BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K22 (970 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 45 1e-06 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 45 1e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 44 2e-04 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 42 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 40 0.002 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.003 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 39 0.005 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 38 0.016 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 38 0.016 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.016 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.037 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 35 0.11 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 34 0.20 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 34 0.20 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 34 0.20 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 34 0.20 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 34 0.20 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.26 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 33 0.35 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.46 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.46 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.46 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 33 0.46 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 33 0.46 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 32 0.61 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.80 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 32 0.80 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 32 0.80 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.1 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.4 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 31 1.4 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 31 1.4 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.9 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.9 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.9 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 30 2.5 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 2.5 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 30 2.5 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 3.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 3.2 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 3.2 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 4.3 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 4.3 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 29 4.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.4 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 5.7 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 5.7 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 29 5.7 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 29 5.7 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 5.7 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 29 5.7 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 29 7.5 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) 29 7.5 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 29 7.5 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 7.5 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 29 7.5 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 29 7.5 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 29 7.5 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 7.5 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 28 9.9 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 9.9 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 28 9.9 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 28 9.9 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 28 9.9 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP S P P PPP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PPPP PP PP P PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PPPP PP PP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P PPPP PP PP P PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PPPP PP PP P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP P PP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP P PP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP P P PP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P P PP PP PP P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP P P PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 376 PSPPPPPPPP-PPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP P PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP P PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXP--PPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P P P PPP PP PP P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +3 Query: 753 PPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXP 932 PP P P P P P P P PPPPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP----PPPPPPPPPPPPAP 420 Query: 933 XPPPWXPXXPP 965 PPP P PP Sbjct: 421 PPPPPPPPPPP 431 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P+ P PPPP PP PP P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 39.1 bits (87), Expect(2) = 1e-06 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PPPP PP PP PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP P P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P PPP P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXR 945 P P P P P P P PP PP PP P R Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 +P P P PPPP PP PP P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P +P PP P PP PP P P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP P P P P P P P PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP--PPPP 425 Query: 924 PXPXPPP 944 P P PPP Sbjct: 426 PPPPPPP 432 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P PP P PP PP P + P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 31.5 bits (68), Expect(2) = 1e-06 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P PP P PP PP P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P PP P PP PP P P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 31.1 bits (67), Expect = 1.4 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP P PP PP P P PP Sbjct: 365 PPPPPPPPPPPPSPPPP-PPPPPPSPPPPPQPPPPPPPPPPPP----------------- 406 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPP 903 P P P AP P P PPPP Sbjct: 407 -----PPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P PP P PP PP P P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXR 735 PP P P PP P PP PP P R Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 49.2 bits (112), Expect = 5e-06 Identities = 29/111 (26%), Positives = 32/111 (28%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP +P PP P PP PP P +PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P+P P P P P P P PP PP P PP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/111 (26%), Positives = 31/111 (27%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP PP PP P + +PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PP PP PP P PP P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP 202 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/111 (28%), Positives = 33/111 (29%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP P PP PP S P +PP Sbjct: 114 PPYPPPPNAPYPPPPNPPYPP-PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN---PPP 169 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP P PP P PP P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA--PNPPPPNPPYPPPPNAP 218 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/111 (27%), Positives = 31/111 (27%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P AP PP P P P P P PP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P P PP PP PP P PP P Sbjct: 177 PPYPPPPNPPYP-PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN--PPYPP 224 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/113 (26%), Positives = 30/113 (26%), Gaps = 2/113 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXP--PXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXX 807 PP P P P P P P PP P P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPP PP PP P PP P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPN--PPYPP 235 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/100 (29%), Positives = 29/100 (29%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P AP PP P P PP P P PP Sbjct: 141 PPSPNAPYPPPPNPPYP-PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P AP P P PPP PP PP P Sbjct: 200 NAPNPPPPNPPYPPPPNAPNP--PYPPPPNAPNPPYPPPP 237 Score = 35.1 bits (77), Expect = 0.086 Identities = 27/112 (24%), Positives = 27/112 (24%), Gaps = 1/112 (0%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXP-PTRPXXPVXPXKXXAXXX 809 PPPP P P P P P P P P P Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 810 XXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP P P P P PP Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 31.5 bits (68), Expect = 1.1 Identities = 29/123 (23%), Positives = 31/123 (25%), Gaps = 12/123 (9%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXX-FRXPXXRPXXPPTRPXXPVXPXKXXAXXX 809 PPPP P P + P P PP P P P Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 810 XXXXXXXXXXXXPXPXXXXPXPXLXXXPPPP------PXXXSXTPXPXP-----PPWXPX 956 P P P P PPPP P P P P PP+ P Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Query: 957 XPP 965 P Sbjct: 237 PNP 239 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P AP PP PP PP P Sbjct: 212 PPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 44.8 bits (101), Expect = 1e-04 Identities = 36/111 (32%), Positives = 36/111 (32%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G G GGGGG G G G G G Sbjct: 769 GGGGGGDGGDGGGG----GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G GG G G G G GG G GG G GGGG Sbjct: 825 GDGGGYGD-GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 41.9 bits (94), Expect = 8e-04 Identities = 30/97 (30%), Positives = 30/97 (30%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G GGG G G GGGGG G G G G G F Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G GG G G G G GG G GG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG G GGG G G GGGGG Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G GGG G G GGGGG G G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 44.0 bits (99), Expect = 2e-04 Identities = 36/114 (31%), Positives = 37/114 (32%), Gaps = 3/114 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGG-GGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG G HGG G G G GGG + G G G G G A Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 787 XGXT--GXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G GG G G G G G G GG G GGGG Sbjct: 100 GGGATGGGGGATGGHGGATGG---GVGATGGHGGATGGHGGATGGHGGATGGGG 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 35/114 (30%), Positives = 36/114 (31%), Gaps = 3/114 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGG-GGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG G GG G G G GGG + G G G G G A Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGG 106 Query: 787 XGXT--GXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G GG G G G G G G GG G GGGG Sbjct: 107 GGGATGGHGGATGGGVGATGG---HGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 38.7 bits (86), Expect = 0.007 Identities = 36/117 (30%), Positives = 36/117 (30%), Gaps = 6/117 (5%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGG-----GFXXSXGXGXXXXGXGXXXXXXXXXXXXXGX 800 GG G GGG G GGGG G G G G G G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 799 AXXFXGXTGXX-GRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G TG G GG G G G G G G GG G GGGG Sbjct: 111 TGGHGGATGGGVGATGGHGGATGG---HGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 35.1 bits (77), Expect = 0.086 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 2/107 (1%) Frame = -1 Query: 946 HGGGXGXGVXEXXXGGG--GGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 HGG G GGG GG G G G G G G TG Sbjct: 39 HGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATG 98 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G G G G G G GG G GG G Sbjct: 99 GGGGATGGGGGATGGH--GGATGGGVGATGGHGGATGGHGGATGGHG 143 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.2 bits (97), Expect = 3e-04 Identities = 34/111 (30%), Positives = 34/111 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G GGGG G G G G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G TG G G G G G G G G GG G GGGG Sbjct: 308 GATGVGGGATGGGGGATGG--GVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 40.7 bits (91), Expect = 0.002 Identities = 34/111 (30%), Positives = 34/111 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG GGG G GGGGG G G G G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGA-TGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G TG G G G G G G G G GG G GGGG Sbjct: 301 GATGGGGGATGVGGGATGG--GGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 37.1 bits (82), Expect = 0.021 Identities = 34/107 (31%), Positives = 35/107 (32%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G GGGGG + G G G G G A G Sbjct: 239 GRLGGGGATGGGGGATGGGGGA--TGGGGGATGGGGGATGGGGGATGGGGGATG-----G 291 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G GG G G G GV G G GG G GGGG Sbjct: 292 GGGATGGGGGATGG---GGGATGVGGGATGGGGGATGGGVGATGGGG 335 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PPPP PP+PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-----PXPXXXRGXPPXXP 966 P P P P P P PPPP PP+P P P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P+ P P P P PP PP PP P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPP PP PP P R PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PR P PPPP PP P P PP P Sbjct: 204 PPPPPPRPPPSPPPPP-PPPSPSPPRPPPPPPPSPP 238 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P PPPPP S P PPP P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PT+P PPPP P PP P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPP 230 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P P P Sbjct: 204 PPPPPPRP-PPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P P PPPPP P P PPP P Sbjct: 204 PPPPPPRPPPSPP-PPPPPPSPSPPRPPPPPPPSPP 238 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 HP + + P PP P PP PP P P P Sbjct: 194 HPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 846 PXPXXXXPXPXLXXX--PPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP S +P P PPP P PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSP-PRPPPPPPPSPP 238 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPP-XXXPPKPPXPXXXR-GXPPXXP 966 P P P P P PP P PP PP P + PP P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP-PXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP P P PPP P PP Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP-IPNMPP 256 Score = 26.6 bits (56), Expect(2) = 0.16 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 673 PPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P PP PP P S P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 26.2 bits (55), Expect(2) = 0.16 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 847 PHPXPTAPXP---RXPXXPPPPXXXPPKPP 927 P P P+ P P + P PP P P PP Sbjct: 231 PPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 25.4 bits (53), Expect(2) = 0.78 Identities = 13/45 (28%), Positives = 14/45 (31%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXR 777 P +P PP P PP P P P PP R Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPR 239 Score = 25.0 bits (52), Expect(2) = 0.78 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P PPP PP P P Sbjct: 233 PPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/123 (26%), Positives = 35/123 (28%), Gaps = 11/123 (8%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPX---CXPXXSGXRXXGPTXHPPXRXXRLXHXXXRX 801 + P P R PP PP PP P P PP R + R Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 802 XXXXXXXXXXXXXXX---PHPXPTAPXPRXPXXPPPPXXXPPK-----PPXPXXXRGXPP 957 P P P P P PPP PP PP P RG PP Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Query: 958 XXP 966 P Sbjct: 405 PGP 407 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/74 (27%), Positives = 22/74 (29%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP+R P P P P P P PPP + Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 364 Query: 924 PXPXPPPWXPXXPP 965 P P PP P PP Sbjct: 365 PPPPPPVGGPPPPP 378 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P PPPP P PP P PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXP--RXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP P P PPPP P PP P PP P Sbjct: 68 PAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 847 PHPXPTAPXP--RXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P AP P P PPPP P PP P PP Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPP + P P PP P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P PPPPP + P P PP + P Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPP P P PP P PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 30.7 bits (66), Expect(2) = 0.049 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P A P P PPPP P PP PP P Sbjct: 75 PPPPAAPPAAP--PPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP P P PPP PP P P P P Sbjct: 78 PAAPPAAPPPPPPLPAPPP---PPAQPAPQPPPAPPHFLP 114 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P P P PP Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PP P P P PPP P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P AP PP PL P PP P Sbjct: 75 PPPPAAPPAAPP-PPPPLPAPPPPPAQP 101 Score = 24.2 bits (50), Expect(2) = 0.049 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +1 Query: 652 PRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 P PP P PP PP P P PP Sbjct: 43 PHFISSSPPPP--PPSPPAAAPAAPPPPAAAPAAPPP 77 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PPPP PP PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 AP P P PPPP PP PP P PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PPPP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P P P P PPPP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PPPP P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PPPP P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPPP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPP 705 PP P P PP P PP PP Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P P PP P PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P P PP P PP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P T P P PPPP PP PP P PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP P P PPP P PP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXX---XPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP P P + P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXP-XPPPWXPXXPP 965 P P P PPPPP P P PPP P PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPP-PWXPXXPP 965 P P + PPPPP P P PP P P PP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP PP P P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P P PP P PP PP P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP PP P G PP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPP--TNGPPPPPP 409 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP PP P G PP P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPP--TNGPPPPPP 399 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P PPPP PP PP P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP PP P G PP P Sbjct: 355 PSPPPPTNNTPP-PPPPTNKPPPPPPP--TNGPPPPPP 389 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP + P P PPP PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP + P P PP P PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP + P P PP P PP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP + P P PPP PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PP PP + TP P PP P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P PPPP P PP P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPP + P P PPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPP + P P PPP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXP-XXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP P PP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PPT P P P P P PPPPP + Sbjct: 346 PPPPPTN-NPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Query: 924 PXPXPPPWXP 953 P P PP P Sbjct: 405 PPPPPPTNGP 414 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPT--APXPRXPXXPPPPXXXPP-KPPXPXXXRGXPPXXP 966 P P PT P P P PP P KPP P PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPP 927 P+ P P P PPPP PP PP Sbjct: 72 PSTPAP--PPPPPPPSSGPPLPP 92 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLX---PPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P PP P PP PP P GP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 847 PHPXPT---APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P PT P P PPPP PP P PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 39.1 bits (87), Expect = 0.005 Identities = 35/112 (31%), Positives = 36/112 (32%), Gaps = 2/112 (1%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXG--XGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 G G GGG G G GGGGG+ G G G G G Sbjct: 123 GGGGRRGGGYGGG-----RGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Query: 787 XGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G GG G G G GG G GG G GGGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG-GYGGGRSGGGG 228 Score = 33.5 bits (73), Expect = 0.26 Identities = 30/101 (29%), Positives = 32/101 (31%), Gaps = 3/101 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGG---GGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAX 794 GG G GGG G GGG GG G G G G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Query: 793 XFXGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 + G G G GG G G G G GG +G GG Sbjct: 190 GYGGG-GYGGGGGGYGGSGYGGGGGYGGGG-YGGGRSGGGG 228 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 778 TGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 +G GR GG G G G GG RGG RGGGG Sbjct: 122 SGGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/73 (30%), Positives = 24/73 (32%), Gaps = 3/73 (4%) Frame = +3 Query: 732 PXXRPXXPP---TRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPP 902 P P PP TRP P P + P P P P L PPPP Sbjct: 920 PPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPP 979 Query: 903 PXXXSXTPXPXPP 941 P + T PP Sbjct: 980 PPVQTTTAPTLPP 992 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP P P P PP PP PP R P P Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP----PXXXPPKPPXPXXXRGXPPXXP 966 P PT P P P PPP P PP PP P + P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 PT P P PP P P PP P PP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPP 705 PP P AP PP PL PP PP Sbjct: 910 PPLPLAPE-----PPPPLPPPPPP 928 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 PT P P P PPPP PP PP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P P PPP + P P PPP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P PPPPP P P PP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPP + P P P P PP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P AP P PPPP PP PP Sbjct: 226 PPPAAPAPPPPPAAAPPPP---PPPPP 249 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 37.5 bits (83), Expect = 0.016 Identities = 33/107 (30%), Positives = 34/107 (31%), Gaps = 3/107 (2%) Frame = -1 Query: 943 GGGXGXGVXEXXXGGGGGFXXSXGXG-XXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGXX 767 GGG G G G GGG+ G G G G G G Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Query: 766 GRVGGXXGRXXG--XRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 GG GR G R G G GG GRG GP GG G Sbjct: 302 RGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 348 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/78 (26%), Positives = 23/78 (29%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P PPT P P P P P + PP PP Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Query: 912 XSXTPXPXPPPWXPXXPP 965 +P P PPP P P Sbjct: 305 NFTSPSPPPPPPLPPAMP 322 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP---PPXXXPPKPPXPXXXRGXPPXXP 966 P P PT+P R P PP P PP PP G PP P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 35.9 bits (79), Expect = 0.049 Identities = 26/105 (24%), Positives = 28/105 (26%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P +P PP P+ P P GP PP Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATV-------PAP 179 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P P P PPPP PP P G Sbjct: 180 AVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPPGSVLG 224 Score = 34.7 bits (76), Expect = 0.11 Identities = 25/108 (23%), Positives = 26/108 (24%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P AP P P P P P PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P + P P PPPP PP PP PP Sbjct: 171 APAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +1 Query: 847 PHPXPTAPXP--RXPXXPPPPXXX-----PPKPPXPXXXRGXPPXXP 966 P P P AP + P PPPP PP PP G PP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P PPPPP + P PPP P Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAP 146 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/84 (26%), Positives = 24/84 (28%), Gaps = 6/84 (7%) Frame = +3 Query: 732 PXXRPXXPPTR---PXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXX---PXPXLXXXP 893 P P P TR P P+ P P P P P + Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 PP P P PPP P PP Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P PPPPP + P PPP P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PT P P P PP PP R PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPP 941 P P P P PPPPP P PP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP--PXXXSXTPXPXPPPWXP 953 P P PPPP P S P P PPP P Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSP 133 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P PPPP PP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP +P P PPP P PP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXP 962 PPPPP P P PPP P P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P PPP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P PPPP PP P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 613 FSLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 FS+ +PP P P P P PP PP P Sbjct: 1150 FSVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP P PP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP---PPPPTP 1186 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPPP P P PPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP------PPPPPPP 1184 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 877 RXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 R PPPP PP P P PP P Sbjct: 1153 RDQIPPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P PPPP P P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXP 933 P PR P PPPP PP PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPP 883 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P PPPP PP PP P G P Sbjct: 860 PRPRPRRPPP---PPPPPPPPPPPPPPPPASSTGSTP 893 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P PPP P PP Sbjct: 867 PPPPP------PPPPPPPPPPPPPP 885 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P PPPPP P P PPP P P Sbjct: 860 PRPRPRRPPPPPP------PPPPPPPPPPPPP 885 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP+ PP Sbjct: 188 PSPMAGMPPPP---PPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PPP P P P G PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P A P P PPPP PP P G PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/51 (39%), Positives = 23/51 (45%) Frame = -1 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G +GG G G + G G+ GG AG GG G GGGG Sbjct: 1772 GMAGGGGGMGG-GGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 32.7 bits (71), Expect = 0.46 Identities = 32/98 (32%), Positives = 32/98 (32%), Gaps = 1/98 (1%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G GGG G G GGGGG G G G G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGM----GGGGMAAGGG-----EFGGGEGMGGGGMAGG 1806 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGV-XXGGXAGRGG 671 G G GG G G G G GG AG GG Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G G GG + G G G G Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G +GG G G G G+ GG GG G GGGG Sbjct: 1759 GGGGGGGGMGGGGGMAGGG-GGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP-PPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P PP PP PP PP P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPP-PTEPPTPPPTDP 1055 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PP PP TP P PP P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P+ P PPPP PP PP P G P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPX---PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P+ PPPP P PP P P P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQP 1277 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP--PXXXPPK----PPXPXXXRGXPPXXP 966 P P P PPP P PPK PP P R PP P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP P P P PP P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P P PPP S P P PPP P PP Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP--PPPPP 994 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXX---PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP P P PPP PP PP P PP P Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P PPPP P PP P PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPW--XPXXPP 965 PPPPP P P PPP P PP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPP 946 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPP P +PP P PP P Sbjct: 922 PPPPPGGNAPLPP--PPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXR-----GXPPXXP 966 P P P P P PPP PP PP P G PP P Sbjct: 933 PPPPPGGSAPSQP--PPPGGNAPPPPPPPGGSAPPPGGGAPPLPP 975 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P T P PP PP PP P PP P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPP 937 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PP P P PPP PP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPP 705 PP P P PP P PP PP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P PPPP PP PP P G Sbjct: 972 PLPPPPGGSAPPPPPP--PPPPPPPMRKLG 999 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.1 bits (77), Expect = 0.086 Identities = 24/89 (26%), Positives = 26/89 (29%) Frame = -1 Query: 946 HGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGXX 767 + GG G GV GGGGG G G G G G G Sbjct: 26 YNGGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNG 85 Query: 766 GRVGGXXGRXXGXRKXXGXXGVXXGGXAG 680 G G G G GV G +G Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 32.7 bits (71), Expect = 0.46 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G +GGG G GV G GGG G G G G G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNV 99 Query: 781 XTGXXGRVGGXXG 743 G G VGG G Sbjct: 100 GGGGSGGVGGNGG 112 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 766 GRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G VGG G G G G GG GG G GGGG Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGG-GNDGGNGGGGAGNGGGGG 80 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 34.7 bits (76), Expect = 0.11 Identities = 30/112 (26%), Positives = 31/112 (27%), Gaps = 1/112 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P P P PP P + P PP L Sbjct: 245 PPMPETP--LPPATPNPFIPPASPNPSIPPAPPNPSIPA--PPNPSIPLAPPNPYIPPAP 300 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP-PXXP 966 PH P P P P PP P PP PP P P P P Sbjct: 301 PNLFIPSAPPNPHIPPAPPNPYIPTAPPNP-SIPPAPPNPSIPPAPPNPSIP 351 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P PT P P P PP P PP PP P PP P Sbjct: 182 PSTIPTPPTPPAPPSPPIP-TAPPTPPMPETP--LPPGSP 218 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/76 (25%), Positives = 21/76 (27%), Gaps = 2/76 (2%) Frame = +3 Query: 744 PXXPPT--RPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXS 917 P PPT P P+ P P P P + P PP Sbjct: 200 PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNP 259 Query: 918 XTPXPXPPPWXPXXPP 965 P P P P PP Sbjct: 260 FIPPASPNPSIPPAPP 275 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 847 PHPX-PTAPX-PRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P+P PTAP P P PP P PP PP P P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSI-PPAPPNPSIPPAPP 355 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 34.3 bits (75), Expect = 0.15 Identities = 30/115 (26%), Positives = 32/115 (27%), Gaps = 4/115 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXP-LXPPXPPX--CXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP PR G P P + PP P P + P P R R Sbjct: 473 PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 532 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPPXXP 966 PHP P P PPP P PP R PP P Sbjct: 533 PPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 32.7 bits (71), Expect = 0.46 Identities = 29/112 (25%), Positives = 30/112 (26%), Gaps = 5/112 (4%) Frame = +1 Query: 637 PXPXAP--RXXXXGPPXPLXPPXP---PXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRX 801 P P AP R G P P PP P P + P P R R Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 551 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 PHP P P PPP P PP PP Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Score = 31.1 bits (67), Expect = 1.4 Identities = 31/121 (25%), Positives = 34/121 (28%), Gaps = 13/121 (10%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXP---PXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP PR G P PP P P + + P P R R Sbjct: 383 PPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFP 442 Query: 805 XXXXXXXXXXXXXXPHPX---PTAPXPRXP-------XXPPPPXXXPPKPPXPXXXRGXP 954 PHP P AP PR P PPP P PP + P Sbjct: 443 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVP 502 Query: 955 P 957 P Sbjct: 503 P 503 Score = 28.7 bits (61), Expect = 7.5 Identities = 34/127 (26%), Positives = 34/127 (26%), Gaps = 16/127 (12%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPX----PPXCXPXXSGXRXXGP-TXHPPXRXXRLXHXXXR 798 PP PR G P P PP P P R P HP H R Sbjct: 513 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHP--R 570 Query: 799 XXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPP--PXXXPP---------KPPXPXXXR 945 PHP P P PPP P P PP P R Sbjct: 571 VPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQR 630 Query: 946 GXPPXXP 966 PP P Sbjct: 631 VPPPGAP 637 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.9 bits (74), Expect = 0.20 Identities = 30/130 (23%), Positives = 32/130 (24%), Gaps = 5/130 (3%) Frame = +1 Query: 592 PGXGXGRFSLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRX 771 P GR L P P PP P PP P G PP + Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 275 Query: 772 XRLXHXXXRXXXXXXXXXXXXXXXXP-----HPXPTAPXPRXPXXPPPPXXXPPKPPXPX 936 P P P P P PPP P PP P Sbjct: 276 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPL 335 Query: 937 XXRGXPPXXP 966 + PP P Sbjct: 336 RGQIAPPPPP 345 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P L PPPPP P P PP PP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 342 Score = 32.3 bits (70), Expect = 0.61 Identities = 27/112 (24%), Positives = 29/112 (25%), Gaps = 8/112 (7%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPP RGP F P PP+R P+ P Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 341 Query: 813 XXXXXXXXXXX-----PXPXXXXPXPXLXXXPPPP---PXXXSXTPXPXPPP 944 P P P P PPPP P P P PPP Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.5 bits (68), Expect = 1.1 Identities = 30/116 (25%), Positives = 32/116 (27%), Gaps = 5/116 (4%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P P PP S PT PP Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPK---RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQ 306 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPP--PXXXPPKPPX---PXXXRGXPPXXP 966 P P P + + P PPP PP PP P R PP P Sbjct: 307 APAPPPPLNATPPPPPPS-RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 Score = 30.3 bits (65), Expect = 2.5 Identities = 31/104 (29%), Positives = 32/104 (30%), Gaps = 4/104 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P + R PP PL PP P S R P PP R Sbjct: 298 PPLPPS-RDQAPAPPPPLNATPPP---PPPS--RDQVPLPPPPLRGQ-----IAPPPPPI 346 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPP----KPPXP 933 P P AP P PPPP PP PP P Sbjct: 347 SKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.9 bits (74), Expect = 0.20 Identities = 30/130 (23%), Positives = 32/130 (24%), Gaps = 5/130 (3%) Frame = +1 Query: 592 PGXGXGRFSLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRX 771 P GR L P P PP P PP P G PP + Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKR 187 Query: 772 XRLXHXXXRXXXXXXXXXXXXXXXXP-----HPXPTAPXPRXPXXPPPPXXXPPKPPXPX 936 P P P P P PPP P PP P Sbjct: 188 GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPL 247 Query: 937 XXRGXPPXXP 966 + PP P Sbjct: 248 RGQIAPPPPP 257 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P L PPPPP P P PP PP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP 254 Score = 32.3 bits (70), Expect = 0.61 Identities = 27/112 (24%), Positives = 29/112 (25%), Gaps = 8/112 (7%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPP RGP F P PP+R P+ P Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 253 Query: 813 XXXXXXXXXXX-----PXPXXXXPXPXLXXXPPPP---PXXXSXTPXPXPPP 944 P P P P PPPP P P P PPP Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 31.5 bits (68), Expect = 1.1 Identities = 30/116 (25%), Positives = 32/116 (27%), Gaps = 5/116 (4%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P P PP S PT PP Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPK---RGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQ 218 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPP--PXXXPPKPPX---PXXXRGXPPXXP 966 P P P + + P PPP PP PP P R PP P Sbjct: 219 APAPPPPLNATPPPPPPS-RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 Score = 30.3 bits (65), Expect = 2.5 Identities = 31/104 (29%), Positives = 32/104 (30%), Gaps = 4/104 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P + R PP PL PP P S R P PP R Sbjct: 210 PPLPPS-RDQAPAPPPPLNATPPP---PPPS--RDQVPLPPPPLRGQ-----IAPPPPPI 258 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPP----KPPXP 933 P P AP P PPPP PP PP P Sbjct: 259 SKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXX----XPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP PP P G PP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPP PP PP P PP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPP-PPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPPP P P PPP Sbjct: 307 PPPPGGAPPPP--PPPPPPPPGDGGAPPPPPPP 337 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPPP P P PPP PP Sbjct: 306 PPPPPGGAPPPPP------PPPPPPPGDGGAPP 332 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GG G G GGGGGF G G G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGGF G G G G Sbjct: 81 GGRGGGFGGGGGFG-----GGGGGGFGGGGGGGFGGGGGG 115 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 GG G GGG G G GGGGG G G G Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G G GGG G G GGGGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G G GGG G G GGGGG G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG + G G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPW 947 P P PPPPP S P P PPP+ Sbjct: 304 PPPTDFAPPPPPPEPTSELPPPPPPPF 330 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPPP P PP P PP P Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P P P PP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPP 325 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P+ P PP P+P P +G PP P Sbjct: 160 PQPYPAQPYPQQGYPPQPPPQAYPQPGYP--PQGYPPTGP 197 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPPXXP 966 P P PTA P PP P P P P +G PP P Sbjct: 138 PMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPP 178 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P + P P PPPP PP PP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPP-PPPPPAP 390 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -1 Query: 766 GRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G GG GR G G G+ GG GRGG + G G GG Sbjct: 127 GGRGGWRGRGGGEGNGAGG-GIGRGGGRGRGGGEGGWGGRGGNGG 170 Score = 31.9 bits (69), Expect = 0.80 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = -1 Query: 784 GXTGXXGRVGGXX-GRXXGXRKXXGXX-GVXXGGXAGRGGXKXXXXGPRGGGG 632 G G GR GG G G + G G GG GRGG G GGGG Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 GG GGG G G GG GG+ G G G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG 174 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P++ P P PPP P +P P PP P Sbjct: 518 PTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQP 555 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P+ P PR P P PP P+PP P R PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPR-PRPPTP---RPGPP 1383 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 859 PTAPXPRXPXXP--PPPXXXPPKPPXP 933 P P P P P PPP PP+P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP 1601 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 8/46 (17%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXX--------PPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP PP P G PP P Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 32.3 bits (70), Expect = 0.61 Identities = 25/96 (26%), Positives = 26/96 (27%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P P G + PP PP P SG P PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPP------PPGCAGLPPPPP 730 Query: 817 XXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKP 924 P P P P PPPP P KP Sbjct: 731 SPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P P PP PP P G PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMP---PPPPPPPPGCAGLPPPPP 730 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXX---PPKPPXPXXX-RGXPPXXP 966 P P + P P PPPP PP PP P G PP P Sbjct: 701 PPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P L PPPPP + P P PP P P Sbjct: 728 PPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXP 953 PPPPP P P PPP P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPP 719 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPXC 711 LPP P +P+ G P P PP PP C Sbjct: 725 LPPPPPSPQPGCAGLPPPP-PPPPPGC 750 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXP 962 PPPPP S T P PPP P P Sbjct: 698 PPPPPPLLSGT-LPMPPPPPPPPP 720 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +3 Query: 846 PXPXXXXPXPXLXXX----PPPPPXXXSXTPXPXPPP 944 P P P P L PPPPP P PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P PT P P PPP PP P P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTP 150 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 PPPP + P P PP P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPP 145 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P P PPP PP PP Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 847 PHPXP-TAPXPRXPXXPPPPXXXPP-KPPXPXXXRGXPP 957 P P P T P P P P PP PP PP PP Sbjct: 137 PPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P PPPPP P P PPP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPP 670 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G + GGGG G G G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 GG G GGG G G GGGGG G G G Sbjct: 82 GGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G G GGG G G G G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGG G G G G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGG-GGFXXSXGXGXXXXGXG 845 GG G GGG G G + GGG GG G G G G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G GGGGG G G G G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 62 GGGGGGGGGGGGGG---GGGGGGGGDDGDGGGGDGGGGGG 98 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 32.7 bits (71), Expect = 0.46 Identities = 30/101 (29%), Positives = 31/101 (30%), Gaps = 3/101 (2%) Frame = +1 Query: 673 PPXPLX-PPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXXXXXXXXXXP 849 PP PL PP PP P P +PP R R P Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTL-PPRYPPS-PPRYPPSPPRYPPSLHRYPQSPLRYPP 322 Query: 850 HPXPTAPXP-RXPXXPPP-PXXXPPKPPXPXXXRGXPPXXP 966 P P P R P PP P P PP P PP P Sbjct: 323 SPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYP 363 Score = 29.1 bits (62), Expect = 5.7 Identities = 29/110 (26%), Positives = 31/110 (28%), Gaps = 2/110 (1%) Frame = +1 Query: 634 PPXPXA-PRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP P P PP + P P P P +PP R R Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPS-LHRYPQSPLRYPPS 323 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP-XPXXXRGXPP 957 P P P P P PP P PP PP P PP Sbjct: 324 PIRYPPLPSRYPPSP-PRYPSSH-PRYPPSPPRYPPSPPRYPSSHPRYPP 371 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P AP P P PPPP PP P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P P PPPP PP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 P A P PPPP PP PP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPP 944 P PPPPP P P PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPP 944 P PPPPP P P PPP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 P P PPPP PP PP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPP 117 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 P PP + P P PPP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPP 117 Score = 27.9 bits (59), Expect(2) = 0.49 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPP 903 P P P P P P PPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 23.4 bits (48), Expect(2) = 0.49 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 892 PPPPXXXPPKPPXP 933 PPPP PP P P Sbjct: 138 PPPPPPPPPAPCMP 151 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP-PPXXXPPKPP 927 P P P + P+ P PP PP PP PP Sbjct: 564 PPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P PP P PKPP P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPP 578 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PP P PP P PP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P + PP PP P P P P PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.3 bits (70), Expect = 0.61 Identities = 29/113 (25%), Positives = 30/113 (26%), Gaps = 2/113 (1%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXG--GGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXX 791 GG G GG G GG G S G G G Sbjct: 307 GGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQ 366 Query: 790 FXGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G GG G G + GG G GG G RGG G Sbjct: 367 SGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGG-GGSAFGIEGGRGGHG 418 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.9 bits (69), Expect = 0.80 Identities = 30/110 (27%), Positives = 34/110 (30%), Gaps = 3/110 (2%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPX-CXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP P P+ GPP P P PP C P + H + + Sbjct: 809 PPGPPGPK----GPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGI 864 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPP-PPXXXPPK-PPXPXXXRGXP 954 P P P P P PP PP PK PP P G P Sbjct: 865 NGPPGQVGEMGPPG-LPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPP 913 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPPP PP PP P G PP P Sbjct: 31 PPPPYEAPPPPPGPPGPDG-PPGFP 54 Score = 30.3 bits (65), Expect = 2.5 Identities = 28/111 (25%), Positives = 31/111 (27%), Gaps = 6/111 (5%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P +P GPP P P PP GP + + H Sbjct: 797 PPGPASP-PSPPGPPGPPGPKGPPGPNGPLGPPGECGPAGNAGGVGCQGNHGNPAGSQGP 855 Query: 814 XXXXXXXXXXXP------HPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P P P PP P PP PP P G Sbjct: 856 NGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSP-PGPPGPPGPKGPPG 905 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP--PKPPXPXXXRGXPPXXP 966 P P P P P PP P P P P P +G PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKG-PPGLP 69 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP-PPXXXPPK-PPXPXXXRGXP 954 P P P P P PP PP PK PP P G P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP + P PPP P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPK 921 P P P P P PPPP PP+ Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPPQ 107 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 P +P P P PPPP PP PP P Sbjct: 1308 PESPPP--PPPPPPPPPPPPLPPTP 1330 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P + P P P PPPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P PT P PPPP PP P P Sbjct: 346 PTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P L PPPPP P P PPP Sbjct: 346 PTPTTPKTHPQLGPPPPPPP------PPPTPPP 372 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P T P P P PPPP P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPP--QTPAPPGP 121 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P P P P P P PP P PP P P Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKP 136 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 862 TAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 T P P PPPP PP PP P P P Sbjct: 91 TCGDPPPPATPPPPTM-PPTPPPPQTPAPPGPDTP 124 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP-XPXPPPWXPXXP 962 P P P P P PPP S P P PPP P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P+ P P P PPPP P PP Sbjct: 1062 PSPPPSEPAP-PPRQPPPPSTSQPVPP 1087 Score = 30.3 bits (65), Expect = 2.5 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 7/78 (8%) Frame = +3 Query: 753 PPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPP-----PPPXXXS 917 P P P+ P K P P P PP PPP S Sbjct: 989 PIPHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPS 1048 Query: 918 XTPX--PXPPPWXPXXPP 965 P P PPP P PP Sbjct: 1049 PPPSAVPIPPPRKPSPPP 1066 Score = 28.7 bits (61), Expect = 7.5 Identities = 25/112 (22%), Positives = 28/112 (25%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 +PP A P P P PP P + P P + Sbjct: 1027 VPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVP 1086 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 HP T P PR P P P P R PP P Sbjct: 1087 PPRQPDPIPTNPAHP--TEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKP 1136 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P PT P+ P PPP P+PP RG Sbjct: 425 PQPSPTGAPPQRPH--PPPQQPSPRPPMGVPHRG 456 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 PT P P P PPPP P PP P Sbjct: 781 PTTPPPEYP--PPPPGLARPNPPPP 803 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +1 Query: 847 PHPXPTAPX-PRXPXXPP----PPXXXPPKPPXPXXXRGXPP 957 P P T P PR P P PP P PP P RG PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPP 470 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P P P P PPPP PP P +G P Sbjct: 484 PPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P+ + P PP P PKPP P PP Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPP 772 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PP PP TP P PP PP Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPP 772 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGG G G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PH PT P P P P P P+P P R P P Sbjct: 49 PH-RPTIPSPHDPITPRPHRPTAPRPHDPIAPRPRSPHGP 87 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PH PTAP P P P P P P P P P Sbjct: 65 PH-RPTAPRPHDPIAPRPRSPHGPVAPRPHRPISPRPHRP 103 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPP 927 PTAP P P P P P PP Sbjct: 17 PTAPRPHRPIAPSPLGPTTPSPP 39 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 31.1 bits (67), Expect = 1.4 Identities = 27/91 (29%), Positives = 29/91 (31%), Gaps = 1/91 (1%) Frame = -1 Query: 901 GGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGXXGRV-GGXXGRXXGXR 725 G GG+ G G G G G GR+ GG GR G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG-- 61 Query: 724 KXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G GG GRG GP GG G Sbjct: 62 ---GGWGRMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 28.7 bits (61), Expect = 7.5 Identities = 27/99 (27%), Positives = 31/99 (31%), Gaps = 2/99 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGV-XEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG GGG G G G GGG+ G G G Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLG 81 Query: 787 XGXTGXXGRV-GGXXGRXXGXRKXXGXXGVXXGGXAGRG 674 G G GR+ G GR G + G G+ G G G Sbjct: 82 RGPGGGWGRMQEGGMGRGPG--QGWGCRGMGCGWGCGNG 118 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P P P P P PPPP P +P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXPXXXRGXP 954 P PPPP PP PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPPP PP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXP 933 P PPPP PP PP P Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P P P PPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP P P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXP 962 PPPPP P P PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 PT P P P PPPP PP P P G Sbjct: 59 PTVPIP--PTLPPPPPPPPPPLPPPPPSGG 86 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP P G P P Sbjct: 664 PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P PPPPP P PPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXX----PPKPPXPXXXRGXPPXXP 966 P A P P PPPP PP PP P PP P Sbjct: 656 PEAGPP--PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P P G P P PP P P G PP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 PT P P P PPPP PP P P G Sbjct: 283 PTVPIP--PTLPPPPPPPPPPLPPPPPSGG 310 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPX--PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP P P PPPP P PP P G PP P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPP-GAPAAPPAPPF--GGPPSAP 202 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGGF G G Sbjct: 46 GGRGGPRGGGRGGG-----RGGGGGFKSPRGGG 73 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P+ P P PPPP P KP P PP P Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKPTKP----SLPPVPP 827 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPX-PRXPXX-PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P PR P P P P PP P + P P Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 PHP P P + P PP PP P Sbjct: 63 PHPVPPTPLVQHPEPEAPPQLPPPPP 88 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 PHP P P + P PP PP P Sbjct: 722 PHPVPPTPLVQHPEPEAPPQLPPPPP 747 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +1 Query: 847 PHPXPTAPXPRX---PXXPPPPXXXPPKPPXP 933 P P P R P PPPP PP PP P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPP 440 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 P P P AP P P PP P P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP P P PPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPP 918 P P PT P PR PPP PP Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPPP 277 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PT P PPPP PP P RG P P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPP P PP P G PP P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPI-RGGVPPPPP 221 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G G +GGG G G GGGGG+ G G G G Sbjct: 201 GSSRGGYGGGRGGGGYGGGRGGGGGY----GGGRRDYGGG 236 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G GGG G G GGGGGF S G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGF-SSRGRG 372 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P R P PPP P PP P R P P Sbjct: 926 PSPSPPRRRRRSPSNSPPPMRSSPLPP-PQRKRASTPPSP 964 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 613 FSLXXXLPPXPXAPRXXXXGPPXPLXPPXPP 705 FS L P P P P PL PP PP Sbjct: 677 FSSKPPLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP P P PPP Sbjct: 425 PPPPPGFPQFQPPPPPPP 442 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGG 890 G HGGG G G GGGGG Sbjct: 27 GGHGGGHGYGGGPNGGGGGGG 47 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 GG G +GGG G G GGGG+ G G G Sbjct: 196 GGSKGGYGGGSGGG-GYGGGRGGGGYGGGHGGGGYGGG 232 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P P P R P PPP P +P P + P Sbjct: 928 PEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSP 963 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPPP P PP P PP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 +P P P PPPP P G PP P Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P A R PPP P P P PP P Sbjct: 122 PRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKP 161 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P + P PR PPP P+PP Sbjct: 141 PTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXX----PPKPPXPXXXR 945 PT P P P P P PPKPP P R Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPPR 168 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP---PXXXPPKPPXPXXXRGXPP 957 P P P P P PPP P PP P P PP Sbjct: 368 PIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPP 407 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 25.0 bits (52), Expect(2) = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPL--XPPXPPXCXPXXSGXRXXG-PTXHPP 762 PP P P P PL P PP SG G P PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPP 2195 Score = 22.6 bits (46), Expect(2) = 4.4 Identities = 11/34 (32%), Positives = 12/34 (35%), Gaps = 1/34 (2%) Frame = +1 Query: 859 PTAPXPRX-PXXPPPPXXXPPKPPXPXXXRGXPP 957 P+ P P P PP PP P P P Sbjct: 2191 PSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 965 GXXGGXPRXXXGXGGXGGXXXGGGG-XXGXRGXGAVGXGXG 846 G GG P G GG G G GG G G G + G G Sbjct: 185 GMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGGMPGGPG 225 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P PPPP KP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 A P PPPP PP PP P + P Sbjct: 71 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 862 TAPXPRXPXXPPPPXXXPPKPP 927 T P P PPPP PP PP Sbjct: 72 TPPPLCAPPPPPPPPPPPPPPP 93 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 953 GXPRXXXGXGGXGGXXXGGGGXXGXRGXGA 864 G P G GG G GGGG G G G+ Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGS 252 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG G GGG G G GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 716 GXXXGGXGGXSGXGGPKXXXRGAXGXGG 633 G GG G G GGP+ G+ G GG Sbjct: 193 GGRGGGRGAPRGRGGPRGGGGGSGGYGG 220 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P PPPP KP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 A P PPPP PP PP P + P Sbjct: 272 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 862 TAPXPRXPXXPPPPXXXPPKPP 927 T P P PPPP PP PP Sbjct: 273 TPPPLCAPPPPPPPPPPPPPPP 294 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG GGG G G + GGGGG Sbjct: 116 GGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGG 890 G G +GGG G G GGGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGG 126 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGF-XXSXGXG 866 GG G GG G G GGGGGF S G G Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGG 138 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -1 Query: 778 TGXXGRVG-GXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 T G+ G G G+ + G G G AG+GG GP G GG Sbjct: 28 TRGDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGG 77 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G HGGG G G G GG G G G G Sbjct: 40 GGHGGGHGGGRGRG---RGHGHGGDVGGDDGDGGNCDGDG 76 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 873 PXLXXXPPP-PPXXXSXTPXPXPPPWXPXXP 962 P + P P PP TP P PPP P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTP 65 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP T P PPP Sbjct: 9 PPPPPIAAEFTAPPAPPP 26 >SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) Length = 687 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 874 PRXPXXPPPPXXXPPKPPXP 933 P+ P PPP PKPP P Sbjct: 10 PKAPPEQPPPAPKEPKPPKP 29 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 P P S +P P PPP P PP Sbjct: 165 PTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +1 Query: 859 PTAPXPRXPXX---PPPPXXXPPKPPXPXXXRGXPP 957 PTA P P PP P P PP P + PP Sbjct: 213 PTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 28.7 bits (61), Expect = 7.5 Identities = 26/100 (26%), Positives = 29/100 (29%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G G G G G GGGGG+ G G G Sbjct: 197 GGRGGYGGRGRGGG-GRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSY 255 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXK 665 G G +G G K G G GRGG + Sbjct: 256 GSYDGYGSMGMYNQSSSGYGKSYGGMSGGGSGGRGRGGGR 295 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P + P PPPP PP P Sbjct: 385 PTPPPMSTHPEFTSKPPPPPVASKPPPKP 413 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 874 PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PR P PP P PP P PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNP 249 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 847 PHPXPT-APXPRXPXXPPPPXXXPPKPP-XPXXXRGXPP 957 P P T P + P PP P PP PP P PP Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P P P P PP P PPKP Sbjct: 236 PVPPTNPPVPPTNPPAPPTNPPKP 259 >SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) Length = 402 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P+ P PP PP PP P G Sbjct: 233 PTPQTEDNPGPPPVYPPNPPEPYSPYG 259 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +1 Query: 145 PRLRSRQLPATSSRILKKWVRGFETPSSARLQQSTPWQKQKLSDKDRA*IIPQNVTTLI 321 PR R+ ++IL+ ++R +TPS + L+ + +S +DR +P N L+ Sbjct: 1414 PRQRTLDSRGNITQILRSYIRDTQTPSYSTLEAQPQLRDDVISYEDR---LPSNTHPLV 1469 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P + PPPPP P PPP PP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMPPP 105 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG G GGG G GV GGGGG Sbjct: 81 GGGCGG-GGGGGGGVGGGGGGGGGG 104 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG G GGG G G + GGGG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGG 205 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P P P PP PP PP Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPP 299 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGG G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 PT P PR P PP PP+ P P Sbjct: 291 PT-PKPRTPTPSPPTPTPPPRSPTP 314 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPPWXP 953 PPPP + P P PPP P Sbjct: 303 PPPPPLPAGVPAPPPPPPPP 322 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP 900 P PT P PR P PPP Sbjct: 75 PQPTPPPPRPPTPPPP 90 >SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP--PXXXPPKPPXP 933 P P P R PPP P PPK P P Sbjct: 340 PLPPIPRTRPAMTPPPISPTTGPPKSPAP 368 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 874 PRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P P PPP PP P P +G P Sbjct: 90 PIPPPTPPPQRRGPPGDPGPKGNKGQP 116 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P PPP P PP G PP Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXR 945 PPPP PP PP P R Sbjct: 211 PPPPPPPPPPPPPPMLAR 228 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PP PP P P PP P Sbjct: 179 PPPAPPGVLAPP-PAPPGVLPPPPAPPGALIPPPPAPP 215 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,112,623 Number of Sequences: 59808 Number of extensions: 391263 Number of successful extensions: 5936 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3028 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2860128240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -