BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M18 (945 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 25 0.86 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 24 1.5 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 24 2.0 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 8.0 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 8.0 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 25.0 bits (52), Expect = 0.86 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 332 LPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMN 469 L ++ FS+F K R A L +F ++ + A YAR +N Sbjct: 74 LERDANFSLFIPKHRRIAGRLIDIFLGMRNVDDLLSVAVYARDRVN 119 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 449 SMLFCRNIQNLWHNRTA*TARWLLPS 372 S FC N+Q + N+ + T W LP+ Sbjct: 205 SYQFCDNLQYSFDNQCSGTIDWALPN 230 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 449 SMLFCRNIQNLWHNRTA*TARWLLP 375 S FC N+Q + N+ + T W LP Sbjct: 196 SYQFCDNLQYSFDNQCSGTIDWALP 220 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 694 CXXPIPXPXTYP 729 C PIP P YP Sbjct: 29 CLAPIPQPPAYP 40 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 694 CXXPIPXPXTYP 729 C PIP P YP Sbjct: 29 CLAPIPQPPAYP 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,036 Number of Sequences: 336 Number of extensions: 3475 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26582281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -