BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M13 (860 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038611-9|AAB92041.2| 180|Caenorhabditis elegans Ribosomal pro... 163 2e-40 >AF038611-9|AAB92041.2| 180|Caenorhabditis elegans Ribosomal protein, large subunitprotein 20 protein. Length = 180 Score = 163 bits (395), Expect = 2e-40 Identities = 72/134 (53%), Positives = 96/134 (71%), Gaps = 1/134 (0%) Frame = +3 Query: 105 KAKGQ-LREYEVIGRKLPSENEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGX 281 KA G+ L EY V+GRK+P+E EP P++KM+IF+ + ++AKSRFWYF+ L++ KK G Sbjct: 4 KALGETLNEYVVVGRKIPTEKEPVTPIWKMQIFATNHVIAKSRFWYFVSMLRRVKKANGE 63 Query: 282 XXXXXXXXXXXXXXXXNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRAR 461 N+G+WL+Y+SR+G HNMYREYRD +V GAVTQCYRDMGARHRA+ Sbjct: 64 ILSIKQVFEKNPGTVKNYGVWLKYDSRTGHHNMYREYRDTTVAGAVTQCYRDMGARHRAQ 123 Query: 462 AHSIQIIKVEVIKA 503 A I I+KV+ +KA Sbjct: 124 ADRIHILKVQTVKA 137 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 514 RRPQVKQFHNSTIRFPLXKRV 576 +R +K FH++ IRFPL RV Sbjct: 141 KRAGIKMFHDAKIRFPLPHRV 161 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,855,944 Number of Sequences: 27780 Number of extensions: 267332 Number of successful extensions: 655 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -