BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L09 (938 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 31 2.6 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 31 2.6 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 26 2.6 Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, ... 32 2.6 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 32 3.5 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.5 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.5 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 32 3.5 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 32 3.5 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.5 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 32 3.5 AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho... 32 3.5 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 32 3.5 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 25 4.3 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 25 4.4 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 25 4.4 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 31 6.0 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 31 6.0 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 25 7.4 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 25 7.5 X16135-1|CAA34261.1| 558|Homo sapiens protein ( Human mRNA for ... 31 8.0 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 31 8.0 BC069184-1|AAH69184.1| 558|Homo sapiens HNRPL protein protein. 31 8.0 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 31 8.0 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 31 8.0 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 31 8.0 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 31 8.0 AB044547-1|BAB18649.1| 589|Homo sapiens heterogeneous nuclear r... 31 8.0 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 30.7 bits (66), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 842 GVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 G PPP PPPP PPP P Sbjct: 915 GASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 30.3 bits (65), Expect(2) = 2.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 827 PGXGWGVXXXXXPPPXXXXXXXPPPPXPPP 916 P G + PPP PPPP PPP Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 20.6 bits (41), Expect(2) = 2.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPP PPP P Sbjct: 958 PPPLPPPPYSCDP 970 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 30.7 bits (66), Expect = 8.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 842 GVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 G PPP PPPP PPP P Sbjct: 915 GASLPPPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 30.3 bits (65), Expect(2) = 2.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 827 PGXGWGVXXXXXPPPXXXXXXXPPPPXPPP 916 P G + PPP PPPP PPP Sbjct: 912 PHAGASLPPPPPPPPPPPPPPPPPPPPPPP 941 Score = 20.6 bits (41), Expect(2) = 2.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPP PPP P Sbjct: 958 PPPLPPPPYSCDP 970 >AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. Length = 1130 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPP 913 PPP PPPP PP Sbjct: 17 PPPAPPPPPPPPPPSPP 33 Score = 24.6 bits (51), Expect(2) = 2.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 45 PPPPPPPPLPGEP 57 >Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, protein expressed in protein. Length = 195 Score = 32.3 bits (70), Expect = 2.6 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -1 Query: 290 GPRSPGPL*RCRHECFCPFFQFS*RSSTWAREQRWSCSKPAPERRRRIGSL 138 GPR+PGP RH P R +W RE+ KP +RR +G + Sbjct: 16 GPRAPGPSLLVRHGSGLPPSALK-RGPSWTRERTLVAVKPDGVQRRLVGDV 65 >BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein protein. Length = 669 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 301 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 337 >BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 301 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 337 >BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 301 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 337 >AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related formin 3 protein. Length = 1112 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 protein. Length = 1152 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 494 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 530 >AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 553 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 589 >AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 518 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 554 >AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 494 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 530 >AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 553 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 589 >AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 518 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 554 >AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 494 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 530 >AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 553 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 589 >AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 518 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 554 >AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 494 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 530 >AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 553 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 589 >AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 518 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 554 >AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 564 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 600 >AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous homologue 2_splice_variant2 protein. Length = 1123 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 494 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 530 >AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous homologue 2_splice_variant1 protein. Length = 1147 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 518 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 554 >AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous homologue 2 protein. Length = 1182 Score = 31.9 bits (69), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P G G PPP PPPP PPP P Sbjct: 553 PSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP 589 >AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. Length = 1015 Score = 25.4 bits (53), Expect(2) = 4.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 P P PPPP PPP Sbjct: 892 PRPFSPPRAPPPPPPPPP 909 Score = 24.6 bits (51), Expect(2) = 4.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 905 PPPPPPPPRMRSP 917 >AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 25.4 bits (53), Expect(2) = 4.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 P P PPPP PPP Sbjct: 780 PRPFSPPRAPPPPPPPPP 797 Score = 24.6 bits (51), Expect(2) = 4.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 793 PPPPPPPPRMRSP 805 >AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 25.4 bits (53), Expect(2) = 4.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 863 PPPXXXXXXXPPPPXPPP 916 P P PPPP PPP Sbjct: 780 PRPFSPPRAPPPPPPPPP 797 Score = 24.6 bits (51), Expect(2) = 4.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 793 PPPPPPPPRMRSP 805 >AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (odd-paired homolog, Drosophila) protein. Length = 663 Score = 31.1 bits (67), Expect = 6.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 818 FPXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 +P G G PPP P PP PPP P Sbjct: 136 YPCGGGSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPP 173 >AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 protein protein. Length = 639 Score = 31.1 bits (67), Expect = 6.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 818 FPXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 +P G G PPP P PP PPP P Sbjct: 112 YPCGGGSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPP 149 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 24.6 bits (51), Expect(2) = 7.4 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPP 916 P P G+ PP PP P PPP Sbjct: 302 PPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPP 333 Score = 24.6 bits (51), Expect(2) = 7.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 334 PPPPLPPPSSAGP 346 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 24.6 bits (51), Expect(2) = 7.5 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPP 916 P PG G P P P P PPP Sbjct: 20 PLPGPKGGFEPGPPPAPGPGAGLLAPGPPPPP 51 Score = 24.6 bits (51), Expect(2) = 7.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 893 PPPPXPPPXXXXP 931 PPPP PPP P Sbjct: 73 PPPPPPPPQQPPP 85 >X16135-1|CAA34261.1| 558|Homo sapiens protein ( Human mRNA for novel heterogeneous nuclear RNP protein, L protein. ). Length = 558 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 915 GGGXGGGGXXXXXXXGGGXXXXXTPHPXP 829 GGG GGGG GGG PH P Sbjct: 40 GGGGGGGGGAGAAGGGGGGENYDDPHKTP 68 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P PG PPP PPPP PPP P Sbjct: 161 PLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 197 >BC069184-1|AAH69184.1| 558|Homo sapiens HNRPL protein protein. Length = 558 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 915 GGGXGGGGXXXXXXXGGGXXXXXTPHPXP 829 GGG GGGG GGG PH P Sbjct: 40 GGGGGGGGGAGAAGGGGGGENYDDPHKTP 68 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P PG PPP PPPP PPP P Sbjct: 579 PLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPP----XPPPXXXXP 931 P G WG PPP PPPP PPP P Sbjct: 318 PELGLPWGTIGKPIPPPPPPSFPPPPPPPGTQLPPPPPSYP 358 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 30.7 bits (66), Expect = 8.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPP----XPPPXXXXP 931 P G WG PPP PPPP PPP P Sbjct: 318 PELGLPWGTIGKPIPPPPPPSFPPPPPPPGTQLPPPPPSYP 358 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 821 PXPGXGWGVXXXXXPPPXXXXXXXPPPPXPPPXXXXP 931 P PG PPP PPPP PPP P Sbjct: 470 PLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 506 >AB044547-1|BAB18649.1| 589|Homo sapiens heterogeneous nuclear ribonucleoprotein L protein. Length = 589 Score = 30.7 bits (66), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 915 GGGXGGGGXXXXXXXGGGXXXXXTPHPXP 829 GGG GGGG GGG PH P Sbjct: 71 GGGGGGGGGAGAAGGGGGGENYDDPHKTP 99 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,300,130 Number of Sequences: 237096 Number of extensions: 2341079 Number of successful extensions: 22665 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 8999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16202 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12325533684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -