BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L08 (934 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0659 - 5021159-5021266,5021364-5021494,5021619-5021785,502... 33 0.32 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 2.3 04_04_1125 + 31085106-31085714 30 2.3 05_03_0515 + 14930736-14932697 30 3.0 11_06_0645 - 25814302-25814759,25814853-25815005,25815032-258152... 29 4.0 04_04_0347 + 24564589-24565296 29 4.0 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 5.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 5.3 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 7.0 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 7.0 02_05_1258 + 35290183-35290198,35290292-35290599,35290844-352909... 29 7.0 02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425,265... 29 7.0 11_06_0296 + 22046649-22048202,22048524-22048703,22048811-220488... 28 9.2 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 28 9.2 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 28 9.2 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 28 9.2 >01_01_0659 - 5021159-5021266,5021364-5021494,5021619-5021785, 5021950-5022065,5022226-5022381,5022570-5022678, 5023153-5023262,5023807-5023992,5024077-5024667 Length = 557 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 295 KFPSIINEGRVEGDKYQISIHLPGYEQKDINVK 393 K ++ E +VEGD Y + +H PG+ K ++V+ Sbjct: 216 KDDEVVKEEKVEGDGYSLGLHAPGFFDKVLHVE 248 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTP 787 PP PP P P + PP P P P P P Sbjct: 634 PPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP 670 >04_04_1125 + 31085106-31085714 Length = 202 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 641 CGTXTLXXXLXXPPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTP 787 CG+ PP PP P P PP P P P PTP Sbjct: 30 CGSNCPTTKPPPPPCQPPPPTPTPATPTTPPTP-WTPPPATPTPPTPTP 77 >05_03_0515 + 14930736-14932697 Length = 653 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = +1 Query: 94 IALVLCGLLAAVSAAPQYYHGSSHWPYHHYDPFSPYVRESM-LDTHSLWSNLANEMQHLD 270 + L +C + V +P + +W YH + YV +S+ ++ S WSN + L Sbjct: 308 LCLEVCAIFFMVMMSPWTWASLQYWKYHRLADAAWYVFKSLQTESMSWWSNSLGQYNFLS 367 Query: 271 DMMKE 285 + Sbjct: 368 SCFSD 372 >11_06_0645 - 25814302-25814759,25814853-25815005,25815032-25815214, 25815342-25815531,25815624-25815784,25816136-25816623, 25817035-25817075 Length = 557 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +1 Query: 307 IINEGRVEGDKYQISIHLPGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLP 465 I ++G++EG + I H+P E D+ V + + + +S H K N P Sbjct: 351 ISSKGQLEGIQVVIDPHVPSVESVDMPVSSMDNSTLEVFSSQQQHSFKCNNTP 403 >04_04_0347 + 24564589-24565296 Length = 235 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 91 MIALVLCGLLAAVSAAPQYYHGSSHWPY-HHYDPF 192 M L+ LLAA SAA +H ++ PY HH+ P+ Sbjct: 5 MSMLLASSLLAAASAARADHHSPAYAPYPHHHAPW 39 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXP 739 PP PP P P + HPP P Sbjct: 1158 PPPPPPLPPPPPVAPFHPPGP 1178 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 680 PXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTP 787 P PP P P + PP P P PC P Sbjct: 116 PPRPPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVP 151 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 Query: 668 LXXPPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTPXXXXG 802 L PP PP P P + PP + P P P P G Sbjct: 23 LRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPPG 67 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/43 (30%), Positives = 13/43 (30%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTPXXXXGP 805 PP P P P PP P P P P P P Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPP 1206 >02_05_1258 + 35290183-35290198,35290292-35290599,35290844-35290939, 35291067-35291144,35291224-35291400,35292738-35292806, 35292917-35293093 Length = 306 Score = 28.7 bits (61), Expect = 7.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 786 GVGQGXXGXXFWXXXXGXGGWXFXXXLGXGXGGFXGGLXXXXXXVXVPHVAXG 628 G G G G G GG G G GG GG+ V VPH G Sbjct: 25 GRGFGRGGDSGGRGGRGRGGGRTPRGRGGGRGGGRGGMKGGSKVVVVPHKHNG 77 >02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425, 2657523-2657649,2657731-2657812,2658172-2658196 Length = 2621 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/50 (26%), Positives = 28/50 (56%) Frame = +1 Query: 202 VRESMLDTHSLWSNLANEMQHLDDMMKELSLKFPSIINEGRVEGDKYQIS 351 +++++L+ LA+E+Q D ++ EL K S + R+E + ++S Sbjct: 1298 LKQTLLEKSGELEKLAHELQSKDSLLIELEAKIKSYADADRIEALESELS 1347 >11_06_0296 + 22046649-22048202,22048524-22048703,22048811-22048860, 22049443-22049564,22051007-22051119,22051227-22051436, 22052152-22052265,22052529-22052658,22053010-22053143, 22053997-22054077,22054181-22054267 Length = 924 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/70 (24%), Positives = 33/70 (47%) Frame = +1 Query: 127 VSAAPQYYHGSSHWPYHHYDPFSPYVRESMLDTHSLWSNLANEMQHLDDMMKELSLKFPS 306 ++ A +++ G++ W + S +DT SLW +L N +H + ++L S Sbjct: 376 ITDAVRFFKGNNSWSFLICPLSSRCDGRKFVDTSSLWGHLCN--KHPEGHWRKLQSVLGS 433 Query: 307 IINEGRVEGD 336 ++E GD Sbjct: 434 KLSENTSVGD 443 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTPXXXXGPT 808 PP P P P PP P P P PTP PT Sbjct: 156 PPSPPQDPAPSLPHAPAPPPPQAPAPTP-PQAPAPTPPRAPTPT 198 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTPXXXXG 802 PP PP P + PP P + P P P P G Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFPKGG 74 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 677 PPXXPPXPXPKXLXKXHPPXPXXXXQKXXPXXPCPTPXXXXGP 805 P PP P PK K P P P P P P P Sbjct: 196 PKPKPPKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFPKPPCPP 238 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,610,148 Number of Sequences: 37544 Number of extensions: 389838 Number of successful extensions: 1529 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1423 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2670960720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -