BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L10 (952 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) 32 0.59 SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) 32 0.59 SB_36576| Best HMM Match : FerB (HMM E-Value=9) 32 0.78 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_41062| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) 31 1.4 SB_6685| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) 31 1.4 SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) 30 3.2 SB_33706| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 29 5.5 SB_26758| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) 29 7.3 SB_22048| Best HMM Match : RHS_repeat (HMM E-Value=0.00058) 29 7.3 SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) 28 9.6 SB_32532| Best HMM Match : RHS_repeat (HMM E-Value=3.2e-06) 28 9.6 SB_11978| Best HMM Match : Myb_DNA-binding (HMM E-Value=8e-21) 28 9.6 SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) 28 9.6 SB_19358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.5 bits (78), Expect = 0.064 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 10/69 (14%) Frame = -3 Query: 335 YLRFGSSC-TSSIFEG---RIG-WSA-----VLGARGTLSP*YSHSGSWPACRTVRVIGR 186 ++ FG SC I G +G W + ++ G +S H GSW +CR + ++ Sbjct: 78 HVEFGGSCRVLGIMSGCGNHVGSWESCRVVGIMSGCGIMSSPGDHVGSWGSCRVLGIMSG 137 Query: 185 CVGGGLKVG 159 C GGGL++G Sbjct: 138 C-GGGLRIG 145 >SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) Length = 1136 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Frame = +1 Query: 247 DNVPRAPSTADHPI--LPSKIDDV--QLDPNRRYVRSVTNPENNEASIEHS-HHTVDIGL 411 + + RA ADH I + K+D QLD N +Y++ + NP+ + ++ V Sbjct: 253 EEIERAKVAADHLISEVKDKLDIAKEQLDDNAKYIKCLENPDEADKYVKQKIQQRVKRTA 312 Query: 412 DQPIESHR 435 + +ESHR Sbjct: 313 ENLVESHR 320 >SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) Length = 1487 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 5/68 (7%) Frame = +1 Query: 247 DNVPRAPSTADHPI--LPSKIDDV--QLDPNRRYVRSVTNPENNEASIEHS-HHTVDIGL 411 + + RA ADH I + K+D QLD N +Y++ + NP+ + ++ V Sbjct: 229 EEIERAKVAADHLISEVKDKLDIAKEQLDDNAKYIKCLENPDEADKYVKQKIQQRVKRTA 288 Query: 412 DQPIESHR 435 + +ESHR Sbjct: 289 ENLVESHR 296 >SB_36576| Best HMM Match : FerB (HMM E-Value=9) Length = 223 Score = 31.9 bits (69), Expect = 0.78 Identities = 22/68 (32%), Positives = 34/68 (50%) Frame = -2 Query: 318 ELHVVDFRRKNRMVCGTWRTRNIVTLIQP*RFLASLSHCTCYRALCWRWPEGRLDEPLAR 139 ELH+ FRR+NRM R+I++ F +CT Y+ +CW++ E R+ L Sbjct: 64 ELHM--FRRENRMAGKQLPARDILS------FENKRRNCTVYKCVCWQYSE-RMHSSLIE 114 Query: 138 SLSKEQHQ 115 +S Q Sbjct: 115 LVSSYLRQ 122 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQC 347 QCS+C+K S S + R + KP +CS C Sbjct: 762 QCSTCSKSYSTSRSLVRHERSHSSEKPYLCSDC 794 >SB_41062| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) Length = 147 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQSRK 362 QC+ C KY R S S ++R + KP C +C + K Sbjct: 6 QCNECGKYFRYSRSMKSHQRIHSEEKPYQCVECDKFYK 43 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQSRK 362 QC+ C KY R S S ++R + KP C +C + K Sbjct: 62 QCNECGKYFRYSRSMKSHQRIHSEEKPYQCVECDKFYK 99 >SB_6685| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) Length = 147 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQSRK 362 QC+ C KY R S S ++R + KP C +C + K Sbjct: 6 QCNECGKYFRYSRSMKSHQRIHSEEKPYQCVECDKFYK 43 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQSRK 362 QC+ C KY R S S ++R + KP C +C + K Sbjct: 62 QCNECGKYFRYSRSMKSHQRIHSEEKPYQCVECDKFYK 99 >SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) Length = 473 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 352 NPENNEASIEHSHHTVDIGLDQPIESHRNTRDLRFLYPRGKLPVPTLPPFNPKPIYIDMG 531 +PEN++ + H V L P + +TR +P LP P+LP P I D Sbjct: 24 SPENSDTLYHYCRHLVP-SLPTPGTTTADTRHHHCRHPAPSLPAPSLPA--PGTITADTW 80 Query: 532 NRYRRH 549 + RH Sbjct: 81 YHHCRH 86 >SB_33706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 200 VQCDKLARNRYGCIKVTMFLVRQVPQTIRFFLRKSTTCSSIQ 325 ++CDK+ R+ K TM + R +R + K+ T S++Q Sbjct: 674 IKCDKIQTGRFVYPKNTMMIPRHFQVGLRIYAGKNETLSTLQ 715 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +3 Query: 30 GIPLXL-LGHY--PVFNRYNQHVQVFSIQFSSGAVLCSGFVPEVHPADLQATANTAP 191 G PL L G Y P+F Y + ++SS A ++ E HP+D A N P Sbjct: 296 GRPLVLNFGSYSCPIFRAYLSEFRTLVEKYSSVADFLVVYIEEAHPSDGWAFQNDTP 352 >SB_26758| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) Length = 1413 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Frame = +2 Query: 296 RKSTTCSSIQTEGMFAVSPIQKITRRPLN--IH-IIQLILDLTSRSRATVTQGTCGFCTL 466 RK++T SS + A P Q + P + +H I+ L+L LTS + T++QG+ + + Sbjct: 297 RKASTASSHSSSFRLAKKP-QHVCSNPPSCLLHSIVALLLCLTSDGQLTLSQGSANWSSA 355 Query: 467 EGNC 478 +C Sbjct: 356 LQSC 359 >SB_22048| Best HMM Match : RHS_repeat (HMM E-Value=0.00058) Length = 820 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 460 YPRGKLPVPTLPPFNPKPIYIDMGNRYRRHASEDQEELRQY 582 YP G L P NP+P Y GN R+ + + R Y Sbjct: 378 YPSGNLQSRYYPSGNPQPRYYPSGNPQPRYYTSGNPQPRYY 418 >SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) Length = 1227 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = +2 Query: 209 DKLARNRYGCIKVTMFLVRQVPQTIRFFLRKSTT------CSSIQTEGMFAVSPIQKI 364 D ++R+R C+ V + ++ Q+ L + T C+S+ G+ AVS I KI Sbjct: 890 DPVSRDRRSCLPVHLCILSQLYDAFSVLLDSTETAYLSVGCASVMCLGLCAVSAIMKI 947 >SB_32532| Best HMM Match : RHS_repeat (HMM E-Value=3.2e-06) Length = 618 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 460 YPRGKLPVPTLPPFNPKPIYIDMGNRYRRHASEDQEELRQY 582 YP G L P NP+P Y GN R+ + R Y Sbjct: 51 YPSGNLQSRYYPSGNPQPRYYPSGNPQSRYYPSGNPQPRYY 91 >SB_11978| Best HMM Match : Myb_DNA-binding (HMM E-Value=8e-21) Length = 636 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/70 (28%), Positives = 31/70 (44%) Frame = +1 Query: 283 PILPSKIDDVQLDPNRRYVRSVTNPENNEASIEHSHHTVDIGLDQPIESHRNTRDLRFLY 462 P + + DV D R R+ +NP N+ IE T D+G+ + + NT + Sbjct: 92 PYTATSLYDVIADGTYRVSRTNSNPTNDTFCIEMEVITGDVGVLE-VLCENNTTKVSQTL 150 Query: 463 PRGKLPVPTL 492 G LPV + Sbjct: 151 GMGTLPVDAI 160 >SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) Length = 1743 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 437 TQGTCGFCTLEGNCLFQRFLRLTPSQ 514 T GTC F + G LF R LRL PSQ Sbjct: 230 TSGTCVFLFIFG-ILFDRHLRLRPSQ 254 >SB_19358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 302 STTCSSIQTEGMFAVSPIQK 361 STTCS++ T G +A++P +K Sbjct: 89 STTCSAVTTVGGYAITPFRK 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,261,576 Number of Sequences: 59808 Number of extensions: 596296 Number of successful extensions: 1704 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1698 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2788625034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -