Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_L21
         (942 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    22   8.0  
AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholo...    22   8.0  

>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 13/47 (27%), Positives = 21/47 (44%)
 Frame = +1

Query: 169 RTRLGDAIDKTSLKILKESYNLADDKNVIASPLGVMLLLSLYESGAG 309
           +  L  A+D     +L   +NL   K+ IA P    ++L L  +  G
Sbjct: 619 KINLKHALDLDRQGLLHRQFNLPPAKDTIAVPNNGYVVLRLRANNPG 665


>AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholog
           protein.
          Length = 406

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -3

Query: 355 PPLPQGFPLSLP 320
           PPLPQ  PL LP
Sbjct: 175 PPLPQVPPLPLP 186


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,282
Number of Sequences: 336
Number of extensions: 3617
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 26478848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)