SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_M19
         (1347 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholo...    24   3.0  

>AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholog
           protein.
          Length = 406

 Score = 23.8 bits (49), Expect = 3.0
 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%)
 Frame = +1

Query: 622 LXPLPA-PPXXXLLXXPPPXXXPPXLPLSP 708
           + P PA PP   L    PP    P LPL P
Sbjct: 158 IDPGPALPPTGFLCNNYPPLPQVPPLPLPP 187


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,552
Number of Sequences: 336
Number of extensions: 1400
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 59
effective length of database: 102,761
effective search space used: 39974029
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -