BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L13 (948 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 2.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.5 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 3.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 6.1 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 2.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 671 PPPPPPP 691 PPPPPPP Sbjct: 731 PPPPPPP 737 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 3.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 143 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 271 P K + ++ + S P TT +T T STT T TV Sbjct: 1157 PGHKPSTSSWQKPTKPSYRPPSTTNHWQTKTTTSTTTRPTTTV 1199 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 644 PXXPPXXXXPPPPPPPXXPXLPXXPXP 724 P P PP PP P LP P Sbjct: 1367 PEWQPTEWHPPIPPTSEKPPLPEELKP 1393 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.0 bits (47), Expect = 3.5 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -3 Query: 724 GXGXXGXGGGXGGGXXGXXXGGXG 653 G GGG GGG G G G Sbjct: 85 GENNDDSGGGRGGGRDGDRGDGGG 108 Score = 21.8 bits (44), Expect = 8.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 692 GGGXXGXXXXXXGXGGGDXXSR 627 GGG G G GGG+ R Sbjct: 92 GGGRGGGRDGDRGDGGGEEKKR 113 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 653 PPXXXXPPPPPPPXXPXLPXXP 718 PP PP P PP P P Sbjct: 175 PPLPQVPPLPLPPIFPPTMINP 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,084 Number of Sequences: 336 Number of extensions: 4053 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26685714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -