BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M16 (1009 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 24 1.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 4.9 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 6.5 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 24.2 bits (50), Expect = 1.6 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = +1 Query: 166 RRDAPDFFKDIEH-----HTKEFHKT--LEQQFNSLTKS 261 RR AP F+DI+H + +E +T L + F SL KS Sbjct: 84 RRKAPQSFEDIQHQRVMANVRERQRTQSLNEAFASLRKS 122 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.4 bits (48), Expect = 2.8 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 278 KSCASFDLVSELNCCSKVLWNS-LVWCSMSLKKSGASRRTIAPWARA 141 KS A+FD V+ + +LW S L + K +R I W A Sbjct: 418 KSLAAFDFVARNSDTPIILWTSHLTQADVIEKYLSKARYVIQTWVPA 464 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 269 ASFDLVSELNCCSKVLWNSLV 207 A D SE++C S+ +W+ L+ Sbjct: 102 ALLDTGSEVSCISEEVWSKLI 122 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 126 SLRLHRSGPRSDGATRRS-RLLQGHR 200 ++RL R+GPR++ A R++ HR Sbjct: 179 NIRLKRAGPRTESAVYEPVRIMGVHR 204 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,904 Number of Sequences: 336 Number of extensions: 2430 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28754374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -