAGG 150 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 961 GGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GGG G G G G GGG G GG GGG G GG G Sbjct: 100 GGGYAAPQAPIGGGYG----GAPIGGGSYAGAGPIGGGAPIGGGAGYAGAAPAGGAYAG 154 >L25598-5|AAM15550.1| 113|Caenorhabditis elegans Calpain family protein 1, isoform c protein. Length = 113 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 845 GGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GG GG G GG GGGG G GGG GG G GG Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGG 76 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 G GG GG GGG G GGG GGG GGG GG GGG Sbjct: 37 GAGGDILGGLASN---FFGGGGGGGGGGGGGGFGGGNGG---FGGG 76 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GG GG GG GG G G G GG GGG G GG Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGG 76 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 866 GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXG 699 G G G G G GG G GGG GGGG G GG G G G Sbjct: 21 GLIGSIAGNLIRDKVGGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGG 690 GGG GGGG G GG G G G GGG Sbjct: 52 GGGGGGGGGGGGGGFGGGNGGFGGG 76 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 785 GGGGXGXGG--GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G GG GG GGG G GG G G G GGG G G GGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNG----GFGGG 76 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G GG GGG GG GGGG G G G GGG Sbjct: 36 GGAGGDILGGLASNFFGGGGGG---GGGGGGGGFGGGNGGFGGG 76 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 749 GGGGXGXGGXGX---GXGXGGGGGXXXXGXGGGXGXXGXG 639 G GG GG G G GGGGG G GGG G G G Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGG 76 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 G G GG GG GG GG GG GGG G GGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGGG-----GGGFGGGNGGFGGG 76 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 892 GGGGXGXXGGXGGGXGXXGGGXXXXGXXGXGG 797 GG GG GGG G GGG G G GG Sbjct: 44 GGLASNFFGGGGGGGGGGGGGGFGGGNGGFGG 75 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 892 GGGGXGXXGGXGGG-XGXXGGGXXXXGXXGXGGXGXGXGG 776 GG G GG G GGG G G GG G GG Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGG 75 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -1 Query: 901 GGXGG---GGXGXXGGXGGGXGXXGGGXXXXGXXGXGGXGXG 785 GG GG GG GGG G GGG G G GG G G Sbjct: 36 GGAGGDILGGLASNFFGGGGGGGGGGGGGGFG-GGNGGFGGG 76 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 807 GXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGGGGG 688 G G G GG GGGG G G G G GGG Sbjct: 37 GAGGDILGGLASNFFGGGGGGGGGGGGGGFGGGNGGFGGG 76 >AF068708-5|AAK68200.1| 628|Caenorhabditis elegans P granule abnormality protein 3,isoform b protein. Length = 628 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 2/73 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXG-XGXG 699 G G GGG GG GG GG G GG G G G GG G G G G G Sbjct: 558 GTSGRGSYGGGRGGDR---GGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQ 614 Query: 698 GGGGXXXXGXGGG 660 GG G GG Sbjct: 615 GGRAGFFGGSRGG 627 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 6/67 (8%) Frame = -3 Query: 962 GGGXXGXG-GGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGG----GXGGXXXXGGGXXX 801 G G G G GG GG G G GG G G G GG GG G G GG Sbjct: 561 GRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQGGRAGF 620 Query: 800 XGGXXGG 780 GG GG Sbjct: 621 FGGSRGG 627 Score = 36.3 bits (80), Expect = 0.033 Identities = 28/92 (30%), Positives = 28/92 (30%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G GGG G G GG G GG GG G Sbjct: 540 GFGAAPVASGFGQFASSNGTSGRGSYGGGRG---GDRGGR-GAYGGDRGRGGSGDGSRGY 595 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G G G G G GG Sbjct: 596 RGGDRGGRGSYGEGSRGYQGGRAGFFGGSRGG 627 Score = 35.1 bits (77), Expect = 0.077 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 4/77 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG---XGGGXGGXXXXG-GG 810 G G G G G G G GG G GG G GG GG G G Sbjct: 551 GQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGS 610 Query: 809 XXXXGGXXGGGGXGXGG 759 GG G G GG Sbjct: 611 RGYQGGRAGFFGGSRGG 627 Score = 33.1 bits (72), Expect = 0.31 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGX-GGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXG-G 663 G G G G G GGG G GG G G G G G G G G Sbjct: 542 GAAPVASGFGQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRG 601 Query: 662 GXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 602 GRGSYGEGSRGYQGG 616 >AF068708-4|AAC17755.1| 693|Caenorhabditis elegans P granule abnormality protein 3,isoform a protein. Length = 693 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 2/73 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXG-XGXG 699 G G GGG GG GG GG G GG G G G GG G G G G G Sbjct: 623 GTSGRGSYGGGRGGDR---GGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQ 679 Query: 698 GGGGXXXXGXGGG 660 GG G GG Sbjct: 680 GGRAGFFGGSRGG 692 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 6/67 (8%) Frame = -3 Query: 962 GGGXXGXG-GGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGG----GXGGXXXXGGGXXX 801 G G G G GG GG G G GG G G G GG GG G G GG Sbjct: 626 GRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQGGRAGF 685 Query: 800 XGGXXGG 780 GG GG Sbjct: 686 FGGSRGG 692 Score = 36.3 bits (80), Expect = 0.033 Identities = 28/92 (30%), Positives = 28/92 (30%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G GGG G G GG G GG GG G Sbjct: 605 GFGAAPVASGFGQFASSNGTSGRGSYGGGRG---GDRGGR-GAYGGDRGRGGSGDGSRGY 660 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G G G G G GG Sbjct: 661 RGGDRGGRGSYGEGSRGYQGGRAGFFGGSRGG 692 Score = 35.1 bits (77), Expect = 0.077 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 4/77 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG---XGGGXGGXXXXG-GG 810 G G G G G G G GG G GG G GG GG G G Sbjct: 616 GQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGS 675 Query: 809 XXXXGGXXGGGGXGXGG 759 GG G G GG Sbjct: 676 RGYQGGRAGFFGGSRGG 692 Score = 33.1 bits (72), Expect = 0.31 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGX-GGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXG-G 663 G G G G G GGG G GG G G G G G G G G Sbjct: 607 GAAPVASGFGQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRG 666 Query: 662 GXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 667 GRGSYGEGSRGYQGG 681 >AF039048-6|AAB94235.1| 91|Caenorhabditis elegans Hypothetical protein F16B4.4 protein. Length = 91 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGX 708 GG G G G GG G GG GG GG G GG GGG GG Sbjct: 20 GGYGRPAGGYGPPSGGYGAP----GGYNNQGGFDGGSQFGGDGGFQQGGGFQQGGQFQQG 75 Query: 707 GXGGGGG 687 G GGG Sbjct: 76 GFNQGGG 82 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G GG G G GG G G GG GG G GG GG Sbjct: 20 GGYGRPAGGYGPPSGGYGAPGGYNNQGGFDG--GSQFGGDGGFQQGGGFQQGGQFQQGGF 77 Query: 788 XGGGGXGXGGGXXG 747 GGG G G G Sbjct: 78 NQGGGFDQGQGFQG 91 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = -3 Query: 908 GXXXXXGGGXGXGGGXGGGXGG-GXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXG 732 G GG G G G GG G G GG GGG GG GG Sbjct: 20 GGYGRPAGGYGPPSGGYGAPGGYNNQGGFDGGSQFGGDGGFQQGGGFQQGGQFQQGGFNQ 79 Query: 731 XGGXGXGXGXGG 696 GG G G G Sbjct: 80 GGGFDQGQGFQG 91 >AB120729-1|BAC87886.1| 693|Caenorhabditis elegans PGL-3 protein. Length = 693 Score = 42.7 bits (96), Expect = 4e-04 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 2/73 (2%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGGXGXGGXGXG-XGXG 699 G G GGG GG GG GG G GG G G G GG G G G G G Sbjct: 623 GTSGRGSYGGGRGGDR---GGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQ 679 Query: 698 GGGGXXXXGXGGG 660 GG G GG Sbjct: 680 GGRAGFFGGSRGG 692 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 6/67 (8%) Frame = -3 Query: 962 GGGXXGXG-GGXXGGXGXXGXXXXXGG-GXGXGGGXGGGXGG----GXGGXXXXGGGXXX 801 G G G G GG GG G G GG G G G GG GG G G GG Sbjct: 626 GRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGSRGYQGGRAGF 685 Query: 800 XGGXXGG 780 GG GG Sbjct: 686 FGGSRGG 692 Score = 36.3 bits (80), Expect = 0.033 Identities = 28/92 (30%), Positives = 28/92 (30%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G G G G GGG G G GG G GG GG G Sbjct: 605 GFGAAPVASGFGQFASSNGTSGRGSYGGGRG---GDRGGR-GAYGGDRGRGGSGDGSRGY 660 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G G G G G GG Sbjct: 661 RGGDRGGRGSYGEGSRGYQGGRAGFFGGSRGG 692 Score = 35.1 bits (77), Expect = 0.077 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 4/77 (5%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGG---XGGGXGGXXXXG-GG 810 G G G G G G G GG G GG G GG GG G G Sbjct: 616 GQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRGGRGSYGEGS 675 Query: 809 XXXXGGXXGGGGXGXGG 759 GG G G GG Sbjct: 676 RGYQGGRAGFFGGSRGG 692 Score = 33.1 bits (72), Expect = 0.31 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 3/75 (4%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGX-GGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXG-G 663 G G G G G GGG G GG G G G G G G G G Sbjct: 607 GAAPVASGFGQFASSNGTSGRGSYGGGRGGDRGGRGAYGGDRGRGGSGDGSRGYRGGDRG 666 Query: 662 GXGXXGXGXXGGXXG 618 G G G G G G Sbjct: 667 GRGSYGEGSRGYQGG 681 >Z99279-6|CAB16498.1| 640|Caenorhabditis elegans Hypothetical protein Y57G11A.2 protein. Length = 640 Score = 42.3 bits (95), Expect = 5e-04 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 1/107 (0%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P P P P P P P Sbjct: 474 PMPEQTDEVPGPWE--PVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGP 531 Query: 820 XXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P PP P P P P P P Sbjct: 532 EDTTPGPAVTEEIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/103 (29%), Positives = 30/103 (29%), Gaps = 13/103 (12%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX------PXPXPXPPXPXP-PPPXXPPPXPXP 777 P P P P P P P P P P P P P P P P P Sbjct: 476 PEQTDEVPGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTT 535 Query: 778 PPPXXPPXXXXPPPXXXXPPXPP------PXPPPXPPPXPXPP 888 P P P PP P P P P P P P P Sbjct: 536 PGPAVTEEIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P Sbjct: 483 PGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTTPGPAVTE 542 Query: 919 XPPXXPPPXPXXPPP 963 P P P P P Sbjct: 543 EIPEVPEPTEEPPTP 557 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/96 (21%), Positives = 21/96 (21%) Frame = +3 Query: 669 PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXP 848 P P P P P P P P P P Sbjct: 483 PGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTTPGPAVTE 542 Query: 849 XPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P P P P P P Sbjct: 543 EIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 >Z82284-8|CAB05294.1| 640|Caenorhabditis elegans Hypothetical protein Y57G11A.2 protein. Length = 640 Score = 42.3 bits (95), Expect = 5e-04 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 1/107 (0%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P P P P P P P Sbjct: 474 PMPEQTDEVPGPWE--PVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGP 531 Query: 820 XXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXP 957 P P P P P PP P P P P P P Sbjct: 532 EDTTPGPAVTEEIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/103 (29%), Positives = 30/103 (29%), Gaps = 13/103 (12%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPX------PXPXPXPPXPXP-PPPXXPPPXPXP 777 P P P P P P P P P P P P P P P P P Sbjct: 476 PEQTDEVPGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTT 535 Query: 778 PPPXXPPXXXXPPPXXXXPPXPP------PXPPPXPPPXPXPP 888 P P P PP P P P P P P P P Sbjct: 536 PGPAVTEEIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 Score = 31.5 bits (68), Expect = 0.95 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP-PPXPXPPPXXXXXPXXP 918 P P P P P P P P P P P P P P P Sbjct: 483 PGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTTPGPAVTE 542 Query: 919 XPPXXPPPXPXXPPP 963 P P P P P Sbjct: 543 EIPEVPEPTEEPPTP 557 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/96 (21%), Positives = 21/96 (21%) Frame = +3 Query: 669 PXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXP 848 P P P P P P P P P P Sbjct: 483 PGPWEPVPSPVPEPEDPVPRPELATTTEGLPVQEPEDPNPIPEDTVPGPEDTTPGPAVTE 542 Query: 849 XPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P PP P P P P P P P Sbjct: 543 EIPEVPEPTEEPPTPTDSEIDSPTPAPAPGPEPESP 578 >AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical protein Y59A8B.1a protein. Length = 1641 Score = 42.3 bits (95), Expect = 5e-04 Identities = 31/110 (28%), Positives = 31/110 (28%), Gaps = 10/110 (9%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXP-------PPXPXPPPPXXPP 798 P P P PPPP P P P P P PP P PPP P Sbjct: 129 PGPSQHPATPSYYIQHPPPPSMSNGAPYYPHMNPSPYYQPRPNYVTQPPAPIIPPPQPPV 188 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP---XXXXXPXXPXPPXXPP 939 PPP P P P P P PP PP Sbjct: 189 MTASAAAAAYRDRLPPPPPKPPMPDLRTKEPIGIRSWNGSGIPPPPILPP 238 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPP-PXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXX 953 PP P P P P P P P P PPP PP Sbjct: 145 PPPPSMSNGAPYYPHMNPSPYYQPRPNYVTQPPAPIIPPPQPPVMTASAAAAA--YRDRL 202 Query: 954 PPPXPXPPPP 983 PPP P PP P Sbjct: 203 PPPPPKPPMP 212 Score = 32.7 bits (71), Expect = 0.41 Identities = 28/104 (26%), Positives = 28/104 (26%), Gaps = 13/104 (12%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPP--- 858 P P P PP P P P P P PP PP PP Sbjct: 135 PATPSYYIQHPPPPSMSNGAPYYPHMNPSPYYQPRPNYVTQPPAPIIPPPQPPVMTASAA 194 Query: 859 --------PXPPPXPXPPPXXXXXP--XXPXPPXXPPPXPXXPP 960 P PPP P P P PP P PP Sbjct: 195 AAAYRDRLPPPPPKPPMPDLRTKEPIGIRSWNGSGIPPPPILPP 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP-PXPPPXPPPXPPPXPXPPPXXXXXPXXP 918 PPP PPP P PP P P P P P PP Sbjct: 273 PPPPVPPPAKKPLNMDVRELLNGAHQTTVESVKKDPPAPQPRPRPIPVPPTTSYNSSFCG 332 Query: 919 XPPXXPPPXP 948 P PPP P Sbjct: 333 LLP--PPPVP 340 Score = 30.7 bits (66), Expect = 1.7 Identities = 33/133 (24%), Positives = 33/133 (24%), Gaps = 12/133 (9%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPX-------PXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX 774 PP PP P P P P P P P P P P P Sbjct: 80 PPLPPPDEPVKQQQQQQPIVAPYSYYPTYGSSTGYPYPYPTMMMPQQGIPGPSQHPATPS 139 Query: 775 -----PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 PPPP P P P PP P PP P Sbjct: 140 YYIQHPPPPSMSNGAPYYPHMNPSPYYQPRPNYVTQPPAPIIPP--PQPPVMTASAAAAA 197 Query: 940 PXPXXPPPXPXXP 978 PPP P P Sbjct: 198 YRDRLPPPPPKPP 210 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPP 786 P PP PPP PPP P P Sbjct: 784 PPPPRASEPPPPPPPPVATAPVP 806 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 PPP P PPP PP P P Sbjct: 784 PPPPRASEPPPPPPPPVATAPVP 806 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 855 PPXPPXXPXPPPPXPPXXXXPXP 923 PP P PPPP PP P P Sbjct: 784 PPPPRASEPPPPPPPPVATAPVP 806 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXP 735 PP P PPPPP P P P P Sbjct: 784 PPPPRASEPPPPP-PPPVATAPVP 806 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/86 (23%), Positives = 20/86 (23%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P P P P Sbjct: 566 PPPEPLRNELPKHSDLLNVSKPSEPAEPPKPSDAPREPEVAAAEAVIPEPSPAVSVEEPP 625 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP PP P P Sbjct: 626 RREERAASMAGIPPPPPTSSRHSPVP 651 >AF026205-6|AAM69068.1| 908|Caenorhabditis elegans Hypothetical protein T23E7.2e protein. Length = 908 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP P P PP P P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 826 XXPPXPPPXPPPXPPPXP 879 PP P P PP P Sbjct: 356 SVPPTPKSAVPSEAPPTP 373 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P PP P P PP P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 356 SVPPTPKSAVP-SEAPPTPRSAAPSDVPPTP 385 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +1 Query: 664 PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPP 837 PP P P PP P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKS--AAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPS 367 Query: 838 XPPPXPPPXPPPXPXPPP 891 PP P P P P Sbjct: 368 EAPPTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 796 PXXXXPPPXXXXPPXPPPXP 855 P P P P PP P Sbjct: 370 P----PTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PP P P PP P P P P P P Sbjct: 311 PTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEAP 370 Query: 835 PXPPPXPPPXPPPXP 879 P P P PP P Sbjct: 371 PTPRSAAPSDVPPTP 385 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKT-PRTPRTPKTPRTPKTPAVVEPEPEPVAEE 503 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEP 526 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPE 523 Query: 817 PXXXXPPXPPPXPPP 861 P P P Sbjct: 524 AEPAVEEEPAEEPEP 538 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 466 PKTPKTPKTPRTPRTPKTP--RTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEP 522 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 1/93 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEE- 503 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEPAVEEEPAEEP 536 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXP--PXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P P P Sbjct: 453 PATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEP 512 Query: 969 XPPP 980 P P Sbjct: 513 EPEP 516 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/114 (20%), Positives = 23/114 (20%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 472 PKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPEAEPAVEEE 531 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P PP P PP Sbjct: 532 PAEEPEPAADETATEPTAEEAEPEAVEESIEKTEVVEEESAPPAARQSSPSPPP 585 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP 504 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 505 EPVAEPEPEP 514 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P PP P P P P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 972 PPPP 983 PP P Sbjct: 370 PPTP 373 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/76 (26%), Positives = 20/76 (26%), Gaps = 1/76 (1%) Frame = +1 Query: 667 PXPXXXXPPPPP-XPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP-EPVAEPEPEPEPVAEAEP 522 Query: 844 PPXPPPXPPPXPXPPP 891 P P P P Sbjct: 523 EAEPAVEEEPAEEPEP 538 >AF026205-5|AAB71258.1| 880|Caenorhabditis elegans Hypothetical protein T23E7.2b protein. Length = 880 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP P P PP P P PP P P P Sbjct: 246 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 305 Query: 826 XXPPXPPPXPPPXPPPXP 879 PP P P PP P Sbjct: 306 SVPPTPKSAVPSEAPPTP 323 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P PP P P PP P PP P P P Sbjct: 246 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 305 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 306 SVPPTPKSAVP-SEAPPTPRSAAPSDVPPTP 335 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +1 Query: 664 PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPP 837 PP P P PP P P PP P P P P PP P P Sbjct: 260 PPTPKSAAPSEVPPTPKS--AAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPS 317 Query: 838 XPPPXPPPXPPPXPXPPP 891 PP P P P P Sbjct: 318 EAPPTPRSAAPSDVPPTP 335 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P PP P P Sbjct: 260 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 319 Query: 796 PXXXXPPPXXXXPPXPPPXP 855 P P P P PP P Sbjct: 320 P----PTPRSAAPSDVPPTP 335 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PP P P PP P P P P P P Sbjct: 261 PTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEAP 320 Query: 835 PXPPPXPPPXPPPXP 879 P P P PP P Sbjct: 321 PTPRSAAPSDVPPTP 335 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P Sbjct: 395 PATPRSSVPATPTESNLTTPAPKTPKTPKT-PRTPRTPKTPRTPKTPAVVEPEPEPVAEE 453 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P Sbjct: 454 PEPVAEPEPEPEPVAEAEPEAEP 476 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P P P Sbjct: 414 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPE 473 Query: 817 PXXXXPPXPPPXPPP 861 P P P Sbjct: 474 AEPAVEEEPAEEPEP 488 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 416 PKTPKTPKTPRTPRTPKTP--RTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEP 472 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 1/93 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P P P P P P Sbjct: 395 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEE- 453 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P Sbjct: 454 PEPVAEPEPEPEPVAEAEPEAEPAVEEEPAEEP 486 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXP--PXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P P P Sbjct: 403 PATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEP 462 Query: 969 XPPP 980 P P Sbjct: 463 EPEP 466 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/114 (20%), Positives = 23/114 (20%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 422 PKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPEAEPAVEEE 481 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P PP P PP Sbjct: 482 PAEEPEPAADETATEPTAEEAEPEAVEESIEKTEVVEEESAPPAARQSSPSPPP 535 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P P Sbjct: 395 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP 454 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 455 EPVAEPEPEP 464 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P PP P P P P P Sbjct: 260 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 319 Query: 972 PPPP 983 PP P Sbjct: 320 PPTP 323 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/76 (26%), Positives = 20/76 (26%), Gaps = 1/76 (1%) Frame = +1 Query: 667 PXPXXXXPPPPP-XPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P P P P P P P P Sbjct: 414 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP-EPVAEPEPEPEPVAEAEP 472 Query: 844 PPXPPPXPPPXPXPPP 891 P P P P Sbjct: 473 EAEPAVEEEPAEEPEP 488 >AF026205-4|AAD47129.1| 885|Caenorhabditis elegans Hypothetical protein T23E7.2c protein. Length = 885 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP P P PP P P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 826 XXPPXPPPXPPPXPPPXP 879 PP P P PP P Sbjct: 356 SVPPTPKSAVPSEAPPTP 373 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P PP P P PP P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 356 SVPPTPKSAVP-SEAPPTPRSAAPSDVPPTP 385 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +1 Query: 664 PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPP 837 PP P P PP P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKS--AAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPS 367 Query: 838 XPPPXPPPXPPPXPXPPP 891 PP P P P P Sbjct: 368 EAPPTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 796 PXXXXPPPXXXXPPXPPPXP 855 P P P P PP P Sbjct: 370 P----PTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PP P P PP P P P P P P Sbjct: 311 PTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEAP 370 Query: 835 PXPPPXPPPXPPPXP 879 P P P PP P Sbjct: 371 PTPRSAAPSDVPPTP 385 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKT-PRTPRTPKTPRTPKTPAVVEPEPEPVAEE 503 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEP 526 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPE 523 Query: 817 PXXXXPPXPPPXPPP 861 P P P Sbjct: 524 AEPAVEEEPAEEPEP 538 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 466 PKTPKTPKTPRTPRTPKTP--RTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEP 522 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 1/93 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEE- 503 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEPAVEEEPAEEP 536 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXP--PXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P P P Sbjct: 453 PATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEP 512 Query: 969 XPPP 980 P P Sbjct: 513 EPEP 516 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/114 (20%), Positives = 23/114 (20%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 472 PKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPEAEPAVEEE 531 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P PP P PP Sbjct: 532 PAEEPEPAADETATEPTAEEAEPEAVEESIEKTEVVEEESAPPAARQSSPSPPP 585 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP 504 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 505 EPVAEPEPEP 514 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P PP P P P P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 972 PPPP 983 PP P Sbjct: 370 PPTP 373 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/76 (26%), Positives = 20/76 (26%), Gaps = 1/76 (1%) Frame = +1 Query: 667 PXPXXXXPPPPP-XPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP-EPVAEPEPEPEPVAEAEP 522 Query: 844 PPXPPPXPPPXPXPPP 891 P P P P Sbjct: 523 EAEPAVEEEPAEEPEP 538 >AF026205-3|AAB71257.1| 930|Caenorhabditis elegans Hypothetical protein T23E7.2a protein. Length = 930 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXX 825 P P PP P P PP P P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 826 XXPPXPPPXPPPXPPPXP 879 PP P P PP P Sbjct: 356 SVPPTPKSAVPSEAPPTP 373 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPX 876 PP P PP P P PP P PP P P P Sbjct: 296 PPTPKTAASEKQSVPPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQS 355 Query: 877 PXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PP P PP P PP P Sbjct: 356 SVPPTPKSAVP-SEAPPTPRSAAPSDVPPTP 385 Score = 35.9 bits (79), Expect = 0.044 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 2/78 (2%) Frame = +1 Query: 664 PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPP-PXXXXPP 837 PP P P PP P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKS--AAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPS 367 Query: 838 XPPPXPPPXPPPXPXPPP 891 PP P P P P Sbjct: 368 EAPPTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P PP P P P P PP P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 796 PXXXXPPPXXXXPPXPPPXP 855 P P P P PP P Sbjct: 370 P----PTPRSAAPSDVPPTP 385 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P P PP P P PP P P P P P P Sbjct: 311 PTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEAP 370 Query: 835 PXPPPXPPPXPPPXP 879 P P P PP P Sbjct: 371 PTPRSAAPSDVPPTP 385 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +1 Query: 631 PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXX 810 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKT-PRTPRTPKTPRTPKTPAVVEPEPEPVAEE 503 Query: 811 PPPXXXXPPXPPPXPPPXPPPXP 879 P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEP 526 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 1/75 (1%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPP-PXXPPPXPXPPPPXXPPXXXXPP 816 P P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPE 523 Query: 817 PXXXXPPXPPPXPPP 861 P P P Sbjct: 524 AEPAVEEEPAEEPEP 538 Score = 32.3 bits (70), Expect = 0.54 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 P P P P P P P P P P P P P P P P P P Sbjct: 466 PKTPKTPKTPRTPRTPKTP--RTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEP 522 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 1/93 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPX-PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEE- 503 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P Sbjct: 504 PEPVAEPEPEPEPVAEAEPEAEPAVEEEPAEEP 536 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXP--PXXPXPP-PPXPPXXXXPXPXPXPPXXPXXPPPXP 968 P P P P P P P P P P P P P P P P P Sbjct: 453 PATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEP 512 Query: 969 XPPP 980 P P Sbjct: 513 EPEP 516 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/114 (20%), Positives = 23/114 (20%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P P P P P P P P P P P Sbjct: 472 PKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEPEPVAEPEPEPEPVAEAEPEAEPAVEEE 531 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P P PP P PP Sbjct: 532 PAEEPEPAADETATEPTAEEAEPEAVEESIEKTEVVEEESAPPAARQSSPSPPP 585 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +1 Query: 760 PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P P P P P P P P P P Sbjct: 445 PATPRSSVPATPTESNLTTPAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP 504 Query: 940 PXPXXPPPXP 969 P P P Sbjct: 505 EPVAEPEPEP 514 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPX 971 P P P P P P PP P P P P P Sbjct: 310 PPTPKSAAPSEVPPTPKSAAPSEVPPTPKSAAPSEVPLTPKSAAQSSVPPTPKSAVPSEA 369 Query: 972 PPPP 983 PP P Sbjct: 370 PPTP 373 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/76 (26%), Positives = 20/76 (26%), Gaps = 1/76 (1%) Frame = +1 Query: 667 PXPXXXXPPPPP-XPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P P P P P P P P Sbjct: 464 PAPKTPKTPKTPRTPRTPKTPRTPKTPAVVEPEPEPVAEEP-EPVAEPEPEPEPVAEAEP 522 Query: 844 PPXPPPXPPPXPXPPP 891 P P P P Sbjct: 523 EAEPAVEEEPAEEPEP 538 >Z81059-5|CAJ15164.1| 176|Caenorhabditis elegans Hypothetical protein F11F1.8 protein. Length = 176 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GG GG GG GGG GG G GG GG GG G G G G GG Sbjct: 23 GGILGGNGQGGLGGIL--GGGEGGLGGILGNGGL---GGILGGNGLGGVLGGEDGGLGG 76 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG GG G G GG GGG G GG G GG GG GG G GG G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGLGGI---LGNGGLGGILGGNGLGGVLGGEDGGLGGIIG 79 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G G GGG G G GG G G G G G GG GG G GG Sbjct: 23 GGILGGNGQGGLGGILGGGEG---GLGGILGNGGLGGILGGNG---LGGVLGGEDGGLGG 76 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG--GGXGXXGGXGGGXGXXGG 833 GG G G GG G GG G G GG GG GG G G GG G GG Sbjct: 27 GGNGQGGLGGILGGGEGGLG---GILGNGGLGGILGGNGLGGVLGGEDGGLGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GG G GG GG GGG GG GG GG G G GG GG G GG Sbjct: 27 GGNGQGG-LGGILGGGEGGL----GGILGNGGLGGILGGNGLGGVLGGEDGGLGG 76 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG GGG G GG G G G GG G G GG G G GG G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGL-GGILGNG--GLGGILGGNGLGGVLGGEDGGLGGIIG 79 Score = 35.5 bits (78), Expect = 0.058 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GG GG G G GG G GG G GG GG GG Sbjct: 23 GGILG-GNGQGGLGGILGGGEGGLGGILGNGGLGGILGG--NGLGGVLGGEDGGLGG 76 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GG G GGG G GG G GG G G G GG GG G G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGLGGILGNGGLGGILGGNGLGGVLGGEDGGLGGIIG 79 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G GG GG GG GG GG GG G GG GG G GG Sbjct: 28 GNGQGGLGGILGGGEGGLGGILGNGGLGGILGGN-GLGGV-LGGEDGGLGG 76 >Z73105-4|CAA97443.2| 1406|Caenorhabditis elegans Hypothetical protein T11G6.5 protein. Length = 1406 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/101 (28%), Positives = 29/101 (28%), Gaps = 2/101 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX--PPXXXXPPPXXXXPP 837 P P PPP P P P P P PP P PPP Sbjct: 623 PGSPTQFNRPPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQ 682 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P PPP P PP Sbjct: 683 LPPRVPVPIIRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 39.1 bits (87), Expect = 0.005 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 15/92 (16%) Frame = +1 Query: 661 PPPX---PXXXXPPPPPXPXPXPXPPXPXPP-----PPXXPPPXPXPP----PPXXPPXX 804 PPP P P P P P P PP P PPP P PP P Sbjct: 632 PPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQLPPRVPVPI 691 Query: 805 XXPPPXXXXPPXPPPXPPP---XPPPXPXPPP 891 PP P P PPP P PPP Sbjct: 692 IRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPX------PPXXPXP--PPPXPPXXXXPXPXPXPPX 941 P P P P P P PPP PP P P PP P P P Sbjct: 652 PQPVPRFNGPPSSFILPSIYPPPPPGVSLNQLPPRVPVPIIRPPNDLQSIEPK-VPLKPN 710 Query: 942 XPXXPPPXPXPPP 980 PPP P PPP Sbjct: 711 FSIPPPPLPAPPP 723 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 8/56 (14%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXP-------XPPXPXPPP-PXXPPPXPXPPP 783 P P PP PP P P P P P P PPP P PPP Sbjct: 668 PSIYPPPPPGVSLNQLPPRVPVPIIRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 4/66 (6%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXP----PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P PPP P P P P P P PP P PP Sbjct: 623 PGSPTQFNRPPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQ 682 Query: 952 XPPPXP 969 PP P Sbjct: 683 LPPRVP 688 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPP 747 PP P P PP P P P P PP P PPP Sbjct: 684 PPRVPVPII-RPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 >Z69384-10|CAA93420.2| 1406|Caenorhabditis elegans Hypothetical protein T11G6.5 protein. Length = 1406 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/101 (28%), Positives = 29/101 (28%), Gaps = 2/101 (1%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXX--PPXXXXPPPXXXXPP 837 P P PPP P P P P P PP P PPP Sbjct: 623 PGSPTQFNRPPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQ 682 Query: 838 XPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PP P P P P P PPP P PP Sbjct: 683 LPPRVPVPIIRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 39.1 bits (87), Expect = 0.005 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 15/92 (16%) Frame = +1 Query: 661 PPPX---PXXXXPPPPPXPXPXPXPPXPXPP-----PPXXPPPXPXPP----PPXXPPXX 804 PPP P P P P P P PP P PPP P PP P Sbjct: 632 PPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQLPPRVPVPI 691 Query: 805 XXPPPXXXXPPXPPPXPPP---XPPPXPXPPP 891 PP P P PPP P PPP Sbjct: 692 IRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPX------PPXXPXP--PPPXPPXXXXPXPXPXPPX 941 P P P P P P PPP PP P P PP P P P Sbjct: 652 PQPVPRFNGPPSSFILPSIYPPPPPGVSLNQLPPRVPVPIIRPPNDLQSIEPK-VPLKPN 710 Query: 942 XPXXPPPXPXPPP 980 PPP P PPP Sbjct: 711 FSIPPPPLPAPPP 723 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 8/56 (14%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXP-------XPPXPXPPP-PXXPPPXPXPPP 783 P P PP PP P P P P P P PPP P PPP Sbjct: 668 PSIYPPPPPGVSLNQLPPRVPVPIIRPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 4/66 (6%) Frame = +1 Query: 784 PXXPPXXXXPPPXXXXP----PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P PPP P P P P P P PP P PP Sbjct: 623 PGSPTQFNRPPPVLHSPRSALPSAGPFSSPQPVPRFNGPPSSFILPSIYPPPPPGVSLNQ 682 Query: 952 XPPPXP 969 PP P Sbjct: 683 LPPRVP 688 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPX-PXPXPPXPXPPP 747 PP P P PP P P P P PP P PPP Sbjct: 684 PPRVPVPII-RPPNDLQSIEPKVPLKPNFSIPPPPLPAPPP 723 >U46675-2|AAB52644.1| 125|Caenorhabditis elegans Hypothetical protein F35A5.5 protein. Length = 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 757 PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXP 885 PPP P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXP 795 PPP P P P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPI---PIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 PPP P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPPXPXP 777 P P P P P P P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPV---PVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPPPXXPPP 765 PP P P P P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPI-PAPVPVPA---PVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PPP P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPP 942 PPP P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMP-MPMPVPVPVP 44 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 PPP P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVP-VPMPMPMPMPMP-MPVPVP 42 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 852 PPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PPP P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMP-MPMPVPVPVP 44 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 835 PXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVP-MPMPMPMPMPMP-VPVPVP 44 Score = 35.5 bits (78), Expect = 0.058 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP-PXPXPPP 747 PP P P P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPV-PVPAPVPQ---PVPVPMPMPMPMPMPMPVPVP 42 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PP P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PP P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 834 PPXXPXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPP 959 PP P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXP-PPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMP-MPVPVPVP 44 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PPP P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVP-QPVPVPMPMPMP-MPMPMPVPVP 42 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 706 PXPXPXP-PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVP 40 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXP 899 PP P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 P P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 695 PPPXXXPXPXPXXPXPPPPXXPPPXXXP-PXPXXXPXXPXXPXP 823 PPP P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAP-VPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPP---PXPPXXXXPXPXPXPPXXP 947 PP P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXP 899 P P P P P P P P P P P P P P P Sbjct: 2 PPPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVP 42 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 807 PXXPXXXXPPPXXPXPPPXPPXXPXPPP-PXPPXXXXPXPXP 929 P P P P P P P P P P P P P P P Sbjct: 3 PPIPIPIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPP-PXPPXXXXPXP 923 PP P P P P P P P P P P P P P P Sbjct: 3 PPIPI-PIPAPVPVPAPVPQPVPVPMPMPMPMPMPMPVPVPVP 44 >U42991-1|AAA85197.1| 118|Caenorhabditis elegans RNA binding protein protein. Length = 118 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/81 (37%), Positives = 30/81 (37%), Gaps = 2/81 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGXXXXGGX 789 GG G GG G G G GG G GG G GG GG G GGG G Sbjct: 41 GGFQRGYGGNGYGNRGGYGQQ---GGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGA 97 Query: 788 XGGGGXGXGGGXXGGGGXGXG 726 G G G G G G G Sbjct: 98 YGNVGLGVNPGVGGVVGSFLG 118 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 2/72 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGGXXXXG 795 G G G G G GG G G GG G GG GG G G GG GGG G Sbjct: 42 GFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGG--GYGGGRGAYG 99 Query: 794 GXXGGGGXGXGG 759 G G GG Sbjct: 100 NVGLGVNPGVGG 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -3 Query: 977 GXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXX 804 G G G G G GG G G G GG G G GGG GGG G G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGAYGNVGLGVNP 107 Query: 803 XXGGXXG 783 GG G Sbjct: 108 GVGGVVG 114 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/69 (39%), Positives = 27/69 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG G G GG G G G GG GG G G GGG GGG G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN-QGYYGQQGGG---YGGGRGAYGNVGL 103 Query: 802 GGXGXGXGG 776 G G GG Sbjct: 104 -GVNPGVGG 111 Score = 35.9 bits (79), Expect = 0.044 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 8/95 (8%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGG-GGXGX-GGXGXG 711 G G G G G GG GG G GG G GG G GG G GG G Sbjct: 21 GLNSGLGLGVGPARANANLNGGFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN 80 Query: 710 XGX----GGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G G G G G G G Sbjct: 81 QGYYGQQGGGYG----GGRGAYGNVGLGVNPGVGG 111 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G G G G G G GG G G GG G G GG GG Sbjct: 41 GGFQRGYGGNGYGNRG-GYGQQGGYYGQQGGYGQQG-GYGGNQGYYGQ-QGGGYGGG 94 >U41746-9|AAA83334.3| 559|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 6 protein. Length = 559 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 2/83 (2%) Frame = +1 Query: 628 PPXXPXPXXPXP-PPXPXXXXPPP-PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPX 801 PP P P P P P P P P P P P P P P P P P Sbjct: 166 PPATVAPYIERPVPARPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPYIEPT 225 Query: 802 XXXPPPXXXXPPXPPPXPPPXPP 870 P P P P P P PP Sbjct: 226 PARPAP-YIEPSTAKPQPRPQPP 247 Score = 37.5 bits (83), Expect = 0.014 Identities = 25/83 (30%), Positives = 25/83 (30%), Gaps = 1/83 (1%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP-PXXXXPPPXXXXPPXPPPXPPPXPP 870 PP P P P P P P P P P P P P P P P P Sbjct: 166 PPATVAPYIERPVPARPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPYIEPT 225 Query: 871 PXPXPPPXXXXXPXXPXPPXXPP 939 P P P P P PP Sbjct: 226 P-ARPAPYIEPSTAKPQPRPQPP 247 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 5/71 (7%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP-PXXXXPPP-XXXXPPXPPPXPPP- 861 P P P P P P P P P P P P P P P P P P P Sbjct: 177 PVPARPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPYIEPTPARPAPYIEPS 236 Query: 862 --XPPPXPXPP 888 P P P PP Sbjct: 237 TAKPQPRPQPP 247 Score = 35.5 bits (78), Expect = 0.058 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 3/71 (4%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPX--PPXXPXPPPPXPPXXXXPXPX-PXPPXXPX 950 P P P P P P P P P P P P P P P P P Sbjct: 177 PVPARPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPYIEPTPARPAPYIEPS 236 Query: 951 XPPPXPXPPPP 983 P P P PP Sbjct: 237 TAKPQPRPQPP 247 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXX 903 PP P P P P P P P P P P P P P P Sbjct: 166 PPATVAPYIERPVPA-RPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPYIEP 224 Query: 904 XPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P P Sbjct: 225 TPARPAPYIEPSTAKPQPRPQP 246 Score = 32.3 bits (70), Expect = 0.54 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 4/90 (4%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXP----PPPXXPPPXPXPPP 783 P P P P P P P P P P P P P P P P Sbjct: 167 PATVAPYIERPVPARPTPYIERPVPARPAPYIERPEPARPAPYIERPVPARPAPY-IEPT 225 Query: 784 PXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 P P P P PP P P Sbjct: 226 PARPAPYIEPSTAKPQPRPQPPRTRPYVAP 255 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 P P P P P P P P P P P P P P P P P Sbjct: 184 PYIERPVPARPA-PYIERPEPARPAPYIERPVPARPAPYIEPTPARPAPYIEP--STAKP 240 Query: 957 PPXPXPP 977 P P PP Sbjct: 241 QPRPQPP 247 >U24124-1|AAA77029.1| 118|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 118 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/81 (37%), Positives = 30/81 (37%), Gaps = 2/81 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGXXXXGGX 789 GG G GG G G G GG G GG G GG GG G GGG G Sbjct: 41 GGFQRGYGGNGYGNRGGYGQQ---GGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGA 97 Query: 788 XGGGGXGXGGGXXGGGGXGXG 726 G G G G G G G Sbjct: 98 YGNVGLGVNPGVGGVVGSFLG 118 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 2/72 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGGXXXXG 795 G G G G G GG G G GG G GG GG G G GG GGG G Sbjct: 42 GFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGG--GYGGGRGAYG 99 Query: 794 GXXGGGGXGXGG 759 G G GG Sbjct: 100 NVGLGVNPGVGG 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -3 Query: 977 GXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXX 804 G G G G G GG G G G GG G G GGG GGG G G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGAYGNVGLGVNP 107 Query: 803 XXGGXXG 783 GG G Sbjct: 108 GVGGVVG 114 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/69 (39%), Positives = 27/69 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG G G GG G G G GG GG G G GGG GGG G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN-QGYYGQQGGG---YGGGRGAYGNVGL 103 Query: 802 GGXGXGXGG 776 G G GG Sbjct: 104 -GVNPGVGG 111 Score = 35.9 bits (79), Expect = 0.044 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 8/95 (8%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGG-GGXGX-GGXGXG 711 G G G G G GG GG G GG G GG G GG G GG G Sbjct: 21 GLNSGLGLGVGPARANANLNGGFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN 80 Query: 710 XGX----GGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G G G G G G G Sbjct: 81 QGYYGQQGGGYG----GGRGAYGNVGLGVNPGVGG 111 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G G G G G G GG G G GG G G GG GG Sbjct: 41 GGFQRGYGGNGYGNRG-GYGQQGGYYGQQGGYGQQG-GYGGNQGYYGQ-QGGGYGGG 94 >AL110490-7|CAD59175.1| 533|Caenorhabditis elegans Hypothetical protein Y48B6A.6b protein. Length = 533 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPP 783 P P P PPPPP P P P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PPPP PP P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPP--PPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 733 PXPPP--PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PPP PPP P P P P PP P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPP-----SPRPTSVPPPIPSPGP 299 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P P PPPP PP P P P P P PP P P P Sbjct: 254 PVPPPVLSIPPPP--PPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPP P PPP P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P PPP P P P P P P PP P P P Sbjct: 256 PPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 811 PPPXXXXPPXPPP-XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP PP PPP P P P PP P P PPP P P Sbjct: 256 PPPVLSIPPPPPPNIPLPTIPQEVQSPP-------SPRPTSVPPPIPSPGP 299 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P PP P PPP P P P PP P P P P P P Sbjct: 254 PVPP-PVLSIPPPPPPNIPLPT-IPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP PP P P P P P P P P P P Sbjct: 263 PPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 859 PXPPPX---PXPPPXXXXXPXXPXPPXXPP-PXP-XXPPPXPXXPP 981 P PPP P PPP P P PP P P PPP P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PP P P P P P P PP P P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSP 297 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXP 899 P P PP P P P P P P P P P P P Sbjct: 258 PVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P P PP P P PP P Sbjct: 263 PPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIP 295 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP--XPPPXXXXXP 909 P PPP P PPP P P P P P P PPP P Sbjct: 254 PVPPPVLSIPPP--PPPNIPLPTIPQEVQSP-PSPRPTSVPPPIPSPGP 299 >AL110490-6|CAB54442.2| 687|Caenorhabditis elegans Hypothetical protein Y48B6A.6a protein. Length = 687 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPX-----PXPPPPXXPPPXPXPPP 783 P P P PPPPP P P P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 748 PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPP 891 P PP PPPP PP P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPP--PPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 733 PXPPP--PXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 P PPP PPP P P P P PP P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPP-----SPRPTSVPPPIPSPGP 299 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXP 855 P P P PPPP PP P P P P P PP P P P Sbjct: 254 PVPPPVLSIPPPP--PPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXP-PXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PPP P PPP P P P P PPP P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP 771 P P PPP P P P P P P PP P P P Sbjct: 256 PPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 811 PPPXXXXPPXPPP-XPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 PPP PP PPP P P P PP P P PPP P P Sbjct: 256 PPPVLSIPPPPPPNIPLPTIPQEVQSPP-------SPRPTSVPPPIPSPGP 299 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 792 PXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXP 935 P PP P PPP P P P PP P P P P P P Sbjct: 254 PVPP-PVLSIPPPPPPNIPLPT-IPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXP 726 PP PP P P P P P P P P P P Sbjct: 263 PPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 859 PXPPPX---PXPPPXXXXXPXXPXPPXXPP-PXP-XXPPPXPXXPP 981 P PPP P PPP P P PP P P PPP P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 692 PPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXP 823 P PP P P P P P P PP P P P P Sbjct: 254 PVPPPVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSP 297 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXP-PPPXP 899 P P PP P P P P P P P P P P P Sbjct: 258 PVLSIPPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIPSPGP 299 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P P PP P P PP P Sbjct: 263 PPPPPPNIPLPTIPQEVQSPPSPRPTSVPPPIP 295 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP--XPPPXXXXXP 909 P PPP P PPP P P P P P P PPP P Sbjct: 254 PVPPPVLSIPPP--PPPNIPLPTIPQEVQSP-PSPRPTSVPPPIPSPGP 299 >AF067209-1|AAC16982.2| 553|Caenorhabditis elegans Warthog (hedgehog-like family)protein 9 protein. Length = 553 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXP 834 P PPP P P PP P P P P PPP P P P Sbjct: 347 PTPPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQAPQLAPLPQHQHQFGFFQ 406 Query: 835 PXPPPXP 855 P P P P Sbjct: 407 PPPQPQP 413 Score = 35.9 bits (79), Expect = 0.044 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 9/79 (11%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXP----XPPPPXXPPXXXXPPPXXXX 831 PP P P P P P P PP P P P P PP PP P Sbjct: 335 PPVQVQVEPVTQPTPPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQAPQLAP 394 Query: 832 PPXPPP-----XPPPXPPP 873 P PPP P P Sbjct: 395 LPQHQHQFGFFQPPPQPQP 413 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +1 Query: 796 PXXXXPPPXXXXPPXPPPXPPPXP---PPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPX 966 P PP P P PPP P P P P P P P P P P Sbjct: 330 PTTHAPPVQVQVEPVTQPTPPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQA 389 Query: 967 PXXPP 981 P P Sbjct: 390 PQLAP 394 Score = 32.3 bits (70), Expect = 0.54 Identities = 25/97 (25%), Positives = 25/97 (25%), Gaps = 3/97 (3%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP---XPP 858 P PP P P P P PP P P P P P Sbjct: 300 PRAPPRRVHQPYTRRILTPKPRIVHTTTVMPTTHAPPVQVQVEPVTQPTPPPNPFVFAPL 359 Query: 859 PXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXP 969 P P P P P P PP P P P Sbjct: 360 PPFPQFGLPQPNLFQFPAPPAPPPFGVPQAPQLAPLP 396 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXP 956 PP P P P P P P P P P P P P P P Sbjct: 350 PPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQAP--QLAPLPQHQHQFGFFQP 407 Query: 957 PPXPXP 974 PP P P Sbjct: 408 PPQPQP 413 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +1 Query: 616 PPXXP----PXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 PP P P P P P P PP P P P P P P PP Sbjct: 349 PPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVPQAPQLAPLPQHQHQFGFFQPP 408 Query: 784 PXXPP 798 P P Sbjct: 409 PQPQP 413 Score = 30.3 bits (65), Expect = 2.2 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 1/86 (1%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 P P P P PP P P P P P P P P P P P Sbjct: 330 PTTHAPPVQVQVEPVTQPTPP--PNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVP 387 Query: 868 -PPXPXPPPXXXXXPXXPXPPXXPPP 942 P P P PP P P Sbjct: 388 QAPQLAPLPQHQHQFGFFQPPPQPQP 413 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P PP P P PP P P P P P P P Sbjct: 343 PVTQPTPPPNPFVFAPLPPFPQFGLPQPNLFQFPAPPAPPPFGVP 387 >AF038614-8|AAB92055.1| 118|Caenorhabditis elegans Hypothetical protein F15E6.3 protein. Length = 118 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/81 (37%), Positives = 30/81 (37%), Gaps = 2/81 (2%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--GGXGGGXGGXXXXGGGXXXXGGX 789 GG G GG G G G GG G GG G GG GG G GGG G Sbjct: 41 GGFQRGYGGNGYGNRGGYGQQ---GGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGA 97 Query: 788 XGGGGXGXGGGXXGGGGXGXG 726 G G G G G G G Sbjct: 98 YGNVGLGVNPGVGGVVGSFLG 118 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/72 (38%), Positives = 28/72 (38%), Gaps = 2/72 (2%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXG--GGXGGXXXXGGGXXXXG 795 G G G G G GG G G GG G GG GG G G GG GGG G Sbjct: 42 GFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGG--GYGGGRGAYG 99 Query: 794 GXXGGGGXGXGG 759 G G GG Sbjct: 100 NVGLGVNPGVGG 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -3 Query: 977 GXXGXGG-GXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXX 804 G G G G G GG G G G GG G G GGG GGG G G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGNQGYYGQQGGGYGGGRGAYGNVGLGVNP 107 Query: 803 XXGGXXG 783 GG G Sbjct: 108 GVGGVVG 114 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/69 (39%), Positives = 27/69 (39%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GG G G GG G G G GG GG G G GGG GGG G G Sbjct: 48 GGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN-QGYYGQQGGG---YGGGRGAYGNVGL 103 Query: 802 GGXGXGXGG 776 G G GG Sbjct: 104 -GVNPGVGG 111 Score = 35.9 bits (79), Expect = 0.044 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 8/95 (8%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGG-GGXGX-GGXGXG 711 G G G G G GG GG G GG G GG G GG G GG G Sbjct: 21 GLNSGLGLGVGPARANANLNGGFQRGYGGNGYGNRGGYGQQGGYYGQQGGYGQQGGYGGN 80 Query: 710 XGX----GGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 G GGG G G G G G G G G Sbjct: 81 QGYYGQQGGGYG----GGRGAYGNVGLGVNPGVGG 111 Score = 31.1 bits (67), Expect = 1.3 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 GG G GG G G G G G G GG G G GG G G GG GG Sbjct: 41 GGFQRGYGGNGYGNRG-GYGQQGGYYGQQGGYGQQG-GYGGNQGYYGQ-QGGGYGGG 94 >AC006834-6|AAF40004.1| 233|Caenorhabditis elegans Hypothetical protein ZK973.9 protein. Length = 233 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/93 (31%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP-PXPPPXPPP 873 PP P P P PP PPP PP P PPP PP Sbjct: 125 PPQAAPSPGGPMQ-PPHGFAPPPMGGGVPPEMMNHQAYQAQMRQQQQQPNGQAPPPVYPP 183 Query: 874 XPXPPPXXXXXPXX-PXPPXXPPPXPXXPPPXP 969 P P P PP P P PPP P Sbjct: 184 FGQPAPQMSGQRMPYPYPPQGMPGYPGGPPPPP 216 Score = 35.5 bits (78), Expect = 0.058 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 4/107 (3%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPPPPXXPPPXPXPPPPXXPP 798 P P P P PP PPP P P PPP PP Sbjct: 126 PQAAPSPGGPMQPPH--GFAPPPMGGGVPPEMMNHQAYQAQMRQQQQQPNGQAPPPVYPP 183 Query: 799 XXXXPPPXXXXPPXPPPXPPPXPPPXP-XPPPXXXXXPXXPXPPXXP 936 P P P P PP P P PPP P P P Sbjct: 184 FGQ-PAPQMSGQRMPYPYPPQGMPGYPGGPPPPPHGYEGYPPPGAQP 229 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXP 974 P P PP P P P P PP P P P PPP P Sbjct: 172 PNGQAPPPVYPPFGQPAPQMSGQRMPYPYPPQGMPGYPGGPPPPPHGYEGYPPPGAQP 229 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 846 PXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P PP P P P P P PP P P PPP Sbjct: 172 PNGQAPPPVYPPFGQPAPQMSGQRMPYPYPPQGMPGYPGGPPPPP 216 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPP----XXPPPXPXP 777 P P P P P P P P P P PPPP PPP P Sbjct: 172 PNGQAPPPVYPPFGQPAPQMSGQRMPYPYPPQGMPGYPGGPPPPPHGYEGYPPPGAQP 229 >Z81059-3|CAB02927.1| 246|Caenorhabditis elegans Hypothetical protein F11F1.5 protein. Length = 246 Score = 41.5 bits (93), Expect = 9e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGG 696 GG GG GG GG GGG GG G GG GG GG G G G G GG Sbjct: 23 GGILGGNGQGGLGGIL--GGGEGGLGGILGNGGL---GGILGGNGLGGILGGEDGGLGG 76 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG GG G G GG GGG G GG G GG GG GG G GG G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGLGGI---LGNGGLGGILGGNGLGGILGGEDGGLGGIIG 79 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 GG GG G G GGG G G GG G G G G G GG GG G GG Sbjct: 23 GGILGGNGQGGLGGILGGGEG---GLGGILGNGGLGGILGGNG---LGGILGGEDGGLGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG--GGXGXXGGXGGGXGXXGG 833 GG G G GG G GG G G GG GG GG G G GG G GG Sbjct: 27 GGNGQGGLGGILGGGEGGLG---GILGNGGLGGILGGNGLGGILGGEDGGLGG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 GG G GG GG GGG GG GG GG G G GG GG G GG Sbjct: 27 GGNGQGG-LGGILGGGEGGL----GGILGNGGLGGILGGNGLGGILGGEDGGLGG 76 Score = 37.5 bits (83), Expect = 0.014 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 833 GXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G G GG GGG G GG G G G GG G G GG G G GG G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGL-GGILGNG--GLGGILGGNGLGGILGGEDGGLGGIIG 79 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -3 Query: 812 GXXXXGGXXGGGGXGXGGGXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 G G GG G GGG G GG G GG G G G GG GG G G Sbjct: 23 GGILGGNGQGGLGGILGGGEGGLGGILGNGGLGGILGGNGLGGILGGEDGGLGGIIG 79 Score = 35.1 bits (77), Expect = 0.077 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G G G G GG GG G G GG G GG G GG GG GG Sbjct: 23 GGILG-GNGQGGLGGILGGGEGGLGGILGNGGLGGILGG--NGLGGILGGEDGGLGG 76 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGG 738 G G G GG GG GG GG GG GG G GG GG G GG Sbjct: 28 GNGQGGLGGILGGGEGGLGGILGNGGLGGILGGN-GLGGI-LGGEDGGLGG 76 >U88314-13|ABR92611.1| 1346|Caenorhabditis elegans Formin homology domain protein 1 protein. Length = 1346 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPPP PPP P PP PPP PP PPP Sbjct: 770 PPPP--PPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 PPPPP P P PP P PP PPPP PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPP--PP 804 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPPP P PP P PPP PPP P Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PPP P P PP P P PPP P Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PPP P P PP PP PP P P P Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PPP PPP P P P PP P P PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPP--PPP 804 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 885 PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP PP P P P PP PPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPP 802 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 PP P P PP PPPP P P PP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P PP PP P PP PP Sbjct: 772 PPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP 899 P P PP P PP PP PP PPPP P Sbjct: 770 PPPPPPPSAIP---LPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX-----PPPXPXXXXPPPPP 702 PP PP P P PPP P PPPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPP---XPPPXPP 870 P PPPP P PP P PPP PPP PP Sbjct: 771 PPPPPPSAIP---LPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PPP P PP P PP PPP PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPP--PPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P PP P PP PPP PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 PP P P PP PPPPP P PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PP P PPP P PPP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIP--PPPPP 804 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 832 PPXPPPXPPPXPPPX----PXPPPXXXXXPXXPXPP 927 PP PPP P PP P PPP P P PP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPP--PPPP 804 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 668 PXXXXX-XPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXP 787 P PPPPP P P PPP PP PP P Sbjct: 764 PVGVGVPPPPPPPSAIPLPPRLQGGIPPP--PPLGIIPPPP 802 >AC024811-5|AAF60775.1| 285|Caenorhabditis elegans Collagen protein 48 protein. Length = 285 Score = 41.5 bits (93), Expect = 9e-04 Identities = 31/111 (27%), Positives = 31/111 (27%), Gaps = 5/111 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 P P PP P P P P P PP P P Sbjct: 112 PGQGPGEPGPPGPDAELHDRILPVPPQCPCTAAPGLGGPPGPPGQDGIPGNPGRNGEDGA 171 Query: 841 PPPXPPPXPPPXPXPP--PXXXXXPXXP---XPPXXPPPXPXXPPPXPXXP 978 P P P PP P P P P P P PP P PP P P Sbjct: 172 PGPQGPSGPPGPPGQPGQPGQRGPPGEPGALLPGGDAPPGPSGPPGRPGAP 222 Score = 35.9 bits (79), Expect = 0.044 Identities = 32/129 (24%), Positives = 32/129 (24%), Gaps = 8/129 (6%) Frame = +3 Query: 615 PXXPPXXPPXPXXXXXPXPXXXXXXPPPPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXP 794 P P P P P PP P PP P Sbjct: 96 PPGPDGEPGTPGKDGEPGQGPGEPGPPGPDAELHDRILPVPPQCPCTAAPGLGGPPGPPG 155 Query: 795 XPPXPXXPXXXX----PPPXXPXPPPXPPXXPXPP----PPXPPXXXXPXPXPXPPXXPX 950 P P P P P PP PP P P PP P P P P Sbjct: 156 QDGIPGNPGRNGEDGAPGPQGPSGPPGPPGQPGQPGQRGPPGEPGAL--LPGGDAPPGPS 213 Query: 951 XPPPXPXPP 977 PP P P Sbjct: 214 GPPGRPGAP 222 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/95 (26%), Positives = 25/95 (26%), Gaps = 1/95 (1%) Frame = +1 Query: 697 PPXPXPXPXPPXPXPPPPXXP-PPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P P P P PP P PP PP Sbjct: 96 PPGPDGEPGTPGKDGEPGQGPGEPGPPGPDAELHDRILPVPPQCPCTAAPGLGGPPGPPG 155 Query: 874 XPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P P Sbjct: 156 QDGIPGNPGRNGEDGAPGPQGPSGPPGPPGQPGQP 190 Score = 33.9 bits (74), Expect = 0.18 Identities = 28/107 (26%), Positives = 28/107 (26%), Gaps = 3/107 (2%) Frame = +1 Query: 646 PXXPXPPPXPXXXXPPPPPXPXPXPXPPXPX-PPPPXXPPPXPXPPPPXXPPXXXXPPPX 822 P P PP P P P P PP P P P P P Sbjct: 116 PGEPGPPGPDAELHDRILPVPPQCPCTAAPGLGGPPGPPGQDGIPGNPGRNGEDGAPGPQ 175 Query: 823 XXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXX--PPPXPXXP 957 P PP P P P P PP PP P P Sbjct: 176 GPSGPPGPPGQPGQPGQRGPPGEPGALLPGGDAPPGPSGPPGRPGAP 222 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 689 PPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPP 826 PP PP P P P P PP P P P P P Sbjct: 180 PPGPPGQPGQPGQRGPPGEPGALLPGGDAPPGPSGPPGRPGAPGQP 225 Score = 30.3 bits (65), Expect = 2.2 Identities = 31/129 (24%), Positives = 31/129 (24%), Gaps = 9/129 (6%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPX-----PXPXPPXPXPPPPXXPPPXPXPPP 783 P P P PP P P P P P P P PP P P Sbjct: 136 PPQCPCTAAPGLGGPPGPPGQDGIPGNPGRNGEDGAPGPQGPSGPPGPPGQPGQPGQRGP 195 Query: 784 PXXP----PXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPX 951 P P P PP P P P P P PP P Sbjct: 196 PGEPGALLPGGDAPPGPSGPPGRPGAPGQPGKAGSPGQDGSNGDAGVAGEPGQRGPPGPP 255 Query: 952 XPPPXPXXP 978 P P Sbjct: 256 GQAGTPGSP 264 >AB084086-1|BAC67013.1| 1346|Caenorhabditis elegans Formactin protein. Length = 1346 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 739 PPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPP 849 PPPP PPP P PP PPP PP PPP Sbjct: 770 PPPP--PPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPP 798 PPPPP P P PP P PP PPPP PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPP--PP 804 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 775 PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXP 879 PPPP P PP P PPP PPP P Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 847 PXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXP 948 P PPP P P PP P P PPP P Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXP 929 PPP P P PP PP PP P P P Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PPP PPP P P P PP P P PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPP--PPP 804 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 885 PPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPPP 983 PPP PP P P P PP PPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPP 802 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 PP P P PP PPPP P P PP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 884 PPPXPXXXPXPPPXPXXPXPPXPXPPXXPPXPP 982 PPP P P PP PP P PP PP Sbjct: 772 PPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 786 PXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXP 899 P P PP P PP PP PP PPPP P Sbjct: 770 PPPPPPPSAIP---LPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +1 Query: 616 PPXXPPXXPXPXXPX-----PPPXPXXXXPPPPP 702 PP PP P P PPP P PPPPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 32.3 bits (70), Expect = 0.54 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 769 PXPPPPXXPPXXXXPPPXXXXPPXPPP---XPPPXPP 870 P PPPP P PP P PPP PPP PP Sbjct: 771 PPPPPPSAIP---LPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 655 PXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPP 765 P PPP P PP P PP PPP PPP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPP--PPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 PP P P PP P PP PPP PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPPP 804 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPP 729 PP P P PP PPPPP P PP Sbjct: 770 PPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPPP 803 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 712 PXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPP 819 P P PP P PP P PPP P PPP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIP--PPPPP 804 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 832 PPXPPPXPPPXPPPX----PXPPPXXXXXPXXPXPP 927 PP PPP P PP P PPP P P PP Sbjct: 771 PPPPPPSAIPLPPRLQGGIPPPPPLGIIPP--PPPP 804 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 668 PXXXXX-XPPPPPXXXPXPXPXXPXPPPPXXPPPXXXPPXP 787 P PPPPP P P PPP PP PP P Sbjct: 764 PVGVGVPPPPPPPSAIPLPPRLQGGIPPP--PPLGIIPPPP 802 >Z93377-1|CAB07573.1| 340|Caenorhabditis elegans Hypothetical protein F13A7.1 protein. Length = 340 Score = 41.1 bits (92), Expect = 0.001 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 10/114 (8%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXG--------GGXGGGXG--GX 828 G G GGG GG G G GGG G G G G Sbjct: 143 GAGGGGGGASAGGGAAGAGGASQMTAAQGSAAQGAGGGGAVSQISAAPGSMAQGVGAPGS 202 Query: 827 XXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXG 666 GGG G GGG G G G G GGGG G G Sbjct: 203 AAQGGGAQGPVSQISVTQGGRGGGTAGTGSVAQGVTAQGSAAQGGGGGGTAGSG 256 Score = 39.5 bits (88), Expect = 0.004 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXG---GGXGGGXGGXXXXGGGXXXXGGXX--GGGG 774 G G G G GG G GG GGG G G G GGGG Sbjct: 191 GSMAQGVGAPGSAAQGGGAQGPVSQISVTQGGRGGGTAGTGSVAQGVTAQGSAAQGGGGG 250 Query: 773 XGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGG 660 G G G G G GGG GG Sbjct: 251 GTAGSGSVAQGSAAQGSAAQGSAAQGGGVAKSSSVAGG 288 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/104 (26%), Positives = 28/104 (26%), Gaps = 6/104 (5%) Frame = -3 Query: 938 GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G G G GG G G GGG G G G GGG Sbjct: 128 GSVAQGSAVQGSAVQGAGGGGGGASAGGGAAGAGGASQMTAAQGSAAQGAGGGGAVSQIS 187 Query: 758 GXXGGGGXGXGGXGXGXGXGGGGG------XXXXGXGGGXGXXG 645 G G G G GG G G GGG G Sbjct: 188 AAPGSMAQGVGAPGSAAQGGGAQGPVSQISVTQGGRGGGTAGTG 231 Score = 37.5 bits (83), Expect = 0.014 Identities = 35/117 (29%), Positives = 35/117 (29%), Gaps = 7/117 (5%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGX-GXGGGXGGGXGGGXGGXXXXGGGXXXXGG 792 G GGG GGG G G G G GGG G G G Sbjct: 145 GGGGGGASAGGGAAGAGGASQMTAAQGSAAQGAGGGGAVSQISAAPGSMAQGVGAPGSAA 204 Query: 791 XXGGGGXGXGG------GXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXG 639 GGG G G GGG G G G G GGG G G G Sbjct: 205 Q-GGGAQGPVSQISVTQGGRGGGTAGTGSVAQGVTAQGSAAQ----GGGGGGTAGSG 256 Score = 35.5 bits (78), Expect = 0.058 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 8/96 (8%) Frame = -3 Query: 878 GXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG-------- 723 G GG G G G G G G GG GGG G GG Sbjct: 111 GMGGTEMATSNPGSKAQGSVAQGSAVQGSAVQGAGGGGGGASAGGGAAGAGGASQMTAAQ 170 Query: 722 XGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G GGGG G G G G G Sbjct: 171 GSAAQGAGGGGAVSQISAAPGSMAQGVGAPGSAAQG 206 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXG 806 GGGGG GG GG G GG G G G G Sbjct: 145 GGGGGGASAGGGAAGAGGASQMTAAQGSAAQGAGGGGAVSQISAAPGSMAQGVGAPGSAA 204 Query: 805 XGGXGXG 785 GG G Sbjct: 205 QGGGAQG 211 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -3 Query: 947 GXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXG 768 G GG G G G GGG GG G G G G GGG Sbjct: 221 GGRGGGTAGTGSVAQGVTAQGSAAQGGGGGGTAGSGSVAQGSAAQGSAAQGSAAQGGGVA 280 Query: 767 XGGGXXGG 744 GG Sbjct: 281 KSSSVAGG 288 Score = 32.3 bits (70), Expect = 0.54 Identities = 30/118 (25%), Positives = 30/118 (25%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GG G G G G GGG G GG GG Sbjct: 111 GMGGTEMATSNPGSKAQGSVAQGSAVQGSAVQGAGGGGG-GASAGGGAAGAGGASQMTAA 169 Query: 788 XGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXGG 615 G G GGG G G G G G G GG GG Sbjct: 170 QGSAAQGAGGGGAVSQISAAPG-SMAQGVGAPGSAAQGGGAQGPVSQISVTQGGRGGG 226 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 GGG G GG G G G G GGG G G G G Sbjct: 206 GGGAQGPVSQISVTQGGRGGGTAGTGSVAQGVTAQGSAAQGGGGGGTAGSGSVAQGSAAQ 265 Query: 802 GGXGXG 785 G G Sbjct: 266 GSAAQG 271 Score = 30.3 bits (65), Expect = 2.2 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXG 762 GGG G G GGG G GG GG G G G Sbjct: 179 GGGAVSQISAAPGSMAQGVGAPGSAAQGGGAQGPVSQISVTQGG--RGGGTAGTGSVAQG 236 Query: 761 GGXXGGGGXGXGGXG-XGXGXGGGGGXXXXGXGGGXGXXGXG 639 G G GG G G G G G G G Sbjct: 237 VTAQGSAAQGGGGGGTAGSGSVAQGSAAQGSAAQGSAAQGGG 278 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGGXXXXGXXGX 803 G GG G G G G GGG G G GGG G Sbjct: 176 GAGGGGAVSQISAAPGSMAQGVGAPGSAAQGGGAQGPVSQISVTQGGRGGGTAGTGSVAQ 235 Query: 802 GGXGXG 785 G G Sbjct: 236 GVTAQG 241 Score = 28.3 bits (60), Expect = 8.9 Identities = 24/108 (22%), Positives = 24/108 (22%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXX 798 G G G G G G GGG G GGG Sbjct: 171 GSAAQGAGGGGAVSQISAAPGSMAQGVGAPGSAAQGGGAQGPVSQISVTQGGRGGGTAGT 230 Query: 797 GGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 G G GGGG G G G G G Sbjct: 231 GSVAQGVTAQGSAAQGGGGGGTAGSGSVAQGSAAQGSAAQGSAAQGGG 278 >Z81472-1|CAB03889.1| 173|Caenorhabditis elegans Hypothetical protein C16D6.1 protein. Length = 173 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = +1 Query: 664 PPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXP 843 PP P PPPP P P P P P P P PP P PP P Sbjct: 69 PPGPPPHGPPPPHLLHALPHPAYPPGHPLHMPGMTMMPMGPVGPPMMAG-MPMRPMPPLP 127 Query: 844 PPXPPPXPPPXPXPPPXXXXXPXXP 918 P P P P P P Sbjct: 128 PMTPMGSMPHPNDGGPHPMMLPGAP 152 Score = 35.5 bits (78), Expect = 0.058 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 2/85 (2%) Frame = +1 Query: 733 PXPPPPXXPPPXPXP--PPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXX 906 P PPP PPP P P PP P P P PP P P Sbjct: 70 PGPPPHGPPPPHLLHALPHPAYPPGHPLHMPGMTMMPMGPVGPPMMAGMPMRPMP----- 124 Query: 907 PXXPXPPXXPPPXPXXPPPXPXXPP 981 P P P P P P P P Sbjct: 125 PLPPMTPMGSMPHPNDGGPHPMMLP 149 Score = 34.3 bits (75), Expect = 0.14 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = +1 Query: 718 PXPPXPXPPPPXXPPPXPXPP-PPXXP---PXXXXPPPXXXXPPXPPPXP-PPXPPPXPX 882 P PP PPPP P P PP P P P PP P P PP P Sbjct: 70 PGPPPHGPPPPHLLHALPHPAYPPGHPLHMPGMTMMPMGPVGPPMMAGMPMRPMPPLPPM 129 Query: 883 PPPXXXXXPXXPXP-PXXPPPXP 948 P P P P P P Sbjct: 130 TPMGSMPHPNDGGPHPMMLPGAP 152 Score = 33.5 bits (73), Expect = 0.24 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 8/84 (9%) Frame = +1 Query: 631 PXXPXPXXPXPP----PXPXXXXPPPPP--XPXPXPXPPXP-XPPPPXXPPPXPXPPPPX 789 P P P P PP P PP P P P P PP P P PP P Sbjct: 69 PPGPPPHGPPPPHLLHALPHPAYPPGHPLHMPGMTMMPMGPVGPPMMAGMPMRPMPPLPP 128 Query: 790 XPPXXXXPPPXXXXP-PXPPPXPP 858 P P P P P P P Sbjct: 129 MTPMGSMPHPNDGGPHPMMLPGAP 152 Score = 31.9 bits (69), Expect = 0.72 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 7/76 (9%) Frame = +3 Query: 777 PPXPXPXPPXPXXPXXXXPPPXXPXPPP-------XPPXXPXPPPPXPPXXXXPXPXPXP 935 PP P P P P P P P P P P PP P P P P Sbjct: 69 PPGPPPHGPPPPHLLHALPHPAYPPGHPLHMPGMTMMPMGPVGPPMMAGMPMRPMP-PLP 127 Query: 936 PXXPXXPPPXPXPPPP 983 P P P P P Sbjct: 128 PMTPMGSMPHPNDGGP 143 >Z70756-4|CAA94788.1| 290|Caenorhabditis elegans Hypothetical protein T06E4.4 protein. Length = 290 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/122 (28%), Positives = 35/122 (28%), Gaps = 1/122 (0%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG-GGXXX 801 G G G G G G G G G GG G G G G Sbjct: 120 GLTGGNGPCITCPAGAPGPAGAPGAPGPQGPSGAPGQDAVGGGPGPAGPQGPAGDAGAPG 179 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXX 621 G G G GG G G G G GG G G GG G G G Sbjct: 180 QAGAPGHPGAPGQGGQRSRGTPGPSGAPGPQGPAGGPGQP--GQSGGAGAPGPAGAPGAP 237 Query: 620 GG 615 GG Sbjct: 238 GG 239 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/102 (31%), Positives = 32/102 (31%), Gaps = 5/102 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXGG-GXXGGXGXXGXXXXXG--GGXGXGGGXGGGXGGGXGGXXXXG--G 813 G GGG G G G G G G G G GG G G G G G Sbjct: 155 GQDAVGGGPGPAGPQGPAGDAGAPGQAGAPGHPGAPGQGGQRSRGTPGPSGAPGPQGPAG 214 Query: 812 GXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGG 687 G G G G G G GG G G G G G Sbjct: 215 GPGQPGQSGGAGAPGPAGAPGAPGGPGNAGTPGTPGAPGNAG 256 Score = 34.7 bits (76), Expect = 0.10 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 6/126 (4%) Frame = -3 Query: 977 GXXGXGGGXXGXG-GGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG--GGX 807 G G G G G G G G GG G G G G G G Sbjct: 92 GPPGQPGAQGEAGHAGEAGKPGANGVTIGLTGGNGPCITCPAGAPGPAGAPGAPGPQGPS 151 Query: 806 XXXGGXXGGGGXGXGG--GXXG-GGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GGG G G G G G G G G G GG G G G G Sbjct: 152 GAPGQDAVGGGPGPAGPQGPAGDAGAPGQAGAPGHPGAPGQGGQRSRGTPGPSGAPGPQG 211 Query: 635 XGGXXG 618 G G Sbjct: 212 PAGGPG 217 Score = 33.1 bits (72), Expect = 0.31 Identities = 33/105 (31%), Positives = 33/105 (31%), Gaps = 9/105 (8%) Frame = -3 Query: 980 GGXXGXGG--GXXGXGG--GXXGGXGXXGXXXXXG----GGXGXGGGXGG-GXGGGXGGX 828 GG G G G G G G G G G G G G G G G GG G Sbjct: 160 GGGPGPAGPQGPAGDAGAPGQAGAPGHPGAPGQGGQRSRGTPGPSGAPGPQGPAGGPGQP 219 Query: 827 XXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGG 693 GG G G G GG G G G G GG Sbjct: 220 GQSGGA----GAPGPAGAPGAPGGPGNAGTPGTPGAPGNAGAPGG 260 >Z49127-2|CAA88949.1| 245|Caenorhabditis elegans Hypothetical protein F13D12.3 protein. Length = 245 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 7/107 (6%) Frame = +1 Query: 664 PPXPXXXXPP-----PPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXXPPXXXXPPPXX 825 PP P P P P P P PP P P P P PP P Sbjct: 86 PPQPSYSPPKSSYGRPEPTYSPYSRPSSSYGRPPQFYPAQPGPAVPAVIPPVVTQPIVPP 145 Query: 826 XXPPXPPPXP-PPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 P P P PP P P P PP P P PP Sbjct: 146 PVPEVSEPVPEPPIPAPGPVAPPTPSGPLFGGVEPGAGALTPGVAPP 192 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXP 795 PP P P P P P P P PP P P P P PP P PP P P Sbjct: 118 PPQFYPAQPGPAVPAVIP-PVVTQPIVPP---PVPEVSEPVPEPPIPAPGPVAPPTPSGP 173 Query: 796 PXXXXPPPXXXXPPXPPPXP 855 P P P P Sbjct: 174 LFGGVEPGAGALTPGVAPPP 193 Score = 37.5 bits (83), Expect = 0.014 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = +1 Query: 724 PPXPXPPPPXXPPPXPX--PPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXX 897 P PP P PP P P P P PP P P P PP Sbjct: 81 PSSYGPPQPSYSPPKSSYGRPEPTYSPYSR-PSSSYGRPPQFYPAQPGPAVPAVIPPVVT 139 Query: 898 XXXPXXPXPPXXPP-PXPXXPPPXPXXPP 981 P P P P P P P P PP Sbjct: 140 QPIVPPPVPEVSEPVPEPPIPAPGPVAPP 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 25/94 (26%), Positives = 25/94 (26%) Frame = +3 Query: 696 PPPXXXPPXXPXXXXXXXXXXXXXXXXPPXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXX 875 P P P P P P PP P P P P P PP Sbjct: 101 PEPTYSPYSRPSSSYGRPPQFYPAQPGPAVPAVIPPVVTQPIVPPPVPEVSEPVPEPPI- 159 Query: 876 PXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 P P P PP P P P PP Sbjct: 160 PAPGPVAPPTPSGPLFGGVEPGAGALTPGVAPPP 193 Score = 36.3 bits (80), Expect = 0.033 Identities = 33/116 (28%), Positives = 33/116 (28%), Gaps = 11/116 (9%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPX-----PPXPXPPPPXXPPPXPXPP---- 780 P P PP P P P P PP P P P PP Sbjct: 81 PSSYGPPQPSYSPPKSSYGRPEPTYSPYSRPSSSYGRPPQFYPAQPGPAVPAVIPPVVTQ 140 Query: 781 PPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXP--XPPXXPPP 942 P PP P P P P P P PP P P P P PPP Sbjct: 141 PIVPPPVPEVSEP---VPEPPIPAPGPVAPPTPSGPLFGGVEPGAGALTPGVAPPP 193 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPP 959 P P P P P PP P P PP P P PP P Sbjct: 107 PYSRPSSSYGRPPQFYPAQPGPAVPAVIPPVVTQPIVP-PPVPEVSEPVPEPPIPAPGPV 165 Query: 960 PXPXPPPP 983 P P P Sbjct: 166 APPTPSGP 173 >U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical protein ZK354.8 protein. Length = 483 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 727 PXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPP 888 P P PPP PP P PPP P P P P P PP P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQP 145 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 691 PPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPP 837 PPP P P P P P PPP P PP P PP Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPP 140 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPP 977 PPP P PPP P PPP P P P P PP Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPP 140 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPX 921 PPP PPP P P P PP PP P P PP P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQPLLQSPS 151 Query: 922 P 924 P Sbjct: 152 P 152 Score = 36.7 bits (81), Expect = 0.025 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 9/85 (10%) Frame = +1 Query: 742 PPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP-------XPXPPPXXX 900 P P P P PPP PP PPP P PPP P PP Sbjct: 69 PTPTLPQIIAKQEPEVAMKTMMLPPPSDP-PPPPPPVAPHQPPPQLATSAQPPQPPVINS 127 Query: 901 XXPXXPXPPXXPP--PXPXXPPPXP 969 P P PP P P P Sbjct: 128 QLPRMSPAPAIPPSMAQPLLQSPSP 152 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 832 PPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXPP 981 PP P PPP P PPP P PP P P P PP Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRM-SPAPAIPP 140 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPP--PXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXP 813 P P P PPP P PPP P PP P P P PP P P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRM-SPAPAIPPSMAQPLLQSP 150 Query: 814 PP 819 P Sbjct: 151 SP 152 Score = 35.5 bits (78), Expect = 0.058 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 616 PPXXPPXXPXPXXP-XPPPXPXXXXPPPPPXPXPXPXP---PXPXPPPPXXPPPXPXPPP 783 PP PP P P P PPP PP P P P P PP P P P Sbjct: 93 PPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQPLLQSPSP 152 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 801 PXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 P P P PP PPP PP P P P P P P P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQPLLQSPS 151 Query: 981 P 983 P Sbjct: 152 P 152 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +1 Query: 667 PXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPP 846 P P PPPPP P P P PP P P PP P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAI--PPSMAQPLLQS 149 Query: 847 PXP 855 P P Sbjct: 150 PSP 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXP 867 PP P P P P P PP P PP P P P P P Sbjct: 93 PPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQPLLQSPSP 152 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXP 777 PP P P P P P PP P P P PP P Sbjct: 92 PPPSDPPPPPPPVAPHQPPPQLATSAQPPQPPVINSQLPRMSPAPAIPPSMAQP 145 >U13644-9|AAB52680.3| 492|Caenorhabditis elegans Cell death abnormality protein 6 protein. Length = 492 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P P PPP P P PP P P Sbjct: 243 PPIYPGLGP-PALPLSPMPQGPPPNIPPSSIYSMPRANDLPPTEMAPTLPQISTSSNGAS 301 Query: 874 XPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P PP P P Sbjct: 302 PSVSP--ASTSPSGPAPSIPPPRPPALAPPPPVAP 334 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 1/89 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P PPP P P PP P Sbjct: 243 PPIYPGLGPPALPLSPMPQGPPPNIPPSSIYSMPRANDLPPTEMAPTLPQISTSSNGASP 302 Query: 808 XPPPXXXXPPXP-PPXPPPXPPPXPXPPP 891 P P P P PPP PP PPP Sbjct: 303 SVSPASTSPSGPAPSIPPPRPPALAPPPP 331 Score = 34.7 bits (76), Expect = 0.10 Identities = 28/100 (28%), Positives = 28/100 (28%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P PP P P P PP P P P Sbjct: 251 PPALPLSPMPQGPPPNIP-PSSIYSMPRANDLPPTEMAPTLPQISTSSNGASPSVSPAST 309 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P PP P PP P PP P P P Sbjct: 310 SPSGPAPSIPP-PRPP------ALAPPPPVAPRRNPVVSP 342 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P P P P P P PP PPPP P P P Sbjct: 288 PTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPRPPALAPPPPVAPRRNPVVSP 342 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX---PPPPXXP 795 P P P P P P P P P PPP P PPPP P Sbjct: 276 PRANDLPPTEMAPTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPRPPALAPPPPVAP 334 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P P PPP P P PP P P P Sbjct: 302 PSVSPASTSPSGPAPSIPPPRPPALAPPPPVAPRRNPVVSP 342 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 P P P P PPP P PPPP P P Sbjct: 306 PASTSPSGPAP--SIPPPRPPALAPPPPVAPRRNP 338 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 PP PP P P P P P P P P P PP Sbjct: 264 PPNIPPSSIYSM-PRANDLPPTEMAPTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPR 322 Query: 793 PPXXXXPPP 819 PP PPP Sbjct: 323 PPALAPPPP 331 >AF098992-4|AAK73869.2| 250|Caenorhabditis elegans Hypothetical protein F53C3.6a protein. Length = 250 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGG 663 GG GG G G G GG G GG G GG G G GG GG Sbjct: 23 GGRGRGGGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGG 863 GG G G GGG G G G G G GG GGGG G G Sbjct: 23 GGRGRGGGGGGRGSSGARG-GVGGRGGGGRGGGGGGFRSG 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 764 GGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXG 645 GG GGGG G G G G GG GG G GGG G Sbjct: 23 GGRGRGGGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSGG 62 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 869 GGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGG 741 GG G G GGG G GG GG GGG G GGG GG Sbjct: 23 GGRGRGGGGGGRGSSGARGGV---GGRGGGGRGGGGGGFRSGG 62 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 962 GGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGG 810 GG G GGG G G G GGG GGG G GG GG Sbjct: 23 GGRGRGGGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 857 GGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 GG G G GG GG G G GG G GG GGGG GG GG Sbjct: 23 GGRGRGGGG-----GGRGSSGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 872 GGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGG 756 GG GG GGG G GG GG GGGG G G Sbjct: 23 GGRGRGGGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSG 61 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 976 GGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GG G GGG GG G GG GGGG G GGG G GG Sbjct: 23 GGRGRGGG----GGGRGSSGARGGVGGRGGGGRG-----GGGGGFRSGG 62 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G GG G G G G GG GGG GG GG GG GG Sbjct: 24 GRGRGGGGGGRGS----SGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 35.9 bits (79), Expect = 0.044 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G G GGG G G G GG GG GG GGGG GG GG Sbjct: 24 GRGRGGGGG-GRGSSGARGGVGGRGG-----GGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 908 GXXXXXGGGXGXGG-GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG 759 G GGG G G G GG GG GG GGG GG GG Sbjct: 23 GGRGRGGGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGG 851 GGGGG G G G G G G G G GG GG Sbjct: 29 GGGGGRGSSGARGGVGGRGGGGRGGGGGGFRSGGARSSFSSFRGG 73 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 985 GGGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGGGGXGXXGGXGGGXGXXGGG 830 GGGGG G G GG G G G GGGG GG GG Sbjct: 28 GGGGGGRGSSGARGGVGGRGGG------GRGGGGGGFRSGGARSSFSSFRGG 73 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 825 GGXGXXGXXGXXXGXGGXXXGGGXXGGGGXGXXGXGXGXXXGGGGG 688 GG G G G G GG GGG GGGG G GG Sbjct: 29 GGGGGRGSSGARGGVGGRG-GGGRGGGGGGFRSGGARSSFSSFRGG 73 >AF061513-1|AAC24362.1| 492|Caenorhabditis elegans candidate adaptor protein CED-6 protein. Length = 492 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = +1 Query: 694 PPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PP P P P P P P PPP P P PP P P Sbjct: 243 PPIYPGLGP-PALPLSPMPQGPPPNIPPSSIYSMPRANDLPPTEMAPTLPQISTSSNGAS 301 Query: 874 XPXPPPXXXXXPXXPXPPXXPPPXPXXPPPXPXXP 978 P P P P PP P PP P P Sbjct: 302 PSVSP--ASTSPSGPAPSIPPPRPPALAPPPPVAP 334 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 1/89 (1%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXX 807 PP P P P P PPP P P PP P Sbjct: 243 PPIYPGLGPPALPLSPMPQGPPPNIPPSSIYSMPRANDLPPTEMAPTLPQISTSSNGASP 302 Query: 808 XPPPXXXXPPXP-PPXPPPXPPPXPXPPP 891 P P P P PPP PP PPP Sbjct: 303 SVSPASTSPSGPAPSIPPPRPPALAPPPP 331 Score = 34.7 bits (76), Expect = 0.10 Identities = 28/100 (28%), Positives = 28/100 (28%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPPPXXPPXXXXPPPXXXXPPX 840 PP P P PP P P P PP P P P Sbjct: 251 PPALPLSPMPQGPPPNIP-PSSIYSMPRANDLPPTEMAPTLPQISTSSNGASPSVSPAST 309 Query: 841 PPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPP 960 P P P PP P PP P PP P P P Sbjct: 310 SPSGPAPSIPP-PRPP------ALAPPPPVAPRRNPVVSP 342 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPPP 783 P P P P P P P P PP PPPP P P P Sbjct: 288 PTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPRPPALAPPPPVAPRRNPVVSP 342 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +1 Query: 628 PPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPX---PPPPXXP 795 P P P P P P P P P PPP P PPPP P Sbjct: 276 PRANDLPPTEMAPTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPRPPALAPPPPVAP 334 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 780 PXPXPXPPXPXXPXXXXPPPXXPXPPPXPPXXPXPPPPXPP 902 P P P P PPP P P PP P P P Sbjct: 302 PSVSPASTSPSGPAPSIPPPRPPALAPPPPVAPRRNPVVSP 342 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXP 720 P P P P PPP P PPPP P P Sbjct: 306 PASTSPSGPAP--SIPPPRPPALAPPPPVAPRRNP 338 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = +1 Query: 616 PPXXPPXXPXPXXPXPPPXPXXXXPPPPPXPXPXPXPPXPXPPPPXXPPPXPXPP-PPXX 792 PP PP P P P P P P P P P PP Sbjct: 264 PPNIPPSSIYSM-PRANDLPPTEMAPTLPQISTSSNGASPSVSPASTSPSGPAPSIPPPR 322 Query: 793 PPXXXXPPP 819 PP PPP Sbjct: 323 PPALAPPPP 331 >Z74032-9|CAA98464.2| 80|Caenorhabditis elegans Hypothetical protein F35B12.7 protein. Length = 80 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -3 Query: 818 GGGXXXXGGXXGGGGXGXGGGXXGG-GGXGXGGXGXGXGXGGGGGXXXXGXGGGXG 654 GGG G G GG G GGG GG GG G G G G G GG G GG G Sbjct: 22 GGGPYGGYGPRGYGG-GYGGGRYGGYGGRGPYGGYGGRGPYGYGGRGPYGGGGLVG 76 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -3 Query: 941 GGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGG 774 GGG GG G G GGG GG G G GG GG G G G GGGG Sbjct: 22 GGGPYGGYGPRGYGGGYGGGR-YGGYGGRGPYGGYGGRGPYGYGGR---GPYGGGG 73 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGGGXXG 747 G G GGG GGG GG GG GG GG G GGG G Sbjct: 30 GPRGYGGGYGGGRYGGYGGRGPYGGYGGRGPYGYGGRGPYGGGGLVG 76 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/54 (48%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -3 Query: 890 GGGXGXGG--GXGGGXGGGXGGXXXXGGGXXXXGGXXGGGGXGXGG-GXXGGGG 738 GG G G G GGG GGG G GG GG G G G GG G GGGG Sbjct: 23 GGPYGGYGPRGYGGGYGGGRYGGY---GGRGPYGGYGGRGPYGYGGRGPYGGGG 73 Score = 35.9 bits (79), Expect = 0.044 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = -3 Query: 785 GGGGXGXGGGXXGGGGXGX---GGXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GGG G G GGG G GG G GG GG G GG G G G G Sbjct: 22 GGGPYGGYGPRGYGGGYGGGRYGGYGGRGPYGGYGGRGPYGYGGRGPYGGGGLVGALLG 80 Score = 35.5 bits (78), Expect = 0.058 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 977 GXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGG 840 G G G G GGG GG G G GG G G G GGG Sbjct: 27 GGYGPRGYGGGYGGGRYGGYGGRGPYGGYGGRGPYGYGGRGPYGGG 72 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -1 Query: 982 GGGGXGXGGGXXGXXGGXGXGXGXXXXGGXGG-GGXGXXGGXGG 854 GGG G G G G GG G G G GG G GG G G G Sbjct: 39 GGGRYG-GYGGRGPYGGYG-GRGPYGYGGRGPYGGGGLVGALLG 80 >Z34533-1|CAA84302.3| 730|Caenorhabditis elegans Hypothetical protein B0285.1 protein. Length = 730 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 831 PPPXXPXPPPXPPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPP 962 PPP P P PPPP PP P P PP P PP Sbjct: 190 PPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPP 233 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +1 Query: 739 PPPPXX-----PPPXPXPPPPXXPPXXXXPPPXXXXPPXPPPXPPPXPPP 873 PPPP P PPPP PP P PP PPP P PPP Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTP----PPRPPPAPFSIPPP 234 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 688 PPPPPXPXPXPXPPXPXPPPPXXPPPXPX-PPPPXXPPXXXXPPP 819 PPPP P PPPP PP PPP PP PP Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPP 233 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 661 PPPXPXXXXPPPPPXPXPXPXPPXPXP---PPPXXPPPXPXPPPPXXPPXXXXPPPXXXX 831 PPP P P P P P P PP PPP P PP Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPPPSVDIHFAATASFSL 248 Query: 832 PPXPPPXP 855 PPP P Sbjct: 249 SSIPPPPP 256 Score = 35.5 bits (78), Expect = 0.058 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +1 Query: 640 PXPXXPXPPPXPXXXXPPPPPXPXPXPX---PPXPXPPPPXXPPP 765 P P P P PPPPP P PP P P P PPP Sbjct: 190 PPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPPP 234 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 692 PPPPXXXPXPX-PXXPXPPPPXXPPPXXXPPXPXXXPXXPXXPXPPXXXXXXXXXXXXXX 868 PPPP P P PPPP PP P P P PP Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPPPSVDIHFAATASFSL 248 Query: 869 XXXXXPPP 892 PPP Sbjct: 249 SSIPPPPP 256 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 811 PPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXPXXPXPPXXPPPXPXXPPP 963 PPP P P P PPP P PP PPP P PP Sbjct: 190 PPPSFNINPFQPMFSQPPPPPLP-------PNSQFMTPPPRPPPAPFSIPP 233 Score = 32.3 bits (70), Expect = 0.54 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +1 Query: 775 PPPPXX-----PPXXXXPPPXXXXPPXPPPXPPPXPPPXPXPPPXXXXXP 909 PPPP P PPP PP PP PPP P P P P Sbjct: 189 PPPPSFNINPFQPMFSQPPP----PPLPPNSQFMTPPPRPPPAPFSIPPP 234 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 798 PPXPXXPXXXXPPPXX-PXPPPXPPXXP-XPPPPXPPXXXXPXPXP 929 PP P P P PPP PP PPP PP P P Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPPP 234 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 631 PXXPXPXXPXPPPXP---XXXXPPPPPXPXPXPXPP 729 P P P PPP P PPP P P P PP Sbjct: 198 PFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPP 233 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 864 PPXXPXPPPPXPPXXXXPXPXPXPPXXPXXPPPXPXPPP 980 PP P P P P P PP PP P PPP Sbjct: 189 PPPPSFNINPFQPMFSQPPPPPLPPNSQFMTPP-PRPPP 226 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 619 PXXPPXXPXPXXPXPPPXPXXXXPP-PPPXPXPXPXP 726 P P P P PP PP PPP P P P Sbjct: 198 PFQPMFSQPPPPPLPPNSQFMTPPPRPPPAPFSIPPP 234 >U58748-9|AAB52969.3| 542|Caenorhabditis elegans Hypothetical protein ZK180.5a protein. Length = 542 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/96 (31%), Positives = 30/96 (31%), Gaps = 3/96 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G GG G GG G GG G G G GG Sbjct: 76 GLGGGAAYPGAG-AGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 788 XG---GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G G G GG G G G GG Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAGAPVSAGG 170 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG-GGXGXGGGXXGG--GGXGXGGXG 717 GG G G G GG GG G G GG G GG G G G Sbjct: 75 GGLGGGAAYPGAGAGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 716 XGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG GG G G Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGGXG 717 GG G G GG G G GG G GG G G GG G G G G Sbjct: 79 GGAAYPGAGAGGQYDTGVHGGAQ--GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAG 136 Query: 716 XGXGXGGG-GGXXXXGXGGGXGXXGXG 639 G GG G G G G G Sbjct: 137 AAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G GG G G G Sbjct: 102 GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAGAAQGAQGGYAGAVQGGQIASQGYAG 161 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 G GG G GG Sbjct: 162 AGAPVSAGGSYNQGPAAINGG 182 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G GG G G G GG Sbjct: 98 GGAQGGYAGAQGAQGGYAGAQGAQGGYA--GAQGAQGGYAGAAQGAQGGYAGAVQGGQIA 155 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G G GG G G Sbjct: 156 SQGYAGAGAPVSAGGSYNQGPAAING 181 >U58748-8|AAM97986.1| 497|Caenorhabditis elegans Hypothetical protein ZK180.5b protein. Length = 497 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/96 (31%), Positives = 30/96 (31%), Gaps = 3/96 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G GG G GG G GG G G G GG Sbjct: 76 GLGGGAAYPGAG-AGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 788 XG---GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G G G GG G G G GG Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAGAPVSAGG 170 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG-GGXGXGGGXXGG--GGXGXGGXG 717 GG G G G GG GG G G GG G GG G G G Sbjct: 75 GGLGGGAAYPGAGAGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 716 XGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG GG G G Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGGXG 717 GG G G GG G G GG G GG G G GG G G G G Sbjct: 79 GGAAYPGAGAGGQYDTGVHGGAQ--GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAG 136 Query: 716 XGXGXGGG-GGXXXXGXGGGXGXXGXG 639 G GG G G G G G Sbjct: 137 AAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G GG G G G Sbjct: 102 GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAGAAQGAQGGYAGAVQGGQIASQGYAG 161 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 G GG G GG Sbjct: 162 AGAPVSAGGSYNQGPAAINGG 182 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G GG G G G GG Sbjct: 98 GGAQGGYAGAQGAQGGYAGAQGAQGGYA--GAQGAQGGYAGAAQGAQGGYAGAVQGGQIA 155 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G G GG G G Sbjct: 156 SQGYAGAGAPVSAGGSYNQGPAAING 181 >U58748-7|AAM97987.1| 399|Caenorhabditis elegans Hypothetical protein ZK180.5c protein. Length = 399 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/96 (31%), Positives = 30/96 (31%), Gaps = 3/96 (3%) Frame = -3 Query: 968 GXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGX 789 G GGG G G GG G GG G GG G G G GG Sbjct: 76 GLGGGAAYPGAG-AGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 788 XG---GGGXGXGGGXXGGGGXGXGGXGXGXGXGGGG 690 G G G G GG G G G GG Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAGAPVSAGG 170 Score = 37.1 bits (82), Expect = 0.019 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 3/89 (3%) Frame = -3 Query: 887 GGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG-GGXGXGGGXXGG--GGXGXGGXG 717 GG G G G GG GG G G GG G GG G G G Sbjct: 75 GGLGGGAAYPGAGAGGQYDTGVHGGAQGGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGY 134 Query: 716 XGXGXGGGGGXXXXGXGGGXGXXGXGXXG 630 G G GG GG G G Sbjct: 135 AGAAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG--GGXGXGGGXXGGGGXGXGGXG 717 GG G G GG G G GG G GG G G GG G G G G Sbjct: 79 GGAAYPGAGAGGQYDTGVHGGAQ--GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAG 136 Query: 716 XGXGXGGG-GGXXXXGXGGGXGXXGXG 639 G GG G G G G G Sbjct: 137 AAQGAQGGYAGAVQGGQIASQGYAGAG 163 Score = 35.1 bits (77), Expect = 0.077 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G G G G GG G G GG G G G Sbjct: 102 GGYAGAQGAQGGYAGAQGAQGGYAGAQGAQGGYAGAAQGAQGGYAGAVQGGQIASQGYAG 161 Query: 800 XGGXXGGGGXGXGGGXXGGGG 738 G GG G GG Sbjct: 162 AGAPVSAGGSYNQGPAAINGG 182 Score = 34.7 bits (76), Expect = 0.10 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXX 801 GG G G G GG G G G G GG G G G GG Sbjct: 98 GGAQGGYAGAQGAQGGYAGAQGAQGGYA--GAQGAQGGYAGAAQGAQGGYAGAVQGGQIA 155 Query: 800 XGGXXGGGGXGXGGGXXGGGGXGXGG 723 G G G GG G G Sbjct: 156 SQGYAGAGAPVSAGGSYNQGPAAING 181 >U42841-13|AAC48170.1| 682|Caenorhabditis elegans Hypothetical protein T17H7.1 protein. Length = 682 Score = 40.7 bits (91), Expect = 0.002 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 5/126 (3%) Frame = -3 Query: 980 GGXXGXGGGXXGXGGGXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXG----- 816 GG G G G G G G G G G G G GG G G Sbjct: 478 GGPEGRDGRGQGPDFGP-GSQGGRGQDSDSGSQDAFPGRRGSGGPGGRGQGPDFGPQDDF 536 Query: 815 GGXXXXGGXXGGGGXGXGGGXXGGGGXGXGGXGXGXGXGGGGGXXXXGXGGGXGXXGXGX 636 G GG G G G G G G G G G GG G G G Sbjct: 537 PGRRGSGGPEGRDGRGQGPDFGPGSQGGRGQDSDSGSQDAFPGRRGPGGPGGLGGRGQGP 596 Query: 635 XGGXXG 618 G G Sbjct: 597 DFGPGG 602 Score = 38.3 bits (85), Expect = 0.008 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 2/115 (1%) Frame = -3 Query: 956 GXXGXGG-GXXGGXGXXGXXXXXGGGXGXGGGXGGGXGGGXGGXXXXGGGXXXXGGXXGG 780 G G GG G GG G G G G G GG G G G G Sbjct: 337 GRRGSGGPGGRGGRGQGPDFEPQDDFPGRRGSGGPGRRGGRGQGPDFGPQDDFPG-RRGS 395 Query: 779 GGXGXGGGXXGGGGXGXG-GXGXGXGXGGGGGXXXXGXGGGXGXXGXGXXGGXXG 618 GG G G GG G G G G G G G G G G GG G Sbjct: 396 GGPG------GRGGRGQGPDFGPGRQGGRGQGPDFGPQDDFSGRRGSGGPGGRGG 444 Score = 35.5 bits (78), Expect = 0.058 Identities = 34/104 (32%), Positives = 34/104 (32%), Gaps = 12/104 (11%) Frame = -3 Query: 890 GGGXGXGGGXGGGXGGGXG-GXXXXGGGXXXXGGXXGGGGXGXGGGXXGG---------- 744 GG G G G G GG G G G G G GG G GG G Sbjct: 304 GGRGGRGQGPDFGPGGQGGRGQGPDFGPQDDFPGRRGSGGPGGRGGRGQGPDFEPQDDFP 363 Query: 743 GGXGXGGXGXGXGXGGGGG-XXXXGXGGGXGXXGXGXXGGXXGG 615 G G GG G G G G G G G G GG G Sbjct: 364 GRRGSGGPGRRGGRGQGPDFGPQDDFPGRRGSGGPGGRGGRGQG 407 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,002,977 Number of Sequences: 27780 Number of extensions: 1020108 Number of successful extensions: 80841 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22086 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2563248310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -