BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L19 (914 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.60 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 27 1.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.8 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 9.8 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 27.5 bits (58), Expect = 0.60 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -2 Query: 889 GGGGXXXGXXXKXXXGGGXXXEXGXXXXXXXGXPXGXXQSXXGGXGXKGGXGXXG 725 GGGG G G G G G S GG G GG G G Sbjct: 518 GGGGGSGCVNGSRTVGAGGMAGGGSDGPEYEGAGRGGVGSGIGGGGGGGGGGRAG 572 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 26.6 bits (56), Expect = 1.0 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +3 Query: 717 PXHPXXPXPPXS-PXPPX-QL*XXPXGXPXXXXXXXPXSXXXPPPXXXXXXXPXXXPPPP 890 P P P P P PP + P P P PP P PPP Sbjct: 206 PTQPQPPRPGGMYPQPPGVPMPMRPQMPPGAVPGMQPGMQPRPPSAQGMQRPPMMGQPPP 265 Query: 891 XXXPXP 908 P P Sbjct: 266 IRPPNP 271 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.8 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +3 Query: 726 PXXPXPPXSPXPPXQL*XXPXGXPXXXXXXXP---XSXXXPPPXXXXXXXPXXXP-PPPX 893 P P PP PP L P G P P PP P P P P Sbjct: 583 PAPPPPPPMGPPPSPLAGGPLGGPAGSRPPLPNLLGFGGAAPPVTILVPYPIIIPLPLPI 642 Query: 894 XXPXP 908 P P Sbjct: 643 PVPIP 647 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 9.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 406 NATRYTTWPSCWN 444 N T Y +WPS W+ Sbjct: 195 NRTLYMSWPSSWS 207 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,016 Number of Sequences: 2352 Number of extensions: 12199 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99228240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -