BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L10 (952 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 29 0.082 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 29 0.082 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.33 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 3.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 4.1 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 4.1 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 28.7 bits (61), Expect = 0.082 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 559 DQEELRQYNEHFLIPRDIFQE*GKFQKQKISECTPIFIES*LLK 690 + E+ ++YNE L +I E G F++ + E T I+++ ++K Sbjct: 55 EDEKPQRYNECILKQFNIVDESGNFKENIVQELTSIYLDENVIK 98 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 28.7 bits (61), Expect = 0.082 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 559 DQEELRQYNEHFLIPRDIFQE*GKFQKQKISECTPIFIES*LLK 690 + E+ ++YNE L +I E G F++ + E T I+++ ++K Sbjct: 55 EDEKPQRYNECILKQFNIVDESGNFKENIVQELTSIYLDENVIK 98 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 26.6 bits (56), Expect = 0.33 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Frame = -3 Query: 797 IIMVNNTYEYLHYLN*NGHF----KILCIFMQNY*KYHLNLSNYDSMNIGVHSEIFCFWN 630 I ++N Y+Y +Y N N ++ + NY K + N++ + + + V I+C N Sbjct: 315 ISSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKKLYYNINYIEQIPVPVPVPIYC-GN 373 Query: 629 FP 624 FP Sbjct: 374 FP 375 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.4 bits (48), Expect = 3.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 713 NY*KYHLNLSNYDSMNIGVHSEIFCFWNFP 624 NY K + N+ N + + + V I+C NFP Sbjct: 348 NYKKLYYNIINIEQIPVPVPVPIYC-GNFP 376 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 4.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 267 KYRRPSDSSFENRRRAARSK 326 KYR S F +RR RSK Sbjct: 291 KYRETSKERFRDRRERERSK 310 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +3 Query: 249 QCSSCAKYRRPSDSSFENRRRAARSKPKVCSQCHQS 356 QC C+K ++ +RR + +P C C ++ Sbjct: 121 QCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERA 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,389 Number of Sequences: 438 Number of extensions: 6391 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31202262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -