BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K24 (945 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 41 0.002 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 40 0.002 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.016 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 37 0.021 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 37 0.027 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.048 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.083 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 32 0.59 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.0 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.4 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 1.4 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.8 SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1) 31 1.8 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 3.1 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 5.5 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 29 5.5 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 5.5 SB_36047| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 6.0 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 29 7.2 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 7.2 SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) 28 9.6 SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) 28 9.6 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 28 9.6 SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) 28 9.6 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 28 9.6 SB_37987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 28 9.6 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 41.5 bits (93), Expect = 0.001 Identities = 32/131 (24%), Positives = 40/131 (30%), Gaps = 3/131 (2%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHN---QXAXTPLXPPPPXTX 729 P P P PPPP + + P PP +P P N + PPPP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Query: 730 FTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPPSXXLSXXNTXXXXXXXXXXXXXXPX 909 + P P P+P P P PP PP P Sbjct: 156 YPP----PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPY 211 Query: 910 HPLDHXPXPPH 942 P + P PP+ Sbjct: 212 PPPPNAPNPPY 222 Score = 37.9 bits (84), Expect = 0.012 Identities = 35/130 (26%), Positives = 40/130 (30%), Gaps = 2/130 (1%) Frame = +1 Query: 559 PTPXAXGXXXPNXP--PPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXF 732 P P A PN P PPP + S + P PP +P P PL PPPP Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP--------PLYPPPP---- 165 Query: 733 TXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPPSXXLSXXNTXXXXXXXXXXXXXXPXH 912 P P P P P PP PP P Sbjct: 166 --NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Query: 913 PLDHXPXPPH 942 P + P PP+ Sbjct: 224 PPPNAPNPPY 233 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 674 HXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 H T P P PPP P P P PP P AP P Sbjct: 83 HPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP 125 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP P P P +P P PP P AP P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP P P P +P P PP P+ P P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 695 PPPXXX--PPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP PPP P P ++P PP P+ P P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/49 (28%), Positives = 17/49 (34%) Frame = +2 Query: 656 FXHXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 F P + P P P P P +P P PP P+ P P Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/62 (27%), Positives = 20/62 (32%) Frame = +1 Query: 649 PPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPX 828 PP P +P + P PPPP + P P P P P P Sbjct: 92 PPYPPPPYPPY---PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPY 148 Query: 829 PP 834 PP Sbjct: 149 PP 150 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = +2 Query: 662 HXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 H P++ + PP P P P P P PP P+ P P Sbjct: 83 HPPTNFSPNPPYPPPPYP-PYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 662 HXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAP 796 + P T PPP PPP P +P +PA +PPT + AP Sbjct: 120 YVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 2/81 (2%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHP 777 PP P F S S P PPL P + L PPPP +P P P P Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSP 357 Query: 778 LXXRGAXPG--PXXXXPPXPP 834 P P PP PP Sbjct: 358 PEDLYDAPATLPSPIMPPPPP 378 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 662 HXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 H S PPP PPP P P SP+ PP P P P Sbjct: 194 HPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPAR 808 PS T PPP P P P P SP PP P P A+ Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAK 244 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/76 (26%), Positives = 24/76 (31%) Frame = +1 Query: 634 SXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXX 813 S P P P + +P PPPP + P P PL + P P Sbjct: 193 SHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Query: 814 XXPPXPPSXXLSXXNT 861 PP P L T Sbjct: 253 NMPPTLPPPTLGYLPT 268 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 671 SHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 SH T+ P PPP P P S P PP+PS P P Sbjct: 193 SHPTS---PSQITQPPPPPPRPPP-SPPPPPPPPSPSPPRPPPP 232 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/83 (31%), Positives = 30/83 (36%) Frame = +1 Query: 589 PNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPS 768 PN PP P + P PP SP P P P PP P + P+ Sbjct: 243 PN-PPMPETPLPPATPNPFIPPASPN--PSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPA 299 Query: 769 PHPLXXRGAXPGPXXXXPPXPPS 837 P L A P P PP PP+ Sbjct: 300 PPNLFIPSAPPNP--HIPPAPPN 320 Score = 32.3 bits (70), Expect = 0.59 Identities = 39/135 (28%), Positives = 45/135 (33%), Gaps = 8/135 (5%) Frame = +1 Query: 559 PTPXAX-GXXXPNXPP-PPXRXFFXSFSXPXXPPLS-----PXXFPXHNQXAXTPLXPPP 717 PTP A P PP PP P PP P P ++ TP PP Sbjct: 189 PTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATP-NPPM 247 Query: 718 PXTXFTXXXXLPRLTP-SPHPLXXRGAXPGPXXXXPPXPPSXXLSXXNTXXXXXXXXXXX 894 P T P + P SP+P A P P PP PS L+ N Sbjct: 248 PETPLPPATPNPFIPPASPNPSIPP-APPNPSIPAPPN-PSIPLAPPNPYIPPAPPNLFI 305 Query: 895 XXXPXHPLDHXPXPP 939 P +P H P P Sbjct: 306 PSAPPNP--HIPPAP 318 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 680 TTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 T PP P P P S P PPTP P P Sbjct: 174 TKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLP 214 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 36.7 bits (81), Expect = 0.027 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHP 777 PPPP S PP P P + P PPPP LP PSP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP---PGCAGLPPPPPSPQP 734 Query: 778 LXXRGAXPGPXXXXPPXPP 834 G P P PP PP Sbjct: 735 -GCAGLPPPP----PPPPP 748 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/82 (28%), Positives = 25/82 (30%) Frame = +1 Query: 589 PNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPS 768 P PPPP + P PP P PPPP + LP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAG---------LPPPPPSPQPGCAGLPPPPPP 745 Query: 769 PHPLXXRGAXPGPXXXXPPXPP 834 P P G P P P P Sbjct: 746 PPP-GCAGLPPPPPPIDVPMKP 766 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP PPP P SP P PP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 35.5 bits (78), Expect = 0.063 Identities = 28/84 (33%), Positives = 30/84 (35%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHP 777 PPPP S P PP P P Q P PPPP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP--PPPPP---------PPPPPPPPP 413 Query: 778 LXXRGAXPGPXXXXPPXPPSXXLS 849 A P P PP PP+ L+ Sbjct: 414 PPPPPAPPPPPPPPPPPPPALRLA 437 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PS PPP PPP P P P PP P P P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPA 805 PPP PPP P P P PP P P PA Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPA 805 PPP PPP P P P PP P P PA Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PS PPP PPP P P P PP P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP PPP P P P PP P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPAR 808 PPP PPP P P P PP P+ A P R Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTX 738 P P P+ PPPP P PP P P P PPPP Sbjct: 366 PPPPPPPPPPPSPPPPPP-------PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Query: 739 XXXLPRLTPSPHPLXXRGAXPGP 807 P P P P R A P Sbjct: 419 APPPPPPPPPPPPPALRLACAPP 441 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 682 NQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 N P PPPP P +P P P P P PP PP Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +1 Query: 589 PNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRL 759 P+ PPPP P PP P P P PPPP PRL Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRL 443 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +1 Query: 655 LSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 +SP P +P PPPP P P P P P P PP PP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP-PPPPPPPPPPPPPPPPPPPPPPAPP 421 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.1 bits (77), Expect = 0.083 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 653 PFXHXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPS 781 P P T PPP PPP P P P+ PP PS Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PPP PPP P P S+P P TP + P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPA 805 PPP PPP P P P PP PA Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPA 726 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.1 bits (77), Expect = 0.083 Identities = 31/102 (30%), Positives = 35/102 (34%), Gaps = 10/102 (9%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFS-XPXXPPLSPXXFPXHNQXAXTPL----XPPPPX 723 PTP P PPPP S + P PP SP P PPPP Sbjct: 98 PTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPI 157 Query: 724 TXFT-XXXXLPRLTPS---PHP-LXXRGAXPGPXXXXPPXPP 834 T P + P+ P P + A P P PP PP Sbjct: 158 APATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPP 199 Score = 33.1 bits (72), Expect = 0.34 Identities = 26/93 (27%), Positives = 33/93 (35%), Gaps = 6/93 (6%) Frame = +1 Query: 589 PNXPPPPXRXFFXSFSXPXXPPLSPXXF--PXHNQXAXTPLXPPPPX----TXFTXXXXL 750 P+ PPPP + + P PP++P P A PPPP + Sbjct: 124 PSPPPPPTSP--ATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAV 181 Query: 751 PRLTPSPHPLXXRGAXPGPXXXXPPXPPSXXLS 849 P SP P P P PP PP L+ Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELA 214 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/83 (27%), Positives = 28/83 (33%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTX 738 P P A P PPPP + P PP++P PPPP + Sbjct: 141 PPPIAPATGGP-PPPPPIAP--ATGGPPPPPPIAPAATVPAPAVPLAAASPPPP-SGGPP 196 Query: 739 XXXLPRLTPSPHPLXXRGAXPGP 807 P P P P+ A P P Sbjct: 197 PPPPPPPPPPPPPILELAAPPPP 219 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.25 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 2/73 (2%) Frame = +1 Query: 622 FXSFSXPXXPPLSPXXFP-XHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAX 798 F S S P PP P P A P PPPP P P P PL Sbjct: 45 FISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAP-------PAAPPPPPPLPAPPPP 97 Query: 799 PG-PXXXXPPXPP 834 P P PP PP Sbjct: 98 PAQPAPQPPPAPP 110 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTP 778 PPP PPP P P + PA PP P Sbjct: 85 PPP---PPPLPAPPPPPAQPAPQPPPAP 109 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = +2 Query: 656 FXHXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 F + P ++ PPP P P +P ++ PP + AP P Sbjct: 39 FTYYPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP 87 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = +1 Query: 628 SFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGP 807 S S PP P PL PPPP P P P G+ P P Sbjct: 907 SESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Query: 808 XXXXPPXPP 834 PP PP Sbjct: 967 GGGAPPLPP 975 Score = 32.3 bits (70), Expect = 0.59 Identities = 28/94 (29%), Positives = 33/94 (35%), Gaps = 2/94 (2%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPP--LSPXXFPXHNQXAXTPLXPPPPXTXF 732 P+ G P PPPP + P PP +P P A P PPP + Sbjct: 910 PSASPPGGSVPPPPPPPG----GNAPLPPPPPGGSAPSQPPPPGGNAPPP-PPPPGGSAP 964 Query: 733 TXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 P L P P G+ P P PP PP Sbjct: 965 PPGGGAPPLPPPPG-----GSAPPPPPPPPPPPP 993 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PP PPP +P P PP P P P Sbjct: 958 PPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.7 bits (71), Expect = 0.44 Identities = 25/97 (25%), Positives = 29/97 (29%) Frame = +1 Query: 544 TTGXXPTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPX 723 TT TP P PPP + PPL P P P P Sbjct: 891 TTAPPTTPTTPKPTTPAPPPP------LPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQA 944 Query: 724 TXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 + T P + P P+ P P PP PP Sbjct: 945 ST-TRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.7 bits (71), Expect = 0.44 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +1 Query: 649 PPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPX 828 PP P P PPPP T P P P P G P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 829 PP 834 PP Sbjct: 406 PP 407 Score = 29.9 bits (64), Expect = 3.1 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = +1 Query: 577 GXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPR 756 G N PPPP + P PP P P PPPP T P Sbjct: 340 GGGGVNPPPPPT-------NNPPSPPPPTNNTPPPPPPTNKP-PPPPPPTNGPPPPPPPT 391 Query: 757 LTPSPHPLXXRGAXPGPXXXXPP 825 P P P G P P P Sbjct: 392 NGPPPPPPPTNGPPPPPPPTNGP 414 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 32.3 bits (70), Expect = 0.59 Identities = 25/91 (27%), Positives = 28/91 (30%), Gaps = 5/91 (5%) Frame = +1 Query: 577 GXXXPNXPPPPXRXFFXSFSXPXX----PPLSPXXFPXHNQXAXTPLXPPPPXTXF-TXX 741 G P PPP F S P PP P + TP+ PPP + Sbjct: 373 GVPTPVKAPPPS-VFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSG 431 Query: 742 XXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 P P P P P PP PP Sbjct: 432 VPTPVAAPPPSVFASSSGVPTPVTAPPPAPP 462 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/84 (25%), Positives = 24/84 (28%), Gaps = 5/84 (5%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPP-----PXTXFTXXXXLPRLT 762 P PP F S P P + TP+ PP P + P Sbjct: 459 PAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAA 518 Query: 763 PSPHPLXXRGAXPGPXXXXPPXPP 834 P P P P PP PP Sbjct: 519 PPPSVFAPSSGVPTPVTEPPPAPP 542 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTP 778 PPP PPP P P P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTP 778 PPP PPP P P P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPS 781 PPP PPP P P P PP P+ Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTP 778 PPP PPP P P P PPTP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPP---PPTP 496 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAX-----HLPPTPSXXXAPXP 802 PPP PP P S +PA HLPP P+ P P Sbjct: 771 PPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPP 811 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/74 (24%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXP-PPPXTXFT 735 P+P P PP P + + P P+ P P PL P P P + Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 736 XXXXLPRLTPSPHP 777 P ++ P P Sbjct: 798 HLPPAPNISAEPPP 811 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/82 (26%), Positives = 25/82 (30%), Gaps = 2/82 (2%) Frame = +1 Query: 592 NXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSP 771 N PPPP S P P P + L PPP + P P Sbjct: 192 NGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 251 Query: 772 HPL--XXRGAXPGPXXXXPPXP 831 P+ G P P PP P Sbjct: 252 PPMRGPTSGGEPPPPKNAPPPP 273 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/80 (28%), Positives = 26/80 (32%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHP 777 PPPP R P ++P P T PPPP P P P P Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP---PPPPP 376 Query: 778 LXXRGAXPGPXXXXPPXPPS 837 R G PP PP+ Sbjct: 377 --GRRPPSGKINPPPPPPPA 394 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/82 (26%), Positives = 25/82 (30%), Gaps = 2/82 (2%) Frame = +1 Query: 592 NXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSP 771 N PPPP S P P P + L PPP + P P Sbjct: 104 NGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 163 Query: 772 HPL--XXRGAXPGPXXXXPPXP 831 P+ G P P PP P Sbjct: 164 PPMRGPTSGGEPPPPKNAPPPP 185 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/80 (28%), Positives = 26/80 (32%) Frame = +1 Query: 598 PPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHP 777 PPPP R P ++P P T PPPP P P P P Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP---PPPPP 288 Query: 778 LXXRGAXPGPXXXXPPXPPS 837 R G PP PP+ Sbjct: 289 --GRRPPSGKINPPPPPPPA 306 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/100 (28%), Positives = 34/100 (34%), Gaps = 5/100 (5%) Frame = +1 Query: 550 GXXPTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTP----LXPPP 717 G P P + G P PPP R + P P S P ++ A P + PPP Sbjct: 303 GAPPPPPSRGSAPP---PPPAR--MGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Query: 718 PXTXFTXXXXLPRLT-PSPHPLXXRGAXPGPXXXXPPXPP 834 P + P P P G P PP PP Sbjct: 358 VGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 3/82 (3%) Frame = +1 Query: 598 PPPPXRXFFX---SFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPS 768 PPPP R S P PP P T PPPP R P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 769 PHPLXXRGAXPGPXXXXPPXPP 834 P + G PP PP Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPP 369 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSS----PAXHLPPTPSXXXAPXP 802 PS + PP P P P S P+ PP PS AP P Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 683 TXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 T PPP PPP P P P PP P P P Sbjct: 91 TCGDPPPPATPPP-PTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/92 (27%), Positives = 30/92 (32%) Frame = +1 Query: 559 PTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTX 738 P P PPP + S S P PP P P + P PPP Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTN---PAHPTEPPP------- 1106 Query: 739 XXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPP 834 P+ TP+P P + P PP P Sbjct: 1107 --RQPKPTPAPRPRSWVESQPELHRPPPPIKP 1136 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = +2 Query: 653 PFXHXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 P PS + PPP PPP P +P P+ P P Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPP 1106 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 589 PNXPPPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPP 720 P P PP F + P PP P P PPPP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 713 PPPXPXSPXXXSSPAXHLPPTPS 781 PP P SP +SP H PPTP+ Sbjct: 1029 PPLIPGSPHRGASPMPHEPPTPT 1051 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +2 Query: 695 PPPXXXPPPXPXSP-XXXSSPAXHLPPTPS 781 PPP PPP P SP P PPTP+ Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTPT 1187 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPS 781 PPP PPP P S P PP P+ Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 PS PPP PPP +P +S PP P AP P Sbjct: 272 PSASQNATPPPP---PPPPSNTPGMFASSGFQPPPPPPTDFAPPP 313 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +1 Query: 550 GXXPTPXAXGXXXPNXPPPPXRX---FFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPP 720 G P P A P PPPP F S PP P T PPPP Sbjct: 267 GHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Query: 721 XTXF 732 F Sbjct: 327 PPPF 330 >SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1) Length = 682 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 713 PPPXPXSPXXXSSPAXHLPPTPS 781 PP P SP +SP H PPTP+ Sbjct: 162 PPLIPGSPHRGASPMPHEPPTPT 184 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 683 TXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAP 796 T PPP PPP P P P P P+ P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGP 65 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHL 766 PPP PPP P P SSP+ L Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRPL 79 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 662 HXPSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPA 805 H SH PPP PPP P P + H + P PA Sbjct: 128 HVVSH-VMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPA 174 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXSSPAXHLPPT 775 PSH PPP PP P +P + P PPT Sbjct: 429 PSHPPPLPQPPPSIIPP--PTTPLPQTVPTPPRPPT 462 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = -3 Query: 607 GGGXGWGXAXPXPXGWGGXPL----XXGXXXPXXXGXXXXXPPPXVFXSG 470 GGG GWG P GG P G P G PPP G Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG 534 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = -3 Query: 607 GGGXGWGXAXPXP-XGWGGXPLXXGXXXPXXXGXXXXXPPP 488 G G GWG P G G P G P G PPP Sbjct: 551 GAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPP 591 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +2 Query: 668 PSHXTTXXXPPPXXXPPPXPXSPXXXS-SP----AXHLPPTPSXXXAP 796 P TT PPP PP SP + SP A LPPT + AP Sbjct: 105 PPPATTSAPPPPTTTAPPATTSPPTTTDSPPTTAAETLPPTDAPTEAP 152 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXP 802 P P PP P P P PP P AP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPAR 808 PPP PP P P SP PP S P P + Sbjct: 468 PPPAPALPPLPLPPELPGSPGDS-PPATSPKQPPLPPK 504 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 29.1 bits (62), Expect = 5.5 Identities = 25/100 (25%), Positives = 30/100 (30%), Gaps = 2/100 (2%) Frame = +1 Query: 544 TTGXXPTPXAXGXXXPNXPPPPXRXFFXSFSXPXXPPL--SPXXFPXHNQXAXTPLXPPP 717 TT P+P P P P S S P+ SP P + TP+ P P Sbjct: 1261 TTPIKPSPSTTSTT-PIKPSPSTNPIKPSPSTTSTTPIKPSPSTTPIKPSPSTTPIKPSP 1319 Query: 718 PXTXFTXXXXLPRLTPSPHPLXXRGAXPGPXXXXPPXPPS 837 T + PSP P P PS Sbjct: 1320 STTPIKPSPSTTPIKPSPSTTSTTPIKPSPSTTPIKPSPS 1359 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/78 (25%), Positives = 26/78 (33%) Frame = +1 Query: 601 PPPXRXFFXSFSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPL 780 PP + + PP SP A P P P + + P P+ +P Sbjct: 104 PPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYP---PTSYPP 160 Query: 781 XXRGAXPGPXXXXPPXPP 834 A P P PP PP Sbjct: 161 QPYPAQPYPQQGYPPQPP 178 >SB_36047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 980 Score = 23.8 bits (49), Expect(2) = 6.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 Query: 671 SHXTTXXXPPPXXXPPP 721 +H T PPP PPP Sbjct: 877 THFATFFPPPPPNVPPP 893 Score = 23.4 bits (48), Expect(2) = 6.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 695 PPPXXXPPPXPXS 733 PPP PPP P S Sbjct: 886 PPPNVPPPPIPES 898 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 801 GXGAXXXEGVGGRCXAGEXXXXGEXGXGGGXXQGGG 694 G G +G GG G G G GGG GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 801 GXGAXXXEGVGGRCXAGEXXXXGEXGXGGGXXQGGG 694 G G G GG G+ G G GGG GGG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.2 Identities = 23/89 (25%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +1 Query: 577 GXXXPNXPPPPXRXFFXS-FSXPXXPPLSPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLP 753 G P+ P F S P PP + P N + PPP P Sbjct: 1179 GPRAPHQSPMEGGDFMKGRMSNPNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPP 1238 Query: 754 RLTPSPHPLXXRGAXPGP--XXXXPPXPP 834 P P G P P PP PP Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 801 GXGAXXXEGVGGRCXAGEXXXXGEXGXGGGXXQGGG 694 G GA G GG C G G G G G GGG Sbjct: 46 GGGAGNGVGAGG-CGCGGGNDGGNGGGGAGNGGGGG 80 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 698 PPXXXPPPXPXSPXXXSSPAXHLPPTPS 781 PP PPP P P P LPPTP+ Sbjct: 1307 PPESPPPPPPPPPPPPPPP---LPPTPN 1331 >SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) Length = 765 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 683 TXXXPPPXXXPPPXPXSPXXXS-SPAXHLPPTPSXXXAPXP 802 T PPP P P P + S H PPTP AP P Sbjct: 439 TPTPPPPTQQPAPQPTMQTTPTHSSTSHTPPTP--ISAPYP 477 >SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) Length = 1020 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +1 Query: 658 SPXXFPXHNQXAXTPLXPPPPXTXFTXXXXLPRLTPSPHPLXXRGAXP 801 SP P + TP+ P P T T P TP H R P Sbjct: 340 SPSTTPIKPSPSTTPIKPSPSTTSTTPIKPSPNTTPGVHDRGGRVQYP 387 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 698 PPXXXPPPXPXSPXXXSSPAXHL--PPTPSXXXAPXP 802 PP PPP P + +P + PP P+ AP P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) Length = 2435 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 698 PPXXXPPPXPXSPXXXSSPAXHLPPTPSXXXAPXPAR 808 PP PP P P P ++PP P P R Sbjct: 118 PPQGYIPPQPPYPWRQPPPEAYIPPDHGMLGIPIPLR 154 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 651 APFXTXLPTPQPXRXHPLXTXPPP 722 A F LPTP P HP T PP Sbjct: 378 ATFDDPLPTPPPMSTHPEFTSKPP 401 >SB_37987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/53 (28%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 565 PXAXGXXXPNXPPPPXRXFFXSFSXPXXPPL--SPXXFPXHNQXAXTPLXPPP 717 P G P PP + ++ S P PPL P P + + PPP Sbjct: 198 PIVLGSVPYRPPMPPPQAYWQPASQPSAPPLMNDPNQAPPYYSQQGSAYPPPP 250 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 695 PPPXXXPPPXPXSPXXXSSPAXHLPPTPS 781 PPP P P P P P PP P+ Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQPT 458 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,755,094 Number of Sequences: 59808 Number of extensions: 183799 Number of successful extensions: 1880 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -