BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_M05 (985 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L23650-1|AAA27955.1| 1076|Caenorhabditis elegans Egg laying defe... 73 4e-13 >L23650-1|AAA27955.1| 1076|Caenorhabditis elegans Egg laying defective protein 45 protein. Length = 1076 Score = 72.5 bits (170), Expect = 4e-13 Identities = 37/85 (43%), Positives = 54/85 (63%) Frame = +2 Query: 215 YGQRPENALKRANEFMDLDKPARALDTLQEVFRNXKWAYNWSESVLQPIXFXYLELCVDL 394 Y Q+PE ALKRA E + + K + ALDTL + + + W+ +V + I ++ELCVDL Sbjct: 5 YFQKPEAALKRAEELIQVGKESDALDTLHDTIKARRHK-QWT-TVHEQIMIKHMELCVDL 62 Query: 395 RKSHVAXEGLFQYRNXFQSVNVGSL 469 +K H+A + LFQY+ Q +NV SL Sbjct: 63 KKQHLAKDALFQYKALTQQINVKSL 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,011,068 Number of Sequences: 27780 Number of extensions: 362178 Number of successful extensions: 765 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2563248310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -