BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M14 (924 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 24 1.9 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 23 3.4 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 5.9 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 7.8 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.8 bits (49), Expect = 1.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 359 ADANGYQPSGAHLPTTPAPXPNPRLHRPGHRVHQN 463 A A Y+P AH P +P L+ H H N Sbjct: 21 AGAGLYEPHVAHRPGLQGLHHSPHLNHAMHPYHAN 55 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 111 QSEEDVSSHFECVCVNGRC 55 +SE + S+FEC+ G+C Sbjct: 33 KSERLMKSYFECLLGTGKC 51 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 314 PLEPWTAMDASSRPSFTSA 258 P E W M A+ P+FTS+ Sbjct: 80 PGEKWKEMRATLSPAFTSS 98 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.8 bits (44), Expect = 7.8 Identities = 16/64 (25%), Positives = 24/64 (37%) Frame = +2 Query: 338 PIQITYIADANGYQPSGAHLPTTPAPXPNPRLHRPGHRVHQNSPTQARGRPTYLSYMIVD 517 P+ TY D Q +G L + R HR +N R R Y+ + V Sbjct: 231 PLLFTYTDDGKNQQRTGTELTKMRPKRQSSRRHR------KNLKDPCRRRQMYVDFGSVG 284 Query: 518 KDDY 529 +D+ Sbjct: 285 WNDW 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,767 Number of Sequences: 336 Number of extensions: 3172 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25858250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -