BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L09 (938 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 26 0.74 10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 26 0.76 12_02_0299 - 17051570-17052474,17053542-17053755 28 0.79 07_03_0154 + 14509979-14512033 25 1.3 04_04_1542 - 34264994-34265331,34266195-34267029 26 1.3 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.3 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.7 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 2.3 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 2.3 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 30 2.3 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 30 2.3 07_03_0890 - 22332768-22333382 30 2.3 07_01_0080 + 587674-588510 30 2.3 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 2.3 01_03_0005 + 11568545-11569119,11569179-11569191 27 4.0 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 25 4.6 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 25 4.8 12_02_1174 - 26696869-26698191 29 5.3 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 5.3 11_01_0621 - 4981070-4981136,4982906-4983825 29 5.3 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 5.3 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 5.3 07_03_1381 - 26166673-26166747,26166972-26167544 29 5.3 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 5.3 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 5.3 03_01_0515 - 3864796-3865425 29 5.3 02_05_0201 + 26687369-26689228 29 5.3 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 5.3 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 5.3 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 5.3 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 25 8.0 11_04_0009 - 12132781-12133272 28 9.3 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 25 9.6 12_02_1177 - 26708215-26708309,26708355-26708392,26708476-267095... 25 9.9 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 25.8 bits (54), Expect(2) = 0.74 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 P P PPPP PPP Sbjct: 208 PAPGTPVTPQPPPPPPPP 225 Score = 24.6 bits (51), Expect(2) = 0.74 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 219 PPPPPPPPPDSKP 231 >10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 Length = 526 Score = 25.8 bits (54), Expect(2) = 0.76 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP P P Sbjct: 16 PPPQEPAPLSPPPPLPTP 33 Score = 24.6 bits (51), Expect(2) = 0.76 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 70 PPPPRPPPQQQHP 82 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 812 FXFPXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 F FP P W P P PP P PPP P Sbjct: 260 FPFPLPPWPWA-PPPAFPFPHLPPIFSPPSPPPPPPPAFP 298 Score = 25.8 bits (54), Expect(2) = 0.79 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 818 FPXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPP 916 FP P P P PPPP PPP Sbjct: 297 FPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPP 329 Score = 24.6 bits (51), Expect(2) = 0.79 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 323 PPPPPPPPPPSFP 335 >07_03_0154 + 14509979-14512033 Length = 684 Score = 25.0 bits (52), Expect(2) = 1.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 P P PPPP PPP Sbjct: 45 PLPLPAAAPPPPPPPPPP 62 Score = 24.6 bits (51), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 54 PPPPPPPPPPPPP 66 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 26.2 bits (55), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPP 913 PPP PPPP PP Sbjct: 219 PPPLALPLPPPPPPSPP 235 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 893 PPPPXPPP 916 PPPP PPP Sbjct: 253 PPPPQPPP 260 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +2 Query: 758 FGPXXXXXKXXXXXXXXXFXFPXPGXGWGVXXXXXPPPXXXXXXXPP----PPXPPPXXX 925 FGP + + P P +GV PPP PP PP PPP Sbjct: 72 FGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Query: 926 XP 931 P Sbjct: 132 PP 133 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 842 GVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 G PPP PPPP PPP P Sbjct: 250 GAEDKRAPPPQSVRPPPPPPPPPPPPPMPP 279 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLP 646 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 608 PPPILPNRSVPPPPPPPP 625 Score = 23.4 bits (48), Expect(2) = 7.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXP 910 PPP PPPP P Sbjct: 641 PPPSLPNRLVPPPPAP 656 Score = 23.4 bits (48), Expect(2) = 7.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 893 PPPPXPPP 916 PPPP PPP Sbjct: 689 PPPPPPPP 696 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPP 95 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 140 PPPPHVPKAAPPPPPPPPPHAPP 162 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 1170 PPPPPLSPSLPPPPPPPPLPSGP 1192 >07_03_0890 - 22332768-22333382 Length = 204 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 76 PPPPAEATPPPPPPPPPPERAVP 98 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 75 PPPPPAEATPPPPPPPPP 92 >07_01_0080 + 587674-588510 Length = 278 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPP 116 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPP 117 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPP 118 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 97 PPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 836 GWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 G G+ PPP PPP PPP P Sbjct: 84 GDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPP 115 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPP 375 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPPXXXXP 931 PPP PPPP PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPP 376 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 27.5 bits (58), Expect(2) = 4.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 912 GGXGGGGXXXXXXXGGGXXXXXTPHPXP 829 GG GGGG GGG P P P Sbjct: 118 GGGGGGGGGWQQGGGGGGAYPTPPPPNP 145 Score = 20.6 bits (41), Expect(2) = 4.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -3 Query: 915 GGGXGGGG 892 GGG GGGG Sbjct: 78 GGGGGGGG 85 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 24.6 bits (51), Expect(2) = 4.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 210 PPPPSPPPPPPSP 222 Score = 23.0 bits (47), Expect(2) = 4.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 866 PPXXXXXXXPPPPXPPP 916 PP PPP PPP Sbjct: 202 PPSSDAPSPPPPSPPPP 218 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 46 PPPPKPPPTVPPP 58 Score = 23.0 bits (47), Expect(2) = 4.8 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 866 PPXXXXXXXPPPPXPPP 916 PP PPP PPP Sbjct: 33 PPDPYGADLSPPPPPPP 49 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 148 PPPSLPPPPPPPPPPPPP 165 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 148 PPPPPPQESTPPPPPPPP 165 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 149 PPPPPQESTPPPPPPPPP 166 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 127 PPPPPPHPLPPPPPTPPP 144 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 931 PPPPPGKPGGPPPPPPPP 948 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 425 PPPPPLPPPPPPPPPPPP 442 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 426 PPPPLPPPPPPPPPPPPP 443 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 151 PPPCGDANENPPPPPPPP 168 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 9 PPPPHSSYAAPPPPPPPP 26 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 10 PPPHSSYAAPPPPPPPPP 27 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 363 PPPKLNTAPKPPPPPPPP 380 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 74 PPPPSVTSSPPPPPLPPP 91 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 91 PPPPPAASPPPPPPSPPP 108 >02_05_0201 + 26687369-26689228 Length = 619 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 13 PPPQSLRLVPPPPPQPPP 30 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 38 PPPPPPPPPPPPPPPPPP 55 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 39 PPPPPPPPPPPPPPPPPP 56 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 412 PPPPPTHTHGPPPPPPPP 429 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 413 PPPPTHTHGPPPPPPPPP 430 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 414 PPPTHTHGPPPPPPPPPP 431 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PPPP PPP Sbjct: 975 PPPFTRQDIPPPPPSPPP 992 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 24.6 bits (51), Expect(2) = 8.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 52 PPPPPPPPTQPAP 64 Score = 22.2 bits (45), Expect(2) = 8.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PPP PP PPP Sbjct: 38 PPPPARHRAPSPPRPPPP 55 >11_04_0009 - 12132781-12133272 Length = 163 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 218 RSSTWAREQRWSCSKPAPERRRRIGSLR 135 R W RE+R S + P +RRR+G R Sbjct: 108 RGEAWRRERRDSKIESRPSQRRRVGGRR 135 >08_02_1143 + 24659105-24659386,24660171-24660272,24661259-24661521, 24661775-24661874,24662080-24662238,24662327-24663147, 24663299-24663618,24665831-24667398 Length = 1204 Score = 25.4 bits (53), Expect(2) = 9.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 PP PPPP PPP Sbjct: 712 PPHLRIPRPWPPPPPPPP 729 Score = 21.0 bits (42), Expect(2) = 9.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PP P Sbjct: 723 PPPPPPPRRRAEP 735 >12_02_1177 - 26708215-26708309,26708355-26708392,26708476-26709563, 26709826-26709945,26710018-26710098,26710696-26710812, 26711122-26711904 Length = 773 Score = 25.0 bits (52), Expect(2) = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 915 GGGXGGGGXXXXXXXGGG 862 GGG GGGG GGG Sbjct: 14 GGGGGGGGGAGQSGDGGG 31 Score = 21.4 bits (43), Expect(2) = 9.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 930 GXXXXGGGXGGGG 892 G GGG GGGG Sbjct: 6 GPRYGGGGGGGGG 18 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,235,835 Number of Sequences: 37544 Number of extensions: 447832 Number of successful extensions: 8257 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 2398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5885 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2694390200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -