BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L22 (1018 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 32 0.016 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 35 0.12 03_01_0515 - 3864796-3865425 35 0.12 06_03_0790 - 24636805-24637770 34 0.21 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 33 0.36 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 32 0.64 07_01_0080 + 587674-588510 32 0.64 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 32 0.64 01_06_0146 + 26969011-26969995,26970878-26970930 32 0.64 03_06_0733 + 35825541-35826052,35826728-35826871,35828638-358287... 32 0.84 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 0.84 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.1 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.1 02_01_0016 + 110796-110979,111252-111768,111847-112213 31 1.1 10_08_0216 - 15942379-15942852,15942956-15943033 31 1.5 08_02_1615 + 28257275-28258428,28258523-28259144 31 1.5 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.5 04_04_1413 - 33386049-33386339 31 1.5 01_02_0031 + 10364487-10365407 31 1.5 12_02_0299 - 17051570-17052474,17053542-17053755 31 1.9 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.9 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.9 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 31 1.9 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 31 1.9 12_02_1174 - 26696869-26698191 30 2.6 08_02_0796 - 21300251-21300373,21300846-21301721 30 2.6 09_06_0081 + 20745627-20748144,20748211-20748308 30 3.4 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 30 3.4 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 30 3.4 05_01_0380 + 2978256-2979284 30 3.4 09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 29 4.5 07_01_0516 - 3850252-3852870 29 4.5 06_01_0486 - 3455030-3455770 29 4.5 04_04_1542 - 34264994-34265331,34266195-34267029 29 4.5 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 4.5 02_04_0400 - 22608519-22608844,22609044-22609122 29 4.5 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 5.9 07_03_1751 - 29215074-29216270 29 5.9 07_03_0154 + 14509979-14512033 29 5.9 04_04_1125 + 31085106-31085714 29 5.9 04_03_1022 - 21778315-21779007 29 5.9 04_03_0904 + 20717005-20718087 29 5.9 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 5.9 01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346,840... 29 5.9 01_01_0713 + 5529497-5530107,5530297-5530339,5530594-5530677,553... 29 5.9 01_01_0073 + 555485-556315 29 5.9 01_01_0070 - 542603-542686,542803-543441 29 5.9 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 24 6.9 11_01_0385 + 2915532-2916482 25 7.1 12_02_1114 - 26171876-26172493 29 7.9 08_01_0059 - 394001-394708 29 7.9 07_03_0177 - 14770777-14772045 29 7.9 06_01_0178 + 1386981-1387505 29 7.9 05_05_0354 - 24347550-24347870 29 7.9 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 29 7.9 04_04_1582 - 34590698-34591199,34593849-34594690 29 7.9 02_05_0814 - 31970558-31971126,31971242-31971413 29 7.9 02_04_0021 + 18975992-18976408 29 7.9 02_02_0363 + 9446055-9446524,9446658-9446771,9446856-9447281,944... 29 7.9 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 32.3 bits (70), Expect(2) = 0.016 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXP 724 AG A PP HPA PAPPPP P Sbjct: 316 AGTGAPPPPPAHPAA--PAPPPPAP 338 Score = 25.4 bits (53), Expect(2) = 3.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXP 724 AGG P PA P PPP P Sbjct: 267 AGGGQVPAAPPPPAGPPPPAPPPLP 291 Score = 24.2 bits (50), Expect(2) = 0.016 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 701 PAPPPPXPXXPXPXXQTPXXP 763 P PPP P P P P P Sbjct: 351 PPPPPAAPAAPRPPGPGPGPP 371 Score = 23.0 bits (47), Expect(2) = 3.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 701 PAPPPPXPXXPXPXXQTP 754 P PPP P P P P Sbjct: 321 PPPPPAHPAAPAPPPPAP 338 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P+ P PPPP P P P P P Sbjct: 1173 PPLSPSLPPPPPPPPLPSGPPPQPAPPPLP 1202 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 +G + PP P P PPPP P P P P Sbjct: 1190 SGPPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P+ PPP P P Q P P Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPPLPIQPPPIP 1209 >03_01_0515 - 3864796-3865425 Length = 209 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPPP P P P +P P Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 A G PP P+ PPPP P P P +P P Sbjct: 65 AAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 >06_03_0790 - 24636805-24637770 Length = 321 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 753 GVWXXGXGXXGXGGGGAGXXXAGCXGG 673 GVW G G G GGGG G G GG Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGG 104 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.1 bits (72), Expect = 0.36 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP PAPPPP P P P P P Sbjct: 753 PPLMTGKKAPAPPPPPPQAPKPPGTVPPPP 782 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXP-XPXXQTPXXP 763 PP P P+PPPP P P P P P Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPP 621 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = +2 Query: 674 PPXHPAXXXPA---PPPPXPXXPXPXXQT 751 PP P+ PA PPPP P P P Q+ Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQS 578 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPPP P P P P Sbjct: 609 PPILPNRSVPPPPPPPPPLPNHSVLPPPPP 638 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXP 739 TPP P P PPPP P P P Sbjct: 78 TPPSPPPPPPPPPPPPPPLSPTP 100 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 PP P PPPP P P P TP Sbjct: 74 PPPQTPPSPPPPPPPPPPPPPPLSPTP 100 >07_01_0080 + 587674-588510 Length = 278 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 PP P+ P PPPP P P P P Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 653 GGXARXTPPXHPAXXXPAPPPPXPXXPXPXXQTP 754 G R PP P +PPPP P P P P Sbjct: 86 GMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 656 GXARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 G R PP P PPP P P P P P Sbjct: 86 GMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGG 673 G G G G G GGGG G GC GG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGG 74 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 R PP PA PAPP P P P P P P Sbjct: 100 RAAPPPAPAPDQPAPPSPPPSLP-PSPPAPGSP 131 >03_06_0733 + 35825541-35826052,35826728-35826871,35828638-35828709, 35829232-35829739 Length = 411 Score = 31.9 bits (69), Expect = 0.84 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXPXXQTP 754 TP HP+ P PPPP P P P Sbjct: 38 TPHHHPSPLHPLPPPPMPQAPHQYYPAP 65 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.9 bits (69), Expect = 0.84 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXPXXP 733 +GG R PP P APPPP P P Sbjct: 261 SGGPPRPPPPQVPPPPPQAPPPPPPNAP 288 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 650 AGGXARXTPPXHPAXXXPAPPPPXPXXPXP 739 AG + PP P PPPP P P P Sbjct: 249 AGAEDKRAPPPQSVRPPPPPPPPPPPPPMP 278 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXP 739 TPP PA P P PP P P P Sbjct: 98 TPPPPPASISPTPAPPLPPPPAP 120 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXP 733 R TPP P P PPPP P P Sbjct: 204 RPTPPSLPVDTMPPPPPPPPPQP 226 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 753 GVWXXGXGXXGXGGGGAGXXXAGCXGGVXRAXPP 652 G + G G G GGGG G G GG +A P Sbjct: 106 GPYASGGGGGGAGGGGGGGYGYGAGGGYGQAGGP 139 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 671 TPPXHPAXXXPA---PPPPXPXXPXPXXQTPXXP 763 +P HP PA PPPP P P P P P Sbjct: 44 SPQSHPQPDAPAAAAPPPPAPLTPPPPKSPPPPP 77 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 677 PXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 P P P PPPP P P P P P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLP 453 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPPP P P P P Sbjct: 427 PPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 >04_04_1413 - 33386049-33386339 Length = 96 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 738 GXGXXGXGGGGAGXXXAGCXGG 673 G G G GGGG G GC GG Sbjct: 68 GGGGGGCGGGGGGGGGGGCGGG 89 >01_02_0031 + 10364487-10365407 Length = 306 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +2 Query: 656 GXARXTPPXHPAXXXPAPPPP----XPXXPXPXXQTPXXP 763 G PP P PAPPPP P P P TP P Sbjct: 164 GQVLVPPPPPPPPALPAPPPPPAPMLPLAPPPTHVTPAMP 203 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 TPP P P P PP P P P P P Sbjct: 251 TPPSPPPPAFPFPLPPWPWAPPPAFPFPHLP 281 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P PPPP P P P P P Sbjct: 311 PPLPSFYPSPPPPPPPPPPPPPSFPWPFPP 340 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXP-XXPXPXXQTPXXP 763 P P P+PPPP P P P Q P P Sbjct: 278 PHLPPIFSPPSPPPPPPPAFPFPFPQLPPLP 308 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 P +P+ P PPPP P P P P Sbjct: 314 PSFYPSPPPPPPPPPPPPPSFPWPFPPLAP 343 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXP 739 PP P P PPPP P P P Sbjct: 112 PPPSPPPSAPPPPPPPPTQPPP 133 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P PPPP P P P P P Sbjct: 97 PPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 662 ARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 A PP P P PPPP P P + P P Sbjct: 323 AAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPP 356 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 662 ARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 A PP P P PPP P P P P P Sbjct: 324 AAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 674 PPXHPAXXXPAPPPP---XPXXPXPXXQTPXXP 763 PP PA P PPPP P P P P P Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P APPPP P P P P Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGP 344 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXP 739 PP PA P PPPP P P Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPP 366 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPPP P P P + P Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 P P P PPPP P P P P P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 686 PAXXXPAPPPPXPXXPXPXXQTPXXP 763 P P PPPP P P P P P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPP 379 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P+PPPP P P P P Sbjct: 124 PPQPPRAWDPSPPPPPPAPAAPVLVPPPAP 153 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPP--PXPXXPXPXXQTPXXP 763 R PP P P PPP P P P P P P Sbjct: 134 RVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPP 168 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 P P+ P PPPP P P P P Sbjct: 146 PQPPPSLPPPPPPPPPPPPPRPPSVKP 172 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXP 739 PP P P PPPP P P P Sbjct: 94 PPSPPLLALPPPPPPPPPPPPP 115 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 662 ARXTPPXHPAXXXPAPPPPXPXXPXPXXQTP 754 A +PP P PPPP P P P P Sbjct: 93 APPSPPLLALPPPPPPPPPPPPPPQPQQHLP 123 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 662 ARXTPPXHPAXXXPAPPPPXPXXPXPXXQTP 754 +R + P P PAPP P P P P P Sbjct: 429 SRASAPTVPTPLVPAPPVPTPHAPAPPADVP 459 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 29.9 bits (64), Expect = 3.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 671 TP-PXHPAXXXPAPPPP----XPXXPXPXXQTPXXP 763 TP P H A P PPPP P P P TP P Sbjct: 46 TPAPRHAATPPPPPPPPTPAVEPTLPIPPASTPPTP 81 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP H A P PPPP P P P P Sbjct: 1926 PPPH-APPPPPPPPPVEGKPKPPPHAPPPP 1954 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 686 PAXXXPAPPPPXPXXPXPXXQTPXXP 763 P P PPPP P P P + P P Sbjct: 26 PPPPPPPPPPPPPPPPRPFSRKPSEP 51 >09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 Length = 883 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 677 PXHPAXXXPAPPPPXPXXPXPXXQTP 754 P PA PAPP P P P P P Sbjct: 361 PRAPAPPVPAPPAPTPPIPTPPALAP 386 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXPXPXXQTP 754 R PP P P PPPP P P P Sbjct: 13 RLLPPQPPPTSRPLPPPPPPPPPAHGPSPP 42 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPP P P P P P Sbjct: 125 PPPTPPSPPPYVPPPTPPSPPPYVPPPSPP 154 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P PPP P P P P P Sbjct: 113 PPYIPPPTPPYVPPPTPPSPPPYVPPPTPP 142 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 PP P P PP P P P P +P Sbjct: 118 PPTPPYVPPPTPPSPPPYVPPPTPPSP 144 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 671 TPPXHPAXXXPAPPP--PXPXXPXPXXQTP 754 TPP P P+PPP P P P P P Sbjct: 120 TPPYVPPPTPPSPPPYVPPPTPPSPPPYVP 149 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 653 GGXARXTPPXHPAXXXPAPPPPXPXXPXP 739 G TPP P P PPPP P P P Sbjct: 210 GATIAPTPPP-PPLALPLPPPPPPSPPKP 237 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 R P + P PPPP P P P T P Sbjct: 341 RPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKP 373 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGGVXRAXPP 652 G G G G G GGGG G G GG PP Sbjct: 60 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 656 GXARXTPPXHPAXXXPAPPPPXPXXPXP 739 G + PP H P PPPP P P Sbjct: 135 GPGQEPPPPHVPKAAPPPPPPPPPHAPP 162 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +2 Query: 671 TPPXHPAXXXPAPP-PPXPXXPXPXXQTPXXP 763 +P HPA P PP P P P P P P Sbjct: 229 SPHRHPAAHPPPPPHHPAPRPPPPMAAAPRQP 260 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGG 673 G G G G G GGGGAG G GG Sbjct: 118 GKGGGLGGGGGLGGGGGGGAGGGLGGGAGG 147 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 686 PAXXXPAPPPPXPXXPXPXXQ 748 PA P PPPP P P P Q Sbjct: 49 PAAAPPPPPPPPPPPPPPQVQ 69 >04_04_1125 + 31085106-31085714 Length = 202 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP P P P P P P P TP P Sbjct: 66 PPATPTPPTPTPWTPTPATPPPTPATPATP 95 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 TP P P P P P P P TP P Sbjct: 55 TPTTPPTPWTPPPATPTPPTPTPWTPTPATP 85 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXP-XPXXQTPXXP 763 R PP A P PPPP P P P P P Sbjct: 24 RARPPCSSAHLLPPPPPPPPPPPYVPPHLLPPSP 57 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 TPP + P PPP P P P TP P Sbjct: 81 TPPTYTPTPKPTPPPYTP-KPTPPAHTPTPP 110 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 PP P P+PPPP P P P +P Sbjct: 86 PPSSPPP--PSPPPPPPSSPPPVPPSP 110 >01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346, 8405434-8405493,8405721-8406137,8406576-8407100 Length = 761 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 738 GXGXXGXGGGGAGXXXAGCXGGVXR 664 G G G GGGG G G GG R Sbjct: 52 GGGGGGGGGGGGGGERVGAVGGAVR 76 >01_01_0713 + 5529497-5530107,5530297-5530339,5530594-5530677, 5532580-5532609 Length = 255 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 732 GXXGXGGGGAGXXXAGCXGGVXRAXPPA 649 G G GG GAG AG GG A PPA Sbjct: 89 GFFGPGGAGAGFAAAG--GGAAAAAPPA 114 >01_01_0073 + 555485-556315 Length = 276 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGGV 670 G G G G GGG G +GC GGV Sbjct: 190 GGGGTVAGGGTATGGAGGGEGGGESGCGGGV 220 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTP 754 PP PA PPPP P P TP Sbjct: 71 PPVAPAVAPVTPPPPTPKKAPPPPVTP 97 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 23.8 bits (49), Expect(2) = 6.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 686 PAXXXPAPPPPXPXXP 733 P P PPPP P P Sbjct: 321 PESERPTPPPPPPPLP 336 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 707 PPPPXPXXPXPXXQ 748 PPPP P P P Q Sbjct: 329 PPPPPPLPPTPVAQ 342 >11_01_0385 + 2915532-2916482 Length = 316 Score = 25.0 bits (52), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPP 715 R PP P PAPPP Sbjct: 129 RHAPPDQPELSPPAPPP 145 Score = 22.2 bits (45), Expect(2) = 7.1 Identities = 10/24 (41%), Positives = 11/24 (45%), Gaps = 3/24 (12%) Frame = +2 Query: 701 PAPP---PPXPXXPXPXXQTPXXP 763 P PP PP P P P + P P Sbjct: 181 PLPPFNQPPTPEWPHPGNKWPPLP 204 >12_02_1114 - 26171876-26172493 Length = 205 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGGVXR 664 G G G G G GGGG G G GG R Sbjct: 58 GGSGSGGGGGGGGGGGGGGGGGGGGGGGGGSWR 90 >08_01_0059 - 394001-394708 Length = 235 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 674 PPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 PP A PA PPP P P P P Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRP 34 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 665 RXTPPXHPAXXXPAPPPPXPXXPXP 739 R PP P P PP P P P P Sbjct: 23 RAPPPPSPPIRPPPPPTPRPYAPPP 47 >07_03_0177 - 14770777-14772045 Length = 422 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGG 673 G G + G G G GGGG G G GG Sbjct: 391 GKGGGFGFGVGGGGFGGGGGGGGGGGGIGG 420 >06_01_0178 + 1386981-1387505 Length = 174 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 762 GXXGVWXXGXGXXGXGGGGAGXXXAGCXGG 673 G G G G G GGGG G AG GG Sbjct: 30 GGRGGASGGGGGGGGGGGGGGGGGAGGKGG 59 >05_05_0354 - 24347550-24347870 Length = 106 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 753 GVWXXGXGXXGXGGGGAGXXXAGCXGGVXR 664 G G G G GGGG G G GG R Sbjct: 25 GALCRGGGRGGKGGGGGGGKGGGGRGGAGR 54 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +2 Query: 665 RXTPPXHPAXXXPAP-PPPXPXXPXP 739 R +PP P P+P PPP P P P Sbjct: 35 RPSPPPPPPSPVPSPAPPPPPHRPSP 60 >04_04_1582 - 34590698-34591199,34593849-34594690 Length = 447 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 738 GXGXXGXGGGGAGXXXAGCXGGVXR 664 G G G GGGG +GC GG R Sbjct: 140 GGGRGGGGGGGGEEGLSGCGGGWTR 164 >02_05_0814 - 31970558-31971126,31971242-31971413 Length = 246 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 653 GGXARXTPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 GG + + P P P P P P P P P P Sbjct: 139 GGGSTPSSPSSPTPTTPNPSTPTPTTPYPSTPMPTTP 175 >02_04_0021 + 18975992-18976408 Length = 138 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 671 TPPXHPAXXXPAPPPPXPXXPXPXXQTPXXP 763 TPP P P PPPP P P P +P P Sbjct: 96 TPP--PPKPKPTPPPPAP-TPKPPAPSPSPP 123 >02_02_0363 + 9446055-9446524,9446658-9446771,9446856-9447281, 9447812-9447893,9447964-9448020,9448633-9448881, 9448978-9449109,9449163-9449291 Length = 552 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 701 PAPPPPXPXXPXPXXQTP 754 P PPPP P P P Q P Sbjct: 103 PTPPPPPPTQPQPEQQKP 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,256,171 Number of Sequences: 37544 Number of extensions: 216575 Number of successful extensions: 5794 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4332 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2998973440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -