BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_L01 (904 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.8 12_02_0145 - 14381089-14381154,14381351-14381494,14384678-14385547 29 5.1 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 262 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 360 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >12_02_0145 - 14381089-14381154,14381351-14381494,14384678-14385547 Length = 359 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -1 Query: 178 LLLLFDERSVNRCRFEFRYGATESEGNKPR*NQDSLHG-LSRRXELSNLKEFPIV 17 L LL ++ +F + ATESEG + LHG + R+ L N + P+V Sbjct: 33 LPLLRKGANLEHAKFLHQIAATESEGGLAEQGEAGLHGTIDRQPRLHNGSDDPVV 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,176,550 Number of Sequences: 37544 Number of extensions: 317250 Number of successful extensions: 613 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -