BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L02 (1004 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 8.6 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 22 8.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 3.7 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +3 Query: 621 PGXPGXNQTSTQXAXPSXXHPPXXRXXRRXPPXPPXFPPXXPPPXPXXHPPSXP 782 PG ST A PS P PPP P PP P Sbjct: 696 PGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQPPRNP 749 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 3.7 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +3 Query: 621 PGXPGXNQTSTQXAXPSXXHPPXXRXXRRXPPXPPXFPPXXPPPXPXXHPPSXP 782 PG ST A PS P PPP P PP P Sbjct: 588 PGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQPPRNP 641 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 6.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 570 TVPPPPXXGXELXFPPXPGXPG 635 T+PPP E+ P P PG Sbjct: 1085 TIPPPAVVMPEVDKPSQPCEPG 1106 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 8.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 732 PPXXPPPXPXXHP 770 PP P P P HP Sbjct: 115 PPLTPSPGPPSHP 127 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.8 bits (44), Expect = 8.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 Query: 702 RRXPPXPPXFPPXXPP 749 R+ P P +PP PP Sbjct: 20 RKRPHSPEPYPPRCPP 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,682 Number of Sequences: 336 Number of extensions: 2110 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28650941 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -