BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K22 (970 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 42 1e-05 At4g01985.1 68417.m00265 expressed protein 47 2e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 45 7e-05 At1g61080.1 68414.m06877 proline-rich family protein 44 2e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 5e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 42 6e-04 At2g30560.1 68415.m03722 glycine-rich protein 42 6e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 6e-04 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 8e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 41 0.001 At2g05440.2 68415.m00575 glycine-rich protein 41 0.001 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 40 0.002 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 40 0.002 At5g38560.1 68418.m04662 protein kinase family protein contains ... 39 0.006 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 38 0.008 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 38 0.010 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 38 0.010 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 38 0.010 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 38 0.013 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 38 0.013 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 37 0.018 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 37 0.018 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 37 0.023 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.031 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 36 0.031 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.031 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 36 0.040 At4g18570.1 68417.m02749 proline-rich family protein common fami... 36 0.040 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 36 0.040 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.040 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.040 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.053 At4g30460.1 68417.m04325 glycine-rich protein 36 0.053 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.053 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.053 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 35 0.071 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.071 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 35 0.071 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 35 0.071 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 35 0.071 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 35 0.071 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 35 0.093 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 35 0.093 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.093 At1g10620.1 68414.m01204 protein kinase family protein contains ... 35 0.093 At1g04800.1 68414.m00476 glycine-rich protein 35 0.093 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 34 0.12 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.16 At1g75550.1 68414.m08780 glycine-rich protein 34 0.16 At1g15830.1 68414.m01900 expressed protein 34 0.16 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.16 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 28 0.19 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 33 0.22 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 33 0.22 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.22 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 27 0.25 At5g24316.1 68418.m02864 proline-rich family protein contains pr... 33 0.29 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 33 0.29 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 33 0.29 At1g29380.1 68414.m03592 hypothetical protein 33 0.29 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.29 At3g51290.1 68416.m05614 proline-rich family protein 29 0.30 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 33 0.38 At2g05440.1 68415.m00574 glycine-rich protein 33 0.38 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 33 0.38 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 33 0.38 At1g27710.1 68414.m03387 glycine-rich protein 33 0.38 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 32 0.50 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 32 0.50 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 32 0.50 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 32 0.50 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 32 0.66 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 32 0.66 At3g24540.1 68416.m03082 protein kinase family protein contains ... 32 0.66 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 0.87 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 0.87 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 31 0.87 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 31 0.87 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 31 0.87 At1g70990.1 68414.m08190 proline-rich family protein 31 0.87 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 31 0.87 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 1.2 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 1.5 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 31 1.5 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.5 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 31 1.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 31 1.5 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 30 2.0 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 30 2.0 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 30 2.0 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 30 2.0 At3g18810.1 68416.m02389 protein kinase family protein contains ... 30 2.0 At3g08630.1 68416.m01002 expressed protein 30 2.0 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 30 2.0 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 30 2.0 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 30 2.0 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 30 2.0 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 30 2.0 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 30 2.0 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 30 2.0 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 30 2.0 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 30 2.7 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 2.7 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 30 2.7 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 30 2.7 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 2.7 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 2.7 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 30 2.7 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 30 2.7 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 29 3.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 3.5 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 29 3.5 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 3.5 At4g33660.1 68417.m04781 expressed protein 29 3.5 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 29 3.5 At4g09270.1 68417.m01535 hypothetical protein same aa sequence a... 29 3.5 At4g09220.1 68417.m01528 hypothetical protein 29 3.5 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 3.5 At3g50180.1 68416.m05486 hypothetical protein 29 3.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 3.5 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 29 3.5 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 29 3.5 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 3.5 At2g05510.1 68415.m00583 glycine-rich protein 29 3.5 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 3.5 At1g53625.1 68414.m06096 expressed protein 29 3.5 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 3.5 At1g02110.1 68414.m00137 proline-rich family protein contains pr... 29 3.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 25 4.3 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 4.6 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 4.6 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 29 4.6 At4g16240.1 68417.m02464 hypothetical protein 29 4.6 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 4.6 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 29 4.6 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 4.6 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 4.6 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 29 4.6 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 29 4.6 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 29 4.6 At1g04660.1 68414.m00463 glycine-rich protein 29 4.6 At5g61660.1 68418.m07736 glycine-rich protein 29 6.1 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 29 6.1 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 29 6.1 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 6.1 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 29 6.1 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 6.1 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 29 6.1 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 6.1 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 6.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 6.1 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 6.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 6.1 At1g66260.1 68414.m07522 RNA and export factor-binding protein, ... 29 6.1 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 6.1 At1g02710.1 68414.m00222 glycine-rich protein 29 6.1 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 28 8.1 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 28 8.1 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 28 8.1 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 28 8.1 At5g14140.1 68418.m01654 zinc finger (C2H2 type) family protein ... 28 8.1 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 28 8.1 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 8.1 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 8.1 At4g26910.3 68417.m03871 2-oxoacid dehydrogenase family protein ... 28 8.1 At4g26910.2 68417.m03873 2-oxoacid dehydrogenase family protein ... 28 8.1 At4g26910.1 68417.m03872 2-oxoacid dehydrogenase family protein ... 28 8.1 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 28 8.1 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 28 8.1 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 28 8.1 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 28 8.1 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 28 8.1 At1g45688.1 68414.m05202 expressed protein 28 8.1 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 28 8.1 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 28 8.1 At1g11850.2 68414.m01364 expressed protein 28 8.1 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 41.9 bits (94), Expect(2) = 1e-05 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 PHP P +P P PPPP PP PP P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 37.1 bits (82), Expect = 0.018 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PH P +P P PP P P +PP P PP P Sbjct: 52 PHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P PP P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHF---SPPHQP 55 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPP--KPPXPXXXRGXPPXXP 966 H P P P PPPP PP PP P PP P Sbjct: 30 HISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/81 (24%), Positives = 22/81 (27%), Gaps = 4/81 (4%) Frame = +3 Query: 714 PXXFRXPXXRPXXPP----TRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXL 881 P + P P PP + P P P P P P P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Query: 882 XXXPPPPPXXXSXTPXPXPPP 944 PPPP P P P P Sbjct: 73 HPHQPPPPPHVLPPPPPTPAP 93 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PH--PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PH P P P P P P PP PP P PP P Sbjct: 41 PHHPPPPHFSPPHQPPPSPYPHPHPP-PPSPYPHPHQPPPPP 81 Score = 25.0 bits (52), Expect(2) = 1e-05 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 3/47 (6%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXP---PXPPXCXPXXSGXRXXGPTXHPP 762 LP P PP P P P PP P P HPP Sbjct: 20 LPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPP 66 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 46.8 bits (106), Expect = 2e-05 Identities = 34/111 (30%), Positives = 34/111 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G V GGGGG G G G G G Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIG 493 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G VGG G G G GG G G G G GG Sbjct: 494 GGAG--GGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGG 542 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/113 (30%), Positives = 34/113 (30%), Gaps = 1/113 (0%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG-FXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG G GG G G GG GG G G G G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGA 126 Query: 787 XGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGGV 629 G G GG G G G G GG GRGG G GGGV Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGV 179 Score = 42.3 bits (95), Expect = 5e-04 Identities = 34/116 (29%), Positives = 34/116 (29%), Gaps = 6/116 (5%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G V GGGGG G G G G Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG 343 Query: 784 GXTGXX------GRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 G G G VGG G G G G GG G GG G GG Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Score = 41.5 bits (93), Expect = 8e-04 Identities = 31/109 (28%), Positives = 31/109 (28%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G G G GV G GGG G G G G Sbjct: 223 GGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGV 282 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 G G VGG G G G G GG G GG G GG Sbjct: 283 GGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 331 Score = 41.1 bits (92), Expect = 0.001 Identities = 34/113 (30%), Positives = 34/113 (30%), Gaps = 1/113 (0%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 G G GG G G GGG G G G G Sbjct: 146 GAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGA 205 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXG-XXGVXXGGXAGRGGXKXXXXGPRGGGGV 629 G G G GG G R G GV GG AG G G RG GGV Sbjct: 206 GGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGV 258 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/110 (29%), Positives = 34/110 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G G G GG S G G G Sbjct: 169 GGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSG 228 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 G +G G VGG G G G G G +G G G GGG Sbjct: 229 GASGGVG-VGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/112 (30%), Positives = 34/112 (30%), Gaps = 1/112 (0%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGX-GXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG GGG G G GG S G G G G G Sbjct: 373 GGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGV 432 Query: 787 XGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G VGG G G G G GG G GG G G GG Sbjct: 433 GGGVG--GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGG 482 Score = 36.3 bits (80), Expect = 0.031 Identities = 36/119 (30%), Positives = 37/119 (31%), Gaps = 2/119 (1%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG-XXXXGXGXXXXXXXXXXXXXGXAXXFX 785 G G GG G G GGGGG S G G G G G Sbjct: 52 GAGGGASGGIGVG---GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGR 108 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG-XKXXXXGPRGGGGVX*XGKT 611 G G G GG G G G G G GG G GGGG GK+ Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKS 167 Score = 33.5 bits (73), Expect = 0.22 Identities = 30/111 (27%), Positives = 31/111 (27%), Gaps = 1/111 (0%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGG-GGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 G G GG G G GG G G + G G G G Sbjct: 232 GGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVG 291 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G VGG G G G G GG G G GG Sbjct: 292 GAVG--GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGG 340 Score = 32.3 bits (70), Expect = 0.50 Identities = 32/111 (28%), Positives = 32/111 (28%), Gaps = 1/111 (0%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G G G G G GGG G G G G Sbjct: 250 GGGRGSGGVGASGGAG-GNVGAGGGLGGGVG-GGVGGGVGGSVGGAVGGAVGGAVGGGGG 307 Query: 784 GXTGXXGR-VGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 G G GR GG G G V GG G GG G GGG Sbjct: 308 GSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG-GGVGGGVGGGVGGG 357 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 965 GXXGGXPRXXXGXGGXGGXXXGGGGXXGXRGXGAVGXG 852 G GG G GG G G GG G GA+G G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P PPPP PP PP P PP P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPP-PPSPPYVYPPPPPSP 451 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P +P P P PPPP PP PP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P PPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPP-----XXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 35.1 bits (77), Expect = 0.071 Identities = 20/78 (25%), Positives = 21/78 (26%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P PP P P P P P P PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Query: 912 XSXTPXPXPPPWXPXXPP 965 P P P P+ PP Sbjct: 443 VYPPPPPSPQPYMYPSPP 460 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 +P A P PPPP PP PP P PP P Sbjct: 365 YPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P P PPP+ PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPP--PPPPPPPPPPPYVYPSPP 414 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP--WXPXXPP 965 P P P PPPPP P P PPP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 +P P PPPP PP PP P PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 32.7 bits (71), Expect = 0.38 Identities = 28/101 (27%), Positives = 29/101 (28%), Gaps = 1/101 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP P PP PP P P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP----------------- 418 Query: 814 XXXXXXXXXXXPHPXPTAPXPR-XPXXPPPPXXXPPKPPXP 933 P+ P P P P P PP PP PP P Sbjct: 419 --------SPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PP P PP P PP P Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 1/112 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P P PP PP P + P P L Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPP-PXXXPPKPPXPXXXRGXPPXXP 966 P P P A P PPP PP PP P + PP P Sbjct: 515 PLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPP 566 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/117 (27%), Positives = 34/117 (29%), Gaps = 6/117 (5%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P PP PP P + P PP + Sbjct: 441 PPTPPIADIAISMPPPPPPPPPPPAVMP----LKHFAPPPPPPLPPAVMPLKHFAPPPPT 496 Query: 814 XXXXXXXXXXXPHPXPTAPXP---RXPXXPPPP---XXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPP 553 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/104 (25%), Positives = 29/104 (27%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPPP P P P PPT P P K A Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPP-PPTPPAFK--PLKGSAPPPP 511 Query: 813 XXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P + PPPPP + P P PPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 37.1 bits (82), Expect = 0.018 Identities = 29/111 (26%), Positives = 29/111 (26%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P P PP PP S P PP Sbjct: 422 PPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P A P PPP PP PP P PP P Sbjct: 482 PAVMPLKHFAPPPPTPPAFKPLKGSAPPP----PPPPPLPTTIAAPPPPPP 528 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P +P P P P P P P PPPPP Sbjct: 498 PAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPG 557 Query: 912 XSXTPXPXPPP 944 P P PPP Sbjct: 558 TQAAPPPPPPP 568 Score = 33.5 bits (73), Expect = 0.22 Identities = 31/121 (25%), Positives = 32/121 (26%), Gaps = 10/121 (8%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPX---------PPXCXPXXSGXRXXGPTXHPPXRXXRLXH 786 PP P PP P PP PP P + P PP L Sbjct: 462 PPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPP---LPT 518 Query: 787 XXXRXXXXXXXXXXXXXXXXPHPXP-TAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXX 963 P P P TA P P PP PP PP P P Sbjct: 519 TIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Query: 964 P 966 P Sbjct: 579 P 579 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/107 (24%), Positives = 27/107 (25%), Gaps = 3/107 (2%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXP-PTR--PXXPVXPXKXXAX 803 PPPP P P P P P PT P P A Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAV 534 Query: 804 XXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P PPPPP + P P P P Sbjct: 535 APPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/104 (22%), Positives = 24/104 (23%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPPP P P P P P P A Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP-PPPPGTAAAPP 550 Query: 813 XXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P PPP P S + P PPP Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXX--PPKPPXPXXXRGX--PPXXP 966 P P P P PPPP P PP P G PP P Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 Score = 28.3 bits (60), Expect = 8.1 Identities = 25/106 (23%), Positives = 26/106 (24%), Gaps = 2/106 (1%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPPP P P P P P P P A Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPP---PPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Query: 813 XXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXS--XTPXPXPPP 944 P P PPPPP + TP P PPP Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/73 (23%), Positives = 18/73 (24%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP P P P P P P PPP + Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNS 585 Query: 924 PXPXPPPWXPXXP 962 PPP P P Sbjct: 586 GSGGPPPPPPPMP 598 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 42.3 bits (95), Expect = 5e-04 Identities = 37/111 (33%), Positives = 39/111 (35%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G H GG G G GGGG + G G G G A + Sbjct: 113 GGAAGGHAGGGGGG----SGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGA--YG 166 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G GG G G G G GG AG GG G GGGG Sbjct: 167 GGGGHGG--GGGGGSAGGAHGGSGYGG-GEGGGAGGGGSHGGAGGYGGGGG 214 Score = 40.3 bits (90), Expect = 0.002 Identities = 35/113 (30%), Positives = 35/113 (30%), Gaps = 3/113 (2%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGG---GGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXX 791 G G HGGG G G GG GGG G G G G G Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Query: 790 FXGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G GG G G G G GG G GG G GGG Sbjct: 226 GGAHGGGYGSGGGEGGGYGGG--AAGGYGGGGGGGEGGGGSYGGEHGGGSGGG 276 Score = 36.7 bits (81), Expect = 0.023 Identities = 31/113 (27%), Positives = 31/113 (27%), Gaps = 2/113 (1%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXA--XX 791 G G GG G GGGGG G G G G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG 205 Query: 790 FXGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G G G G G G G G GG G GGGG Sbjct: 206 AGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 Score = 35.1 bits (77), Expect = 0.071 Identities = 34/115 (29%), Positives = 34/115 (29%), Gaps = 4/115 (3%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G G G G G E GGG G G G G A Sbjct: 62 GGGSG-EGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHA 120 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXG-XXGVXXGGXAGR---GGXKXXXXGPRGGGG 632 G G GG G G G GG AG GG G GGGG Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175 Score = 31.5 bits (68), Expect = 0.87 Identities = 30/109 (27%), Positives = 32/109 (29%), Gaps = 3/109 (2%) Frame = -1 Query: 952 GXHGGGXGXG-VXEXXXGG--GGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G HGGG G G V GG GGG+ G G G G G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEG-AGGGYGGAEGYASGGGSGHGGGGGGAA 95 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 +G G G G G GG G GG G G Sbjct: 96 SSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASG 144 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGF 887 G G HGGG G G GGGG+ Sbjct: 263 GSYGGEHGGGSGGGHGGGGGHGGGGY 288 Score = 28.3 bits (60), Expect = 8.1 Identities = 30/98 (30%), Positives = 31/98 (31%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G G GGGGG G G G A Sbjct: 194 GGGAGG-GGSHG-GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGY 251 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G G G GG G G + G G GG G GG Sbjct: 252 GGGGGGGEGGG--GSYGG--EHGGGSGGGHGGGGGHGG 285 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 41.9 bits (94), Expect = 6e-04 Identities = 27/108 (25%), Positives = 30/108 (27%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP +P PP P+ P PP P P H P Sbjct: 650 PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P + P P PPPP P PP P PP Sbjct: 710 VHSPPPPVHSPPPPVHSPPPP--VQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/111 (25%), Positives = 31/111 (27%), Gaps = 3/111 (2%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXX 822 P +P PP P+ P PP P P PP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHS 698 Query: 823 XXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKP---PXPXXXRGXPPXXP 966 P P + P P PPPP PP P P P PP P Sbjct: 699 PPPPVHSPPPPVHSPPPP--VHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 35.5 bits (78), Expect = 0.053 Identities = 24/98 (24%), Positives = 26/98 (26%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 P P PP P+ P PP P P PP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P + P P PPPP PP PP Sbjct: 703 VHSPPPPVHSPPPPVHSPPPP--VHSPPPPVQSPPPPP 738 Score = 34.7 bits (76), Expect = 0.093 Identities = 27/114 (23%), Positives = 30/114 (26%), Gaps = 3/114 (2%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXS---GXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP +P PP P+ P PP P P PP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSP 766 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P P PPP P PP P P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPP--PVHSPPPPVHSPPPPSPIYSPPPPVFSP 818 Score = 33.5 bits (73), Expect = 0.22 Identities = 24/101 (23%), Positives = 26/101 (25%), Gaps = 3/101 (2%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPX---CXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP P PP P+ P PP P P PP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSP 781 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P + P P PPPP PP P Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP P PPP PP Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPP 775 Score = 32.3 bits (70), Expect = 0.50 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 5/83 (6%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVX--PXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPP 905 P P P P PV P + P P P P PPPP Sbjct: 695 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Query: 906 XXXSXTP---XPXPPPWXPXXPP 965 S P P PPP PP Sbjct: 755 PVHSPPPPVHSPPPPPVHSPPPP 777 Score = 31.5 bits (68), Expect = 0.87 Identities = 20/84 (23%), Positives = 23/84 (27%) Frame = +3 Query: 714 PXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXP 893 P F P P P P P + P P P P + P Sbjct: 737 PPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 796 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 PP +P PPP PP Sbjct: 797 PPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPPPP P PPP PP Sbjct: 670 PPPPVYSPPPPVH-SPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P PPP PP Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P PP P PP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P + PPPPP P PPP PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPP 672 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 41.9 bits (94), Expect = 6e-04 Identities = 35/118 (29%), Positives = 39/118 (33%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G G GG GG S G G Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPK 74 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGGVX*XGKT 611 G +G G+ GG G G G GG +G GG G GGGG GK+ Sbjct: 75 GGSGGGGKGGGGGGGISGG--GAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKS 130 Score = 41.9 bits (94), Expect = 6e-04 Identities = 32/111 (28%), Positives = 34/111 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G G GGGGG+ + G G Sbjct: 27 GGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKGGSGGGGKGGGG 86 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G GG G G G G GG G GG K G GGG Sbjct: 87 GGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 38.7 bits (86), Expect = 0.006 Identities = 30/110 (27%), Positives = 34/110 (30%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G GGG G G GGGG G G G G Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNF 69 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 + G GG G + G G+ GG G+ G G GGGG Sbjct: 70 ESDPKGGSGG------GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/104 (26%), Positives = 30/104 (28%), Gaps = 4/104 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXX----RLXHXXXRX 801 PP P P P PP PP SG GP PP + Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKP 698 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P + P PPPP P PP P Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/120 (25%), Positives = 33/120 (27%), Gaps = 2/120 (1%) Frame = +1 Query: 613 FSLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLX--H 786 FS PP P P P PP PP P + P+ PP Sbjct: 499 FSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNR 558 Query: 787 XXXRXXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P PPPP PP PP P P P Sbjct: 559 DPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAP 618 Score = 36.7 bits (81), Expect = 0.023 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +3 Query: 846 PXPXXXXPXPX----LXXXPPPPPXXXSXTPXPXPPPW--XPXXPP 965 P P P P L PPPPP S TP P PPP P PP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP S P P PP P PP Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRS-IPSPSAPPPPPPPPP 626 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P L P PPP S TP P PPP Sbjct: 718 PPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/104 (25%), Positives = 31/104 (29%), Gaps = 4/104 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP--XXSGXRXXG--PTXHPPXRXXRLXHXXXRX 801 PP P P P P PP PP P +G + P PP R+ Sbjct: 599 PPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAP 658 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P+ P P P P PKPP P Sbjct: 659 PPPPPPPTSHSGSIRVGP-PSTPPPPPPPPPKANISNAPKPPAP 701 Score = 29.9 bits (64), Expect = 2.7 Identities = 30/115 (26%), Positives = 31/115 (26%), Gaps = 4/115 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLX---PPXPPXCXPXXSGXR-XXGPTXHPPXRXXRLXHXXXRX 801 PP P P P PL PP PP P R P+ PP Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP------PPPPPPS 627 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP R PP P Sbjct: 628 FGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPP--PPPPTSHSGSIRVGPPSTP 680 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 891 PPPPPXXXSXTP-XPXPPPWXPXXPP 965 PPPPP S T P PP P PP Sbjct: 487 PPPPPLFTSTTSFSPSQPPPPPPPPP 512 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/109 (24%), Positives = 29/109 (26%) Frame = +3 Query: 618 PX*XTPPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXX 797 P +PPPP P P P PP P P P Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVY 480 Query: 798 AXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 + P P P P PPPPP S P P P P Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 41.5 bits (93), Expect = 8e-04 Identities = 29/111 (26%), Positives = 31/111 (27%) Frame = +3 Query: 633 PPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXX 812 PPPP P F P P P PP P P+ P Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPP--PPHSPPPPIYPY-----LSP 591 Query: 813 XXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP +P P PP PP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPP 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 1/82 (1%) Frame = +3 Query: 723 FRXPXXRPXXPPTRPXXPVX-PXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPP 899 F P PP P PV P P P P P PPP Sbjct: 417 FSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Query: 900 PPXXXSXTPXPXPPPWXPXXPP 965 PP P P PPP PP Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPP 498 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/97 (26%), Positives = 28/97 (28%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P +P PP P PP P P P PP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP------PPPPPPPV 479 Query: 817 XXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P +P P P PPPP PP PP Sbjct: 480 YSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/115 (26%), Positives = 33/115 (28%), Gaps = 4/115 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLX--PPXPPXCXPXXSGX-RXXGPTXH-PPXRXXRLXHXXXRX 801 PP P P PP P+ PP PP P R P H PP Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYY 559 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P + P P P PPP P P P PP P Sbjct: 560 YSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 37.9 bits (84), Expect = 0.010 Identities = 29/110 (26%), Positives = 30/110 (27%) Frame = +3 Query: 636 PPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXXX 815 PPP P F P + P P PP P P Sbjct: 410 PPPPAPI---FSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP--PPPPPPPPPVY 464 Query: 816 XXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP S P P PPP P P Sbjct: 465 SPPPPPPPPPPPPPVYSPPPP--SPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 37.9 bits (84), Expect = 0.010 Identities = 27/112 (24%), Positives = 28/112 (25%) Frame = +3 Query: 618 PX*XTPPPPRGPXXXXFXXXXXXXXXXXXXXXPXXFRXPXXRPXXPPTRPXXPVXPXKXX 797 P +PPPP P P P P PP P P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Query: 798 AXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P P PPPPP P PPP P Sbjct: 506 PPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 37.5 bits (83), Expect = 0.013 Identities = 30/118 (25%), Positives = 31/118 (26%), Gaps = 4/118 (3%) Frame = +1 Query: 616 SLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXC--XPXXSGXRXXGPTXHPPXRXXRLXHX 789 SL PP P P P PP P P P PP + Sbjct: 406 SLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYS 465 Query: 790 XXRXXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPP--KPPXPXXXRGXPP 957 P P P P P PPPP PP PP P PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPP PP PP PP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 37.1 bits (82), Expect = 0.018 Identities = 29/112 (25%), Positives = 30/112 (26%), Gaps = 2/112 (1%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P PP P PP P P P PP H Sbjct: 527 PAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSP---PPPHSSPPPHSPPPPHSPPP 583 Query: 817 XXXXXXXXXXPHPXPTAPXPRXPXX--PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P + P P PPPP P PP P PP P Sbjct: 584 PIYPYLSPPPP-PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 36.7 bits (81), Expect = 0.023 Identities = 28/110 (25%), Positives = 29/110 (26%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P P PP PP P P S P PP Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPP--PPVYSPPPPPPPPPPPPVYS 465 Query: 817 XXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P + P P P PPP PP PP P P P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 33.1 bits (72), Expect = 0.29 Identities = 24/88 (27%), Positives = 25/88 (28%), Gaps = 4/88 (4%) Frame = +3 Query: 714 PXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXP 893 P + P P PP P P P P P P P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP--P 503 Query: 894 PPPPXXXSXTPXP----XPPPWXPXXPP 965 PPPP S P P PPP P P Sbjct: 504 PPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPPP S P P P + PP Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 31.5 bits (68), Expect = 0.87 Identities = 30/120 (25%), Positives = 31/120 (25%), Gaps = 9/120 (7%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXP-----LXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXR 798 PP P +P PP P PP P P S P PP L Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP---PPPIYPYLSPPPPP 595 Query: 799 XXXXXXXXXXXXXXXXP----HPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP P PP P Sbjct: 596 TPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP P PP P Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PP P P PP + P PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP 442 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P P PP P PP P PP P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP 442 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP TP P P PP Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXX---PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PP PP P P PP P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPP +P P PP PP Sbjct: 642 PPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 847 PHPXPTAPXPRXP------XXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+AP P PPP PP P + PP P Sbjct: 692 PPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPPVIHQSPPPPSP 737 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 40.7 bits (91), Expect = 0.001 Identities = 32/113 (28%), Positives = 35/113 (30%), Gaps = 5/113 (4%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXP-PXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP P P PP P P P PP P + PT P + Sbjct: 74 PPAPVPP--VSPPPPTPSVPSPTPPVSPPPPT------PTPSVPSPTPPVSPPPPTPTPS 125 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXP----PKPPXPXXXRGXPP 957 P P P+ P P P PPPP P P PP P PP Sbjct: 126 VPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP 178 Score = 37.1 bits (82), Expect = 0.018 Identities = 30/114 (26%), Positives = 31/114 (27%) Frame = +1 Query: 616 SLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXX 795 S+ PP P P P P PP P S P PP Sbjct: 89 SVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP-----TPS 143 Query: 796 RXXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P PT P P P PPP PP PP P PP Sbjct: 144 VPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP-PPTPTPSVPSPP 196 Score = 36.7 bits (81), Expect = 0.023 Identities = 30/116 (25%), Positives = 31/116 (26%), Gaps = 6/116 (5%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXH----PPXRXXRLXHXXXRXX 804 P P P P P+ PP PP P PT PP Sbjct: 135 PPPPTPTPSVPSPTPPVSPP-PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPP--XXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PP PP PP G PP P Sbjct: 194 SPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVP 249 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PPPP P P P PP P Sbjct: 84 PPPTPSVPSPTPPVSPPPP-TPTPSVPSPTPPVSPPPPTP 122 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PPPP P P P PP P Sbjct: 102 PTPTPSVPSPTPPVSPPPP-TPTPSVPSPTPPVSPPPPTP 140 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PPPP P P P PP P Sbjct: 120 PTPTPSVPSPTPPVSPPPP-TPTPSVPSPTPPVSPPPPTP 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PP PP P P PP P Sbjct: 79 PPVSPPPPTPSVPS-PTPPVSPPPPTPTPSVPSPTPPVSP 117 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP---PXXXSXTPXPXPPPWXP 953 P P P P PPPP P S TP PPP P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP---PXXXSXTPXPXPPPWXP 953 P P P P PPPP P S TP PPP P Sbjct: 102 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/78 (26%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = +3 Query: 732 PXXRPXXP-PTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPX 908 P P P PT P P P + P P P P + P P P Sbjct: 120 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT-PTPSVPSPTPPVPTDPMPSPP 178 Query: 909 XXSXTPXPXPPPWXPXXP 962 P P P P P P Sbjct: 179 PPVSPPPPTPTPSVPSPP 196 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 862 TAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 T P P P PPPP P P P PP P Sbjct: 73 TPPAPVPPVSPPPPTPSVPSPTPPV---SPPPPTP 104 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXP----XXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P P P PP PP P P PP P Sbjct: 93 PTP-PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXP----XXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P P P PP PP P P PP P Sbjct: 111 PTP-PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/97 (31%), Positives = 32/97 (32%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G HGGG G G GGG G G G G G G + G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG---------GHYGGGGGHYGG 98 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G G GG G G G G GG G GG Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G HGGG G GGGGG G G Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G +GGG G GGGGG G G G Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/98 (24%), Positives = 26/98 (26%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP +P PP P+ P PP P P H P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P PPPP PP PP Sbjct: 620 PPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/99 (26%), Positives = 29/99 (29%), Gaps = 1/99 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLX-PPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP +P PP P+ PP PP P P PP Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPP 626 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P +P P PPPP PP PP Sbjct: 627 PPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/112 (25%), Positives = 30/112 (26%), Gaps = 4/112 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP +P PP P+ P PP P P PP Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPP-XXXPP---KPPXPXXXRGXPP 957 P P P P PPPP PP PP P PP Sbjct: 606 VHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPPPP +P P PP + P PP Sbjct: 504 PSPIHSPPPPPVYSPPPPPPVY---SPPPPPPVYSPPPPP 540 Score = 36.7 bits (81), Expect = 0.023 Identities = 28/112 (25%), Positives = 31/112 (27%), Gaps = 4/112 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXH-PPXRXXRLXHXXXRXXXX 810 PP +P PP P+ P PP P P H PP Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPP---KPPXPXXXRGXPP 957 P P +P P PPP PP PP P PP Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 35.1 bits (77), Expect = 0.071 Identities = 29/112 (25%), Positives = 30/112 (26%), Gaps = 1/112 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP P+ P PP P P PP H Sbjct: 527 PPPP--PPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV----HSPPPPVHSP 580 Query: 814 XXXXXXXXXXXPH-PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 H P P P P PPP P PP P P P Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP 632 Score = 35.1 bits (77), Expect = 0.071 Identities = 22/80 (27%), Positives = 24/80 (30%), Gaps = 2/80 (2%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVX--PXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPP 905 P P P P PV P + P P P P + PPPPP Sbjct: 562 PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Query: 906 XXXSXTPXPXPPPWXPXXPP 965 P PPP PP Sbjct: 622 VHSPPPPVFSPPPPVHSPPP 641 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/112 (25%), Positives = 29/112 (25%), Gaps = 4/112 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP PP PP P P PP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 577 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPP----KPPXPXXXRGXPP 957 P P + P P PPPP PP PP P PP Sbjct: 578 HSPPPPVYSPPPPPVHSPPPP--VHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 34.3 bits (75), Expect = 0.12 Identities = 26/109 (23%), Positives = 28/109 (25%), Gaps = 1/109 (0%) Frame = +1 Query: 634 PPXPXAPRXXXX-GPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP P P PP PP P S P P + Sbjct: 433 PPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRS 492 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P + P P PPPP P PP P PP Sbjct: 493 PPPPPVHSPPP-PSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P PPPPP S P P PP P P Sbjct: 512 PPPVYSPPPPPPVYSPPPPPPVYS--PPPPPPVHSPPPP 548 Score = 32.3 bits (70), Expect = 0.50 Identities = 19/78 (24%), Positives = 21/78 (26%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P PP P P P P P P + PPP Sbjct: 514 PVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 573 Query: 912 XSXTPXPXPPPWXPXXPP 965 P PP + P PP Sbjct: 574 PPPVHSPPPPVYSPPPPP 591 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP +P P PP + P PP Sbjct: 495 PPPVHSPPPPSPIHSPPPPP--V-YSPPPPPPVYSPPPPP 531 Score = 30.7 bits (66), Expect = 1.5 Identities = 31/118 (26%), Positives = 32/118 (27%), Gaps = 10/118 (8%) Frame = +1 Query: 634 PPXPX---APRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP P P PP P+ P PP P P PP H Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV----HSPPPPV 584 Query: 805 XXXXXXXXXXXXXXPH-PXPTAPXPRXPX---XPPPPXXXPPKP---PXPXXXRGXPP 957 H P P P P PPPP PP P P P PP Sbjct: 585 YSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P +P P P PPP PP P PP Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P PP + P PP Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP P PPP PP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPP 648 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/100 (24%), Positives = 27/100 (27%), Gaps = 6/100 (6%) Frame = +1 Query: 676 PXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXXXXXXXXXXPHP 855 P P+ P PP P + P H P P Sbjct: 463 PSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Query: 856 XPTAPXPRXP---XXPPPPXXXPPKP---PXPXXXRGXPP 957 +P P P PPPP PP P P P PP Sbjct: 523 PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPP----PPPXXXSXTPXP--XPPPWXPXXPP 965 P P P P + PP PPP S P P PPP PP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/102 (26%), Positives = 30/102 (29%), Gaps = 4/102 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPX--CXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXX 807 PP P + P P P PP C P + PP + Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPP 107 Query: 808 XXXXXXXXXXXXXPHPXPT--APXPRXPXXPPPPXXXPPKPP 927 P P PT P P P PPPP PP PP Sbjct: 108 PPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/111 (27%), Positives = 32/111 (28%), Gaps = 3/111 (2%) Frame = +1 Query: 643 PXAPRXXXXGPPX-PLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXX 819 P P PP P PP PP P + PT PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKP--PTVKPPPPYIPCPPPPYTPKPPTVK 88 Query: 820 XXXXXXXXXPHPXPTAPXPRXP--XXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P PPPP PP PP P P P Sbjct: 89 PPPPPYVKPP-PPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/78 (25%), Positives = 24/78 (30%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P +P PP P K P P P P + PPP P Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTP 160 Query: 912 XSXTPXPXPPPWXPXXPP 965 + P P P P+ P P Sbjct: 161 EAPCPPPPPTPYPPPPKP 178 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +3 Query: 753 PPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXP 932 PP PV P K A P P P P PPPP T P Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHT-PKPPTVKPPPPYIPCPPPPYTPKPPTVKP 89 Query: 933 XPPPWXPXXPP 965 PPP+ PP Sbjct: 90 PPPPYVKPPPP 100 Score = 36.7 bits (81), Expect = 0.023 Identities = 31/113 (27%), Positives = 33/113 (29%), Gaps = 2/113 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXP--LXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXX 807 PP P P P P + PP PP P PT PP + Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPP------PTVKPPPPP----YVKPPPPP 117 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P PP P Sbjct: 118 TVKPPPPPTPYTPPPPTPYTPPP-PTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 33.9 bits (74), Expect = 0.16 Identities = 30/115 (26%), Positives = 32/115 (27%), Gaps = 4/115 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXP--LXPPXPPXCXPXXSGX--RXXGPTXHPPXRXXRLXHXXXRX 801 PP P P+ PP P + PP PP P PT PP Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYT------ 129 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P P PP PP P P P Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPP--PPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/111 (23%), Positives = 28/111 (25%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 P P AP P P PP P P+ PP + Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSP 88 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P T P P PPPP P PP P P P Sbjct: 89 PPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSP 139 Score = 32.3 bits (70), Expect = 0.50 Identities = 26/115 (22%), Positives = 29/115 (25%), Gaps = 5/115 (4%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGP----TXHPPXRXXRLXHXXXRXX 804 P P P PP + PP PP P P + PP Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Query: 805 XXXXXXXXXXXXXXPHPXP-TAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P T+ P P PP P P R P P Sbjct: 157 KPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKP 211 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP--PXXXPPKPPXPXXXRGXPP 957 P P P P PPP P PP+ P P PP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPP 58 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP + P P PP Sbjct: 156 PKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPP 195 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPP---KPPXPXXXRGXPP 957 P P P P P P PPPP PP PP P + PP Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPPP PP PP P PP P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSP-PPSPPPPQLP--PPPQLP 101 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P PPPP PP PP P PP Sbjct: 56 PEPADCPPPPPPPPCPPPP-SPPPCPPPPSPPPSPPP 91 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPK-PPXPXXXRGXPP 957 P P P +P P P PPP PP+ PP P PP Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 35.1 bits (77), Expect = 0.071 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP P P PP P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP PP PP P Sbjct: 52 PEPEPE-PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P PPP PP PP P PP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP-PXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP P P P P P P PP Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP S P PPP P PP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP--PQLPP 102 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPPP +P P PPP P PP Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPP--PSPPP 87 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PP PP P PP P PP Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P PPPP P P P P P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP P P PPP P P Sbjct: 47 PPSPSPEPEPEPADCPPPPP-PPPCPPPPSPPPCPPPPSP 85 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PP PP P PPP P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXP--PPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P PPP PP P P P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP----PKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PKPP P +G P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRX--PXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P AP P P PPPP P+PP P P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P+ P PP PP PP P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPP-PGSGGPKPPPPP 406 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP-PXXXSXTPXPXPPPWXPXXP 962 P P P PPPP P S P P PPP P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP-GPKGP 411 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P + P+ P P P PP P PP P Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP----PKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PKPP P +G P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRX--PXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P AP P P PPPP P+PP P P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P+ P PP PP PP P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPP-PGSGGPKPPPPP 406 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPP-PXXXSXTPXPXPPPWXPXXP 962 P P P PPPP P S P P PPP P P Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP-GPKGP 411 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P + P+ P P P PP P PP P Sbjct: 391 PAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 37.9 bits (84), Expect = 0.010 Identities = 27/113 (23%), Positives = 30/113 (26%), Gaps = 2/113 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXH--PPXRXXRLXHXXXRXXX 807 PP P PP P+ P P P PT H PP + Sbjct: 725 PPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 + P P PPPP P PP P PP P Sbjct: 785 VYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 837 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP +P P PP + PP Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPP 792 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/123 (23%), Positives = 32/123 (26%), Gaps = 4/123 (3%) Frame = +1 Query: 601 GXGRFSLXXXLPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRL 780 G GR + + P P PP P P PP P G + P Sbjct: 399 GCGRSTRPPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSP 458 Query: 781 XHXXXRXXXXXXXXXXXXXXXXPHPXPTAPXP--RXPXXP--PPPXXXPPKPPXPXXXRG 948 P PT P P P P P P PP P G Sbjct: 459 PSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGG 518 Query: 949 XPP 957 PP Sbjct: 519 SPP 521 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P++P P P PP PP P P + PP P Sbjct: 547 PSPSSPTPSSPIPSPPTPSTPPTPISP--GQNSPPIIP 582 Score = 29.5 bits (63), Expect = 3.5 Identities = 25/111 (22%), Positives = 25/111 (22%), Gaps = 4/111 (3%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P PP P P PP P T P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPS 496 Query: 817 XXXXXXXXXXPHPXPTAPXPRX----PXXPPPPXXXPPKPPXPXXXRGXPP 957 P PT P P P P P P PP G PP Sbjct: 497 SPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPP 547 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPP +P P PPP PP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPP 726 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP---PXXXPPKPPXPXXXRGXPPXXP 966 P P T P P P P P PP P G PP P Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSP 498 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP PPPP PP P PP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPP 739 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P+ P P PP P PP G PP P Sbjct: 433 PITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSP 472 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P A P P PPPP PP PP PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP P+PP P PP P Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P R PPP PP+PP P + PP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPP-PPXXXSXTPXPXPPPWXPXXPP 965 P P P PPP PP P P PPP PP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXR-----GXPPXXP 966 P P +P P P PPPP PP PP P G PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXPXXXRGXPP 957 P PPP PPKPP R PP Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPP 117 Score = 29.5 bits (63), Expect = 3.5 Identities = 26/105 (24%), Positives = 29/105 (27%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P PP P PP PP P + G PP + Sbjct: 43 PPPPPPP------PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMI--------KPL 88 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P P PPP P KP +G Sbjct: 89 SSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKPKRDGLNKG 133 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P P PPPPP PPP P Sbjct: 45 PPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P PP P P P P P L PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 Query: 912 XSXTPXPXPP 941 S P P PP Sbjct: 99 RS-QPPPKPP 107 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXS---XTPXPXPPP 944 P P P P PPPPP + T P PPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P PPP P PP Sbjct: 76 PPPPPVTDMIKPLSSPPP--PQPPP 98 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 37.1 bits (82), Expect = 0.018 Identities = 32/115 (27%), Positives = 35/115 (30%), Gaps = 4/115 (3%) Frame = -3 Query: 965 GXXGGXPRXXXGXGGXGGXXXGG-GGXXGXRGXGAVGXGXGXXXXXXXXXXXXXXXXRXF 789 G GG + G GG GG GG G G G G G G Sbjct: 245 GGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGG 304 Query: 788 XWXNRXXRXGG---WXVGPXXRXPEXXGXXXGGXGGXSGXGGPKXXXRGAXGXGG 633 + GG + GP G GG GG SG G G G GG Sbjct: 305 GYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGG 359 Score = 36.7 bits (81), Expect = 0.023 Identities = 29/106 (27%), Positives = 31/106 (29%), Gaps = 2/106 (1%) Frame = -1 Query: 943 GGGXGXGVXEXXXGGGGGFXXSXGX--GXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGX 770 GGG G GGGGG+ G G G + G G Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 769 XGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G GG R G G G GG GG GGGG Sbjct: 361 MGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGG 406 Score = 35.9 bits (79), Expect = 0.040 Identities = 33/114 (28%), Positives = 34/114 (29%), Gaps = 5/114 (4%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G HGGG G GGG G S G G G G Sbjct: 235 GYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALG 294 Query: 781 XTGXXGRVGGXXGR----XXGXRKXXGXXGVXXGGXAGR-GGXKXXXXGPRGGG 635 +G G GG R G G G GG G GG G GGG Sbjct: 295 YSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGG 348 Score = 31.9 bits (69), Expect = 0.66 Identities = 30/114 (26%), Positives = 31/114 (27%), Gaps = 3/114 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G E GGGG+ G G Sbjct: 255 GGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMG 314 Query: 784 GXTGXXGRVGGXXGRXXG--XRKXXGXXGVXXGGXAGRG-GXKXXXXGPRGGGG 632 G G G G G G G G GG G G G GGGG Sbjct: 315 GGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGG 368 Score = 30.7 bits (66), Expect = 1.5 Identities = 30/101 (29%), Positives = 32/101 (31%), Gaps = 4/101 (3%) Frame = -1 Query: 961 GXXGXHGGGXGX---GVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXX 791 G G +GGG G G GG GG S G G G G Sbjct: 314 GGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAG-----GGG 368 Query: 790 FXGXTGXX-GRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 + G G G VGG G G GG GRGG Sbjct: 369 YRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXX--XPPKPPXPXXXRGXPP 957 P P PT+P P P P PP PP PP P G P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTP 103 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P PPPP PP PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P PP PP PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPP-PPSPPPPSPPPP 95 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P PP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP 88 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P PPPP P P PPP P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPPP P PP P PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP 88 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P P P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPP 89 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 36.7 bits (81), Expect = 0.023 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P++P PR P PP P PP+PP P PP P Sbjct: 45 PPPSPSSP-PRLP--PPFPALFPPEPPLPPRFELPPPLFP 81 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PP PP PP P Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 33.1 bits (72), Expect = 0.29 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPP---P 902 P P PP P P P P P P L PPP P Sbjct: 38 PLSPPPSPPPSPSSP--PRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPP 95 Query: 903 PXXXSXTPXPXPPPWXPXXPP 965 P P P PPP P PP Sbjct: 96 PEEPPREPPPPPPP--PEEPP 114 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P PPP PP+ P P Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPP P +PP PP P Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Score = 31.5 bits (68), Expect(2) = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P P P PR P PPPP PP P Sbjct: 94 PPPEEP-PREPPPPPPPPEEPPPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P L PPP P +P PPP+ PP Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPPFPALFPP 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPXC 711 LPP PR PP P PP P C Sbjct: 93 LPPPEEPPREPPPPPPPPEEPPPPASC 119 Score = 21.8 bits (44), Expect(2) = 0.12 Identities = 13/45 (28%), Positives = 13/45 (28%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXR 777 P P PP P PP P R P PP R Sbjct: 57 PPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPR 101 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP PP P PP P Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPP 731 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PP P + +P P PPP P PP Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 31.5 bits (68), Expect = 0.87 Identities = 25/102 (24%), Positives = 27/102 (26%), Gaps = 2/102 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPP-XCXPXXSGXRXXGPTXHPPXRXXRL-XHXXXRXXX 807 PP P P PP P PP PP P +G + P RL H Sbjct: 714 PPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPP 773 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P PP P P Sbjct: 774 TAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALP 815 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +1 Query: 847 PHPXPTAPXPRXPXX---PPPPXXXPPKPPXP 933 P P P P P P PPP PP PP P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 853 PXPTAPXPRXPXX---PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P AP PR P PPPP PP P PP P Sbjct: 755 PAPPAP-PRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 891 PPPPPX---XXSXTPXPXPPPWXPXXPP 965 PPPPP + T P PPP P PP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXP-----XPPPWXPXXPP 965 P P + PPPPP P P PPP P PP Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 36.3 bits (80), Expect = 0.031 Identities = 29/117 (24%), Positives = 33/117 (28%), Gaps = 9/117 (7%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXP-PXPPXCXPXXSGXRXXGPTXHPPXRXXR-----LXHXXX 795 PP P P P + P P PP P P PP + + Sbjct: 62 PPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPT 121 Query: 796 RXXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXP---PPPXXXPPKPPXPXXXRGXPP 957 + P P T P P P P PPP PP P P PP Sbjct: 122 KPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/114 (22%), Positives = 32/114 (28%), Gaps = 3/114 (2%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P+ PP P P P P PT P + + + Sbjct: 49 PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKP 108 Query: 814 XXXXXXXXXXXP-HPXPTAPXP--RXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P + P P P P P P PP P Sbjct: 109 HPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP-PPXXXPPKPPXPXXXRGXPP 957 P P P P P+ P PP PP PPKPP PP Sbjct: 32 PSPAPHKP-PKHPVKPPKPPAVKPPKPPAVKPPTPKPP 68 Score = 34.7 bits (76), Expect = 0.093 Identities = 26/100 (26%), Positives = 29/100 (29%), Gaps = 1/100 (1%) Frame = +1 Query: 637 PXPXAPRXXXXGPPX-PLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 P P P+ PP P PP P P + P PP + Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVI 205 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P PT P P P PP PP P P Sbjct: 206 TPPTPTPPVITP-PTPTPPVV-TPPTPTPPVVTPPTPTPP 243 Score = 33.1 bits (72), Expect = 0.29 Identities = 29/109 (26%), Positives = 30/109 (27%), Gaps = 1/109 (0%) Frame = +1 Query: 643 PXAPRXXXXGPPX-PLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXX 819 P P PP P+ PP PP P PT PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKP-PKPPAVKPPTPKPPT-------VKPHPKPPTVK 80 Query: 820 XXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PHP P P P P P PKPP PP P Sbjct: 81 PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPH-PKPPIVKPPTKPPPSTP 128 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/87 (24%), Positives = 24/87 (27%), Gaps = 4/87 (4%) Frame = +3 Query: 714 PXXFRXPXXRPXXPP-TRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXX 890 P + P +P P P P+ P P P P Sbjct: 94 PPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Query: 891 P---PPPPXXXSXTPXPXPPPWXPXXP 962 P PPP TP P PP P P Sbjct: 154 PHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 29.9 bits (64), Expect = 2.7 Identities = 26/104 (25%), Positives = 27/104 (25%), Gaps = 5/104 (4%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXP---PXPPXCXPXXSGX-RXXGPTXHPPXRXXRLXHXXXRXX 804 P P P P P P P PP P P PP + Sbjct: 90 PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPS 149 Query: 805 XXXXXXXXXXXXXXPHPXPT-APXPRXPXXPPPPXXXPPKPPXP 933 P P PT P P P PP PP P P Sbjct: 150 TPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/102 (26%), Positives = 29/102 (28%), Gaps = 2/102 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 P P+ PP P PP P P + PT PP Sbjct: 86 PTVKPHPKPPTVKPPHP-KPPTKPHPHPKPPIVKP--PTKPPPSTPKPPTKPPPSTPKPP 142 Query: 814 XXXXXXXXXXXPH--PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 PH P PT P P P PP PP P P Sbjct: 143 TTKPPPSTPKPPHHKPPPT-PCPPPTPTPTPPVVTPPTPTPP 183 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +3 Query: 852 PXXXXPXPXLXXXPP--PPPXXXSXTPXPXPPPWXPXXPP 965 P P P PP P P P P PPP PP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P+ P PPPP PP P P PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXP---PPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P P PPPP TP P PP P PP Sbjct: 72 PPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPPP S P P P P PP Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQS-LPPPSPSPEPEHYPP 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P+ P P PPP PP PP P + PP P Sbjct: 50 PAPS-PEPEDYLPLPPPPQTPPPPPPP---QSLPPPSP 83 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXX--PPKPPXPXXXRGXPPXXP 966 P +P P PPPP P PP P R PP P Sbjct: 80 PPSPSPEPEHYPPPPYHHYITPSPPPP---RPLPPPPP 114 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 35.9 bits (79), Expect = 0.040 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 PH P +P P+ P PPPP P P P Sbjct: 1129 PHESPPSPPPQPPSSPPPPSSPPQLAPAP 1157 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P PP P PP P P PP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPP S P PP P PP Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P L PPPPP P P PPP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P L PPPP + P P PPP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP P PP P + PP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQP-PPPPSVSKAPPPPPP 339 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 676 PXPLXPPXPPXCXPXXSGXRXXGPTXHP 759 P PL PP PP P SG P +P Sbjct: 27 PLPLPPPPPPPLKPPSSGSATTKPPINP 54 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P PT+P P PP P PP P P PP Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P PP P PP P P PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 34.7 bits (76), Expect = 0.093 Identities = 24/100 (24%), Positives = 26/100 (26%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P PP P P P PP + Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 H P AP P P P PP P+ P Sbjct: 173 TKHKRKHKHKRHHHAP-APAPIPPSPPSPPVLTDPQDTAP 211 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/80 (27%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPP--PPP 905 P P PP PV P P P P P PPP Sbjct: 75 PAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Query: 906 XXXSXTPXPXPPPWXPXXPP 965 S P P PP P PP Sbjct: 135 APASPPPAPASPPPAPVSPP 154 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P PPP PP P P PP P Sbjct: 98 PQP-PQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P +P P PP P PP P P + P Sbjct: 125 PPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P P PPP PP P P P Sbjct: 132 PPPAPASPPPA-PASPPPAPVSPPPVQAPSPISLPPAPAP 170 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 35.9 bits (79), Expect = 0.040 Identities = 31/113 (27%), Positives = 33/113 (29%), Gaps = 2/113 (1%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLX-PPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 P P P PP P P PP P P PP + Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQ-----PKPVPPP 66 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPP-PXXXPPKPPXPXXXRGXPPXXP 966 P P P P P P P P P PPKPP P + PP P Sbjct: 67 ACPPTPPKPQPKPAPPPE-PKPAPPPAPKPVPCPSPPKPPAP-TPKPVPPHGP 117 Score = 34.3 bits (75), Expect = 0.12 Identities = 29/104 (27%), Positives = 31/104 (29%), Gaps = 4/104 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXP-PXCXPXXSGXRXXGPTXHPPXRXXRLX-HXXXRXXX 807 P P P PP P P P P P S P PP + Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAP 81 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPP-PPXXXPPKP-PXP 933 P P P+ P P P P PP PPKP P P Sbjct: 82 PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/108 (24%), Positives = 28/108 (25%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP +P PP P P PP P PT PP + Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACP---------PT--PPKPQPKPAPPPEPKPAPP 90 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P PPP P P PP Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/77 (27%), Positives = 22/77 (28%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P PP PV P A P P P P PP Sbjct: 48 PSPCPSPPPKPQPKPVPPP---ACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKP 104 Query: 912 XSXTPXPXPPPWXPXXP 962 + TP P PP P P Sbjct: 105 PAPTPKPVPPHGPPPKP 121 Score = 29.9 bits (64), Expect = 2.7 Identities = 27/112 (24%), Positives = 29/112 (25%), Gaps = 2/112 (1%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P P PP P P P P + P PP Sbjct: 30 PCPSPPPKPQPKPP-PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPA 88 Query: 817 XXXXXXXXXXPHPX-PTAPXPRX-PXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P AP P+ P PPP P P P P P Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P+ P P+ PP P PP PP P PP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXP----PPPPXXXSXTPXPXPPPWXPXXP 962 P P P P P PPPP S P P PPP P P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P L PPPPP + P PPP P P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRX-PXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P PPP P K P PP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPP 705 PP P P+ PP PL PP PP Sbjct: 66 PPSPPPPKKSSC-PPSPLPPPPPP 88 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.5 bits (78), Expect = 0.053 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 1/112 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P+ P PP P S P PP Sbjct: 538 PPVHSPPPPVHSPPPPPVYSPPPPP-PPVHS---PPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXX-PPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P P PPPP PP P PP P Sbjct: 594 HSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 35.1 bits (77), Expect = 0.071 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXX---PXPXXXXPXPXLXXXPPPP 902 P +P P+RP P K P P P P PPPP Sbjct: 479 PVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPP 538 Query: 903 PXXXSXTPXPXPPPWXPXXPP 965 P P PPP PP Sbjct: 539 PVHSPPPPVHSPPPPPVYSPP 559 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP---XPXPPPWXPXXP 962 P P P P + PPPPP S P P PP + P P Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P PPPP PP PP P P P Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP 575 Score = 33.1 bits (72), Expect = 0.29 Identities = 27/109 (24%), Positives = 31/109 (28%), Gaps = 1/109 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTX-HPPXRXXRLXHXXXRXXXX 810 PP +P PP P+ P PP P P H P Sbjct: 562 PPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P +P PR P PP P PP P + PP Sbjct: 622 PPPVFSPPPSQSP-PVVYSPPPRPPKINSPPVQSP--PPAPVEKKETPP 667 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P PPPP P PP P PP Sbjct: 535 PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P P PPP P P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621 Score = 31.9 bits (69), Expect = 0.66 Identities = 26/109 (23%), Positives = 29/109 (26%), Gaps = 1/109 (0%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXX 822 P P PP P+ P PP P P PP + Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPP------PVYSPPPPPPPVHSPPPPVFSPPPPV 579 Query: 823 XXXXXXXXPHPXPT-APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P P PPP P PP P P P Sbjct: 580 YSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSP 628 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 +P P PPPP PP PP P P P Sbjct: 517 SPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSP 550 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPPP +P P PPP PP Sbjct: 536 PPPPVHSPPPPVHSPPPPP----VYSPPPPPPPVHSPPPP 571 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/98 (24%), Positives = 26/98 (26%) Frame = +1 Query: 673 PPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXXXXXXXXXXPH 852 PP P+ P PP P P PP P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPP--PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P +P P P PPP P PP P P P Sbjct: 577 PPVYSPPP--PVHSPPPPVHSPPPPAPVHSPPPPVHSP 612 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 35.5 bits (78), Expect = 0.053 Identities = 30/106 (28%), Positives = 31/106 (29%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G G GGGG S A G +G Sbjct: 49 GIGGGGSGSGAGAGSGSGGGG-SSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAG-SG 106 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 GR G GR G G G GG G GG GGG Sbjct: 107 SGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 34.7 bits (76), Expect = 0.093 Identities = 29/104 (27%), Positives = 30/104 (28%), Gaps = 1/104 (0%) Frame = -1 Query: 940 GGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGXXGR 761 GG G G+ GGGG G G G G G Sbjct: 38 GGIGAGIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGS 97 Query: 760 -VGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G R G G GG G GG G GGGG Sbjct: 98 YAGSHAGSGSGGRSGSGR-GRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G E G GGG+ G G Sbjct: 129 GGGGGGRGGGGGSGNGE-GYGEGGGYGGGYGGG 160 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G HGGG G G GGGGG G G Sbjct: 120 GGGGGHGGGGGGG---GGRGGGGGSGNGEGYG 148 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P P P P P A P P P P L P PPP T Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTP-PALPPKPLPPPLSPPQT 102 Query: 924 PXPXPPPWXPXXPP 965 P PP P PP Sbjct: 103 TPPPPPAITPPPPP 116 Score = 33.5 bits (73), Expect = 0.22 Identities = 26/108 (24%), Positives = 28/108 (25%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P GPP P P PP + P P + Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPT----PPTFQPAPPANDQPPPPPQSTSPPPVATTPP 86 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P T P P PPPP PP P P PP Sbjct: 87 ALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +1 Query: 847 PHPXPT-APXPRXPXX--PPPPXXXPPKPP 927 P P PT +P P P PPPP PP PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P T P P P P PP PP+ P PP P Sbjct: 132 PPPLATTP-PALPPKPLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/79 (26%), Positives = 21/79 (26%), Gaps = 1/79 (1%) Frame = +3 Query: 732 PXXRPXXPP-TRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPX 908 P P PP T P P P P P L P PPP Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPL 151 Query: 909 XXSXTPXPXPPPWXPXXPP 965 T P PP P P Sbjct: 152 SPPQTTPPPPPAITPPLSP 170 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXP 962 PPPPP P P PP P P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPP 54 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXP--PKPPXPXXXRGXPPXXP 966 P P P P PPPP P P PP P +G P P Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+A P P P PP PP P PP P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P A P PPP PP PP P PP P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPP--XXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P +G PP P Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKG-PPKPP 436 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P PPPPP P P PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PP PP + T P PPP PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPP 396 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP P P PPP PP Sbjct: 396 PPPPPPKKGPAAPP-PPPPPGKKGAGP-PPPPPMSKKGPP 433 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 35.1 bits (77), Expect = 0.071 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXX-----PPKPPXPXXXRGXPPXXP 966 P P P R P PPPP PP PP P R PP P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPP 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXP 953 PPPPP P P PPP P Sbjct: 45 PPPPPLMRRRAPPPPPPPPLP 65 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP P PPP P P Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXC 711 PP P P PP P PP P C Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPRPC 68 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 35.1 bits (77), Expect = 0.071 Identities = 32/97 (32%), Positives = 34/97 (35%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G H GG G G GGGGG+ S G G G G G + Sbjct: 90 GGGGGHRGGGGGGYRS---GGGGGY--SGGGGSYGGGGG----RREGGGGYSGGGGGYSS 140 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G G GG GR G G G GG G GG Sbjct: 141 RGGGGGSYGG--GRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G +GGG G G GGG+ S G G Sbjct: 142 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 35.1 bits (77), Expect = 0.071 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +3 Query: 753 PPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXP 932 PPT P P + P P P L PPPPP TP P Sbjct: 31 PPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPP---DLTPPP 87 Query: 933 XPPPWXPXXPP 965 PP P PP Sbjct: 88 SSPP-PPDAPP 97 Score = 35.1 bits (77), Expect = 0.071 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP P P A P P P PPPPP + Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDES 136 Query: 924 PXPXPPPWXPXXPP 965 P P PPP PP Sbjct: 137 P-PAPPPPEQLPPP 149 Score = 33.5 bits (73), Expect = 0.22 Identities = 28/104 (26%), Positives = 29/104 (27%), Gaps = 3/104 (2%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXP---LXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRX 801 LPP +P PP P PP PP P S P PP Sbjct: 54 LPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPP---PPDAPPPIPIVFPPPIDSP 110 Query: 802 XXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P A P PPPP PP P Sbjct: 111 PPESTNSPPPPEVFEP-PPPPADEDESPPAPPPPEQLPPPASSP 153 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P ++P P PPP PP P P PP Sbjct: 70 PPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P +P P PPPP P PP P PP P Sbjct: 105 PPIDSPPPESTNSPPPPEVFEP-PPPPADEDESPPAPP 141 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP---XPXXXRGXPPXXP 966 P P +AP P P PP P PP P PP P Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPP 72 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P +P P P PPP PP PP Sbjct: 158 PPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P P P PP P P PP P Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 A P P PPP PP P P PP Sbjct: 143 AGQPPPPESPPPESLPPPSPESPSPPSPEPP 173 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 35.1 bits (77), Expect = 0.071 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPPPP S P PPP+ PP Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYS---SPPPPPYVYNSPP 91 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP-----XPPPWXPXXPP 965 P P + PPPPP S +P P PPP+ PP Sbjct: 332 PPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 82 PPPYVYNSPPPPPYVYSSPP---PPPYVYKSPP 111 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 102 PPPYVYKSPPPPPYVYSSPP---PPPYVYKSPP 131 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 152 PPPYVYKSPPPPPYVYS---PPPPPPYVYQSPP 181 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 172 PPPYVYQSPPPPPYVYS---SPPPPPYVYKSPP 201 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 192 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 221 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 212 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 241 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 232 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 261 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 252 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 281 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 272 PPPYVYKSPPPPPYVYS---SPPPPPYVYSSPP 301 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 282 PPPYVYSSPPPPPYVYS---SPPPPPYVYSSPP 311 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 292 PPPYVYSSPPPPPYVYS---SPPPPPYVYKSPP 321 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP P PP P Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPP 94 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/74 (24%), Positives = 21/74 (28%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP P P + P P P PPPP + Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKS 159 Query: 924 PXPXPPPWXPXXPP 965 P P P + P PP Sbjct: 160 PPPPPYVYSPPPPP 173 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/74 (24%), Positives = 21/74 (28%) Frame = +3 Query: 744 PXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXT 923 P PP P P + P P P PPPPP + Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQS 179 Query: 924 PXPXPPPWXPXXPP 965 P P P + PP Sbjct: 180 PPPPPYVYSSPPPP 193 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + P PPP+ PP Sbjct: 72 PPPYVYSSPPPPPYVYN---SPPPPPYVYSSPP 101 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + P PPP+ PP Sbjct: 312 PPPYVYKSPPPPPYVYT---SPPPPPYVYKSPP 341 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXP---XPPPWXPXXPP 965 P P P P PPP S +P P PPP+ PP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPP 71 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 92 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 182 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 211 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 202 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 231 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 222 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 251 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 242 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 271 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 262 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 291 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 302 PPPYVYSSPPPPPYVYK---SPPPPPYVYTSPP 331 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP P PP P Sbjct: 169 PPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPP 204 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 35.1 bits (77), Expect = 0.071 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PPPP PP P PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 850 HPXPTAPXPRXPXXP--PPPXXXPPKPPXPXXXRGXPP 957 +P P +P P P P PPP PP PP PP Sbjct: 58 NPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PPPP PP PP P PP P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACP--PPPALP 81 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPP--KPPXPXXXRGXPPXXP 966 P P P P PPP PP PP P P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.7 bits (76), Expect = 0.093 Identities = 31/118 (26%), Positives = 34/118 (28%), Gaps = 1/118 (0%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXG 782 G G GGG G G GG GG+ S G G G G G G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Query: 781 XTGXXGRVGGXXGRXXGXRKXXGXXGVXXG-GXAGRGGXKXXXXGPRGGGGVX*XGKT 611 G G G G G G G G + G G G G G + Sbjct: 186 GYGGDATGHGGAGGGYGSSGGFGSSGNTYGEGSSASAGAVGDYNGSSGYGSANTYGSS 243 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/98 (25%), Positives = 28/98 (28%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G +GG G G GG GG+ G G G A + Sbjct: 131 GGGGGGYGGSGGYGGGAGGYGGSGGY--GGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYG 188 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G G GG G G G AG G Sbjct: 189 GDATGHGGAGGGYGSSGGFGSSGNTYGEGSSASAGAVG 226 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P ++P P PPPP PP P P PP Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 33.5 bits (73), Expect = 0.22 Identities = 29/114 (25%), Positives = 31/114 (27%), Gaps = 6/114 (5%) Frame = +1 Query: 634 PPXPX-APRXXXXGPPXPLXPPXPP--XCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP P +P PP P+ P PP P P PP Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSP--PPPVHSPP 595 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKP---PXPXXXRGXPP 957 P P P P PPPP PP P P P PP Sbjct: 596 PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPP 649 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +3 Query: 714 PXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXP 893 P R P TR P P + P P P P Sbjct: 516 PVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPP-HVYS 574 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 PPPP P P PP P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPP 598 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P P PPP PP Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 31.1 bits (67), Expect = 1.2 Identities = 28/111 (25%), Positives = 32/111 (28%), Gaps = 4/111 (3%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXX 816 P P P+ P P P P P GPT P + + Sbjct: 472 PKPEQPKPEES--PKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRS-PPPPKV 528 Query: 817 XXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKP----PXPXXXRGXPP 957 P P P+ P P PPPP PP P P P PP Sbjct: 529 EDTRVPPPQPPMPSPSPPSP--IYSPPPPVHSPPPPVYSSPPPPHVYSPPP 577 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P PPPP PP PP P P P Sbjct: 587 PPPPVHSPPPPPVFSPPPPVFSPP-PPSPVYSPPPPSHSP 625 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP P PPP PP Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 847 PHPXPT-APXPRXPXXPPPPXXXPPKPP 927 P P PT AP P P PPP PP PP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 33.9 bits (74), Expect = 0.16 Identities = 26/109 (23%), Positives = 28/109 (25%), Gaps = 1/109 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P P PP PP P PP +L Sbjct: 128 PPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP----KLVPPSHSPPRHL 183 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPP 957 P P+ P P PP P P PP R PP Sbjct: 184 PSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPP 232 Score = 33.5 bits (73), Expect = 0.22 Identities = 29/100 (29%), Positives = 31/100 (31%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P P GPP P PP P S PT PP + Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPP---PEPSPPPPL-PTEAPPP-----ANPVSSPPPES 122 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P T+P P P PPPP PP P P Sbjct: 123 SPPPPPPTEAPPTTPITSPSP--PTNPPPPPESPPSLPAP 160 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P L PPP S P P PPP P P Sbjct: 71 PPPEPSPPSPSLTG-PPPTTIPVSPPPEPSPPPPLPTEAP 109 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP----PXPXXXRGXPPXXP 966 P ++P P P PPP PP P P P PP P Sbjct: 57 PAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEP 98 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXP-PPWXPXXPP 965 P P PPPP TP P PP P PP Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPP S P PPP P P Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAP 133 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 850 HPXPTAPX-PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 HP P P P+ PPPP P P P P P Sbjct: 216 HPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHP 255 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 846 PXPXXXXPXPX-LXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P + PPP P P PPP P P Sbjct: 78 PSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSP 118 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP + P P P PP Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP 148 Score = 28.3 bits (60), Expect = 8.1 Identities = 22/99 (22%), Positives = 24/99 (24%), Gaps = 1/99 (1%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPXC-XPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXX 807 LP P PP PP PP P + P +PP Sbjct: 104 LPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPP 163 Query: 808 XXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKP 924 P P P PPPP P P Sbjct: 164 SNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P T P P P PPP PP PP P Sbjct: 73 PPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P PT P P PPP P+PP G P Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 23.8 bits (49), Expect(2) = 6.7 Identities = 13/40 (32%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXP-----PKPPXPXXXRGXPP 957 P P+ P P+ P P P PKP P PP Sbjct: 92 PPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 23.0 bits (47), Expect(2) = 6.7 Identities = 13/46 (28%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPP---XPPXCXPXXSGXRXXGPTXHPP 762 PP P +P PP P PP P + P+ PP Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPP 93 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 34.7 bits (76), Expect = 0.093 Identities = 33/113 (29%), Positives = 34/113 (30%), Gaps = 2/113 (1%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG-XXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG G GGG G G GGG G G G G G G Sbjct: 76 GGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGV 135 Query: 787 XGXTGXXGRVGGXXGRXXGXRK-XXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G G G K G G G AG+G G GG G Sbjct: 136 DGGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAG 188 Score = 28.7 bits (61), Expect = 6.1 Identities = 33/113 (29%), Positives = 34/113 (30%), Gaps = 2/113 (1%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGG-GGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXF 788 GG G GGG G G GG GGF G G G G G Sbjct: 57 GGGGGISGGG-GFGAGGGWIGGSVGGFGGGIGGGFGGGGFG----GGAGKGVDGGFGKGV 111 Query: 787 XGXTGXXGRVGGXXGRXXGXRK-XXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 G G G G G K G G G G+G G GG G Sbjct: 112 DGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGGVG 164 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P+ P PP P P P + P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P+ P PP P P P + P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P+ P PP P P P + P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P+ P PP P P P + P P Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PT P P+ P PP P P P + P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-PXPXXXRGXPPXXP 966 P P PT P P P P P PPKP P P P P Sbjct: 40 PKPKPT-PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPPXXP 966 P P P P P PP P P P PP P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKP 64 Score = 31.5 bits (68), Expect = 0.87 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-PXPXXXRGXPPXXP 966 P P P AP P P P P PPKP P P P P Sbjct: 29 PKPKP-APAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 862 TAPXPRXPXXPPPPXXXPPKP-PXPXXXRGXPPXXP 966 +AP P+ P P P PPKP P P P P Sbjct: 22 SAPAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-PXP 933 P P PT P P+ P P PKP P P Sbjct: 99 PTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 Score = 28.3 bits (60), Expect = 8.1 Identities = 20/81 (24%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +3 Query: 726 RXPXXRPXXPPTRPXX-PVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPP 902 + P +P PT P P P P P P PP P Sbjct: 27 KPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Query: 903 PXXXSXTPXPXPPPWXPXXPP 965 + TP P P P PP Sbjct: 87 KPKPAPTP-PNPKPTPAPTPP 106 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPP P S P P PP + P PP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFS--PPPSPPVYSPPPPP 449 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PPPP PP PP P PP P Sbjct: 403 PSPPIVALPPPP---PPSPPLPPPVYSPPPSPP 432 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P + PPPPP P PPP P P Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPPVFSP 436 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P+ P P PPP PP P PP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP + P PP PP Sbjct: 429 PSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPP 468 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPP +P P P + PP Sbjct: 447 PPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPP 479 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 847 PHPXPT-APXPRXPXXPPPPXXXPP---KPPXPXXXRGXPPXXP 966 P P P +P P P PPP PP PP P PP P Sbjct: 419 PLPPPVYSPPPSPPVFSPPP--SPPVYSPPPPPSIHYSSPPPPP 460 Score = 25.4 bits (53), Expect(2) = 1.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P+ P PPP P PP P PP Sbjct: 445 PPPPPSIHYSSPP--PPPVHHSSPPPPSPEFEGPLPP 479 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 10/30 (33%), Positives = 10/30 (33%) Frame = +1 Query: 673 PPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P PP PP P PP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 78 GGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G GGG G G GGGGG G G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G GGG G G GGGGG+ G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGG G+ G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G + GGGG G G Sbjct: 90 GGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.9 bits (74), Expect = 0.16 Identities = 31/107 (28%), Positives = 34/107 (31%), Gaps = 3/107 (2%) Frame = -1 Query: 952 GXHGGGXGX--GVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGX 779 G GGG G V + GGGGG G G G G G Sbjct: 383 GWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGG 442 Query: 778 TG-XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRG 641 G +GG G G G GG GRGG K G +G Sbjct: 443 GGAPLTMIGGGGGE-------QGVTGSDGGGGRGRGGGKVAGGGKKG 482 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G GGG G G GGGGG G G Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVG 429 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P+ P P PPPP PP P PP Sbjct: 460 PPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPP 496 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP-----XPPPWXPXXPP 965 P P + PPPPP S P P PPP+ PP Sbjct: 486 PPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPP 523 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 476 PPPYVYSSPPPPPYVYSSPP---PPPYVYSSPP 505 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP S P PPP+ PP Sbjct: 459 PPPPSPSPPPPYVYSSPPPPYVYS---SPPPPPYVYSSPP 495 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P+ + P P PPPP PP PP P PP Sbjct: 507 PYVYSSPPPPYVYSSPPPP---PPSPPPPCPESSPPP 540 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP----XPXPPPWXPXXPP 965 P P P + PPPP +P P PPP P PP Sbjct: 425 PPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPP 468 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP----XPXPPPWXPXXPP 965 P P P + PPPPP S P PPP+ PP Sbjct: 442 PPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPP 485 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPX-PPPWXPXXPP 965 P P + PPPP S P P PPP P P Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSP 538 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P PPPP S P P P P P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/71 (23%), Positives = 18/71 (25%) Frame = +3 Query: 753 PPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXXXSXTPXP 932 PP P P P + P P P PPP P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNS 581 Query: 933 XPPPWXPXXPP 965 PPP PP Sbjct: 582 PPPPSPVYYPP 592 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P + PPPP P PPP P Sbjct: 79 PLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 Score = 26.6 bits (56), Expect(2) = 0.19 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPP 918 P P P+ P P PPP PP Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPP 78 Score = 25.8 bits (54), Expect(2) = 0.19 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 5/30 (16%) Frame = +1 Query: 892 PPPPXXX-----PPKPPXPXXXRGXPPXXP 966 PPPP PP PP +G PP P Sbjct: 95 PPPPRFYYFESTPPPPPLSPDGKGSPPSVP 124 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 853 PXPTAPXPRXPXXPP---PPXXXPPKPPXPXXXRGXPP 957 P P P P P PP PP PP+PP PP Sbjct: 137 PMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPP 174 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P P P P+ P P P P PPPPP Sbjct: 1058 PEDSPPLPQESPP-PLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLS 1116 Query: 912 XSXTPXPXPPP 944 +P P PPP Sbjct: 1117 PPPSPPPPPPP 1127 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP P P PP P Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PP PP P P PP P PP Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +1 Query: 847 PHPXPTAPXPRXP----XXPPPPXXXPPKPPXP 933 P P P A P P PPPP PP PP P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P+ P P PPPP P P P PP P Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P + P P PPP PP PP Sbjct: 1102 PLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP-PPXXXPPKPPXPXXXRGXPP 957 P P P P P PP PP PP PP PP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPP 1106 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P L PPP + P PPP P PP Sbjct: 1077 PSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP----PPXXXPP--KPPXPXXXRGXPPXXP 966 P P P P P PP PP PP PP P PP P Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXP--XPPPWXPXXPP 965 P P P P PP P S P P PPP P PP Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P + P P+ P PP P PP P P P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P L PPPP + P PPP PP Sbjct: 1071 PLPPLPPSPPPPSPPLPPSSLPPPPP-AALFPP 1102 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXX--SXTPXPXPPPWXPXXPP 965 P P P PPPPP P P PP P PP Sbjct: 1077 PSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 616 SLXXXLPPXPXAPRXXXXGPPXPLXPPXPP 705 +L LPP P P PP PP PP Sbjct: 1098 ALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.5 bits (73), Expect = 0.22 Identities = 29/94 (30%), Positives = 31/94 (32%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G GGGGG+ G G G G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERR--------------SGGYG 133 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G GG G G R+ G G GG G GG Sbjct: 134 SGGG-GGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP P PP P G P P Sbjct: 230 PPPPPPPPHQAQPP-PPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PT P P P PP PP P PP P Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPP 247 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 27.1 bits (57), Expect(2) = 0.25 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPP 918 H +P P P PPPP PP Sbjct: 114 HHHRRSPPPPPPPPPPPPTITPP 136 Score = 25.0 bits (52), Expect(2) = 0.25 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 892 PPPPXXXPPKPP 927 PPPP PP PP Sbjct: 151 PPPPPPPPPPPP 162 >At5g24316.1 68418.m02864 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 125 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPP 918 P P P P P P PPPP PP Sbjct: 97 PRPIPKRPMPYVPPPPPPPTRRPP 120 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/116 (24%), Positives = 29/116 (25%), Gaps = 4/116 (3%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHP----PXRXXRLXHXXXR 798 L P P PP L PP PP P P P L Sbjct: 69 LSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 128 Query: 799 XXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P +P P PPP PP P R PP P Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S P P PPP PP Sbjct: 36 PAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S P P PPP PP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPP 90 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S P P PPP PP Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP 108 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S P P PPP PP Sbjct: 108 PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP 144 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXP 938 P P P P PPPPP P P P Sbjct: 154 PPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P P P P PP Sbjct: 90 PPPPVLLSPPPPPVNLS--PPPPPVNLSPPPPP 120 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S P P PPP PP Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPP 162 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + +P P P P PP Sbjct: 63 PPPPVNLSPPPPP--VNLSPPPPPVNLSPPPPP 93 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + +P P P P PP Sbjct: 99 PPPPVNLSPPPPP--VNLSPPPPPVLLSPPPPP 129 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP +P P P P PP Sbjct: 81 PPPPVNLSPPPPP--VLLSPPPPPVNLSPPPPP 111 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP +P P P P PP Sbjct: 117 PPPPVLLSPPPPP--VLLSPPPPPVNLSPPPPP 147 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/98 (28%), Positives = 30/98 (30%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G G GGGGG+ G G + Sbjct: 95 GGFGGGRGGGRGSG--GGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYG 152 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGG 671 G G G GG G G G GG G GG Sbjct: 153 GGGGGYGGGGGYGG---------GGGGYGGGGRGGGGG 181 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXG 872 GG G GGG G G GGGGG S G Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 29.5 bits (63), Expect = 3.5 Identities = 30/107 (28%), Positives = 30/107 (28%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G G GGG G G G G G G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYK-----CGEPG 138 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 R G G G G GG G GG G GGGG Sbjct: 139 HMARDCSEGGGGYG----GGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 G G GGG G G GGGGG+ G G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 33.1 bits (72), Expect = 0.29 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 965 GXXGGXPRXXXGXGGXGGXXXGGGGXXGXRGXGAVGXGXG 846 G GG P G GG G GGGG G GA G G G Sbjct: 106 GYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGA-GGGVG 144 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GGG G G GGGGG G G G G Sbjct: 97 GGDVGGGGGGYGGGT--PGGGGGGGGDTGAGAGGGGYGGG 134 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P PT P P P P PP PP P P P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPP 276 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 846 PXPXXXXPXPX---LXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPPP + P P PPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PRXPXXPPPPXXXPPKPP 927 P P PPPP PP PP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 26.6 bits (56), Expect(2) = 0.30 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPP 903 P P+ P P P PPPP Sbjct: 69 PSPSPPPPPPPRPPPPP 85 Score = 25.4 bits (53), Expect(2) = 0.85 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXP 915 +P +P P P PPPP P Sbjct: 67 NPPSPSPPPPPPPRPPPPPLSP 88 Score = 25.0 bits (52), Expect(2) = 0.30 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 892 PPPPXXXPPKPP 927 PPPP PP PP Sbjct: 105 PPPPPPPPPPPP 116 Score = 24.6 bits (51), Expect(2) = 0.85 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 895 PPPXXXPPKPPXP 933 PPP PP PP P Sbjct: 105 PPPPPPPPPPPPP 117 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP PP PP G PP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPG-----GGPPPPP 702 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P PPPP PP PP P G Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPPP P P P P PP Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P+A P PPPP P P P G PP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P PPPP P PP P Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPPP PP P PP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPP P P PPP Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G G HGGG G G GGG G G G G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGX-GVXEXXXGGGGGFXXSXGXG 866 GG G +GGG G G GGGGG G G Sbjct: 83 GGGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPPP S P PPP P PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPP-PPHLPP 73 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 32.7 bits (71), Expect = 0.38 Identities = 26/108 (24%), Positives = 28/108 (25%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 PP P PP P P PP PT P R Sbjct: 536 PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPS 595 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P PT + P PPPP + P P PP Sbjct: 596 PSPPYYQYTSSP-PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP 642 Score = 31.9 bits (69), Expect = 0.66 Identities = 21/89 (23%), Positives = 25/89 (28%), Gaps = 5/89 (5%) Frame = +3 Query: 714 PXXFRXPXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXP 893 P F+ PP P + P P P P P Sbjct: 427 PPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATP 486 Query: 894 PPP-----PXXXSXTPXPXPPPWXPXXPP 965 PPP P + P P PP + P PP Sbjct: 487 PPPSSKMSPSVKAYPPPPPPPEYEPSPPP 515 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P + PPPPP S P PPP+ PP Sbjct: 513 PPPPSSEMSPSVRAYPPPPP--LSPPPPSPPPPYIYSSPP 550 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P +P R PPP PP PP P PP P Sbjct: 515 PPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 30.3 bits (65), Expect = 2.0 Identities = 30/123 (24%), Positives = 31/123 (25%), Gaps = 12/123 (9%) Frame = +1 Query: 634 PPXPXA---PRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP P + P PP PL PP P P PP Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCP 572 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXP-----XXPPPP----XXXPPKPPXPXXXRGXPP 957 P P P P P PPPP PP PP P P Sbjct: 573 PTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSP 632 Query: 958 XXP 966 P Sbjct: 633 PPP 635 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +3 Query: 867 PXPXLXXXP--PPPPXXXSXTPXP---XPPPWXPXXPP 965 P P L P PPPP S P P PPP+ PP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P + PPPP T P PPP Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPP 679 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 32.7 bits (71), Expect = 0.38 Identities = 30/106 (28%), Positives = 31/106 (29%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G G GGGGG G G G G G G Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGG 165 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGG 635 G GG G G G GG G GG +G G Sbjct: 166 IGGG-GGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGSG 210 Score = 31.5 bits (68), Expect = 0.87 Identities = 29/100 (29%), Positives = 32/100 (32%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G V GGG G+ G G G G G Sbjct: 116 GGGYGPGGGGGGV-VIGGGFGGGAGYGSGGGLG-WDGGNGGGGPGYGSGGGGIGGGGGIG 173 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXK 665 G G GG G G G G GG + +G K Sbjct: 174 GGVIIGGGGGGCGGSCSGG--GGGGGGYGHGGVSTKGSGK 211 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 965 GXXGGXPRXXXGXGGXGGXXXGGGGXXGXRGXGAVG 858 G GG P G GG GG GGG G G G Sbjct: 151 GNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCG 186 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 32.3 bits (70), Expect = 0.50 Identities = 24/109 (22%), Positives = 29/109 (26%), Gaps = 1/109 (0%) Frame = +1 Query: 634 PPXPXAPRXXXXGP-PXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXX 810 PP P+ P P P+ PP P P HPP + Sbjct: 41 PPFKWGPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVK 100 Query: 811 XXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 +P P P PPP PP P + PP Sbjct: 101 YPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPP 149 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/83 (24%), Positives = 22/83 (26%), Gaps = 3/83 (3%) Frame = +3 Query: 726 RXPXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPP--- 896 + P P PP P P P P P + PP Sbjct: 48 KFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQY 107 Query: 897 PPPXXXSXTPXPXPPPWXPXXPP 965 PPP P PPP PP Sbjct: 108 PPPIKKYPPPEQYPPPIKKYPPP 130 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 956 GGXPRXXXGXGGXGGXXXGGGGXXGXRGXGAVGXG 852 GG P G G GG GGG G G GA G G Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGG 45 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GG G G GGGGG+ G G G Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 956 GGXPRXXXGXGGXGGXXXGGGGXXGXRGXGAVGXG 852 GG P G G GG GGG G G GA G G Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGG 45 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 GG G GG G G GGGGG+ G G G Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 32.3 bits (70), Expect = 0.50 Identities = 30/107 (28%), Positives = 34/107 (31%), Gaps = 3/107 (2%) Frame = -1 Query: 943 GGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTGXXG 764 GGG G G + GGGGG + G G G G G G Sbjct: 314 GGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Query: 763 RVGGXXGRXXGXRKXXGXXGVXXGGXAGRG---GXKXXXXGPRGGGG 632 G G +K G G GG G G + G GGGG Sbjct: 374 --VQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGG 418 Score = 31.1 bits (67), Expect = 1.2 Identities = 29/111 (26%), Positives = 32/111 (28%), Gaps = 2/111 (1%) Frame = -3 Query: 932 GXGGXGGXXXGGGGXXGXRGXGAVGXGXGXXXXXXXXXXXXXXXXRXFXWXNRXXRXGGW 753 G GG GG G GG G G G G N GG Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGV 374 Query: 752 XV--GPXXRXPEXXGXXXGGXGGXSGXGGPKXXXRGAXGXGGSXLXRENLP 606 + GP G GG G SG P G G GG ++P Sbjct: 375 QMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMP 425 Score = 29.9 bits (64), Expect = 2.7 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 1/110 (0%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GGG G + GGGG G G G G Sbjct: 320 GGKKGGPGGG-GGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNG 378 Query: 784 GXTGXXGRVGGXXGRXXGXRKXXGXXGV-XXGGXAGRGGXKXXXXGPRGG 638 G G GG G G G GG G GG P GG Sbjct: 379 GPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGG 428 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P L PPPP + P P P P P PP Sbjct: 404 PLLPTLPPPPVIEITRDPSPPPSPVQPPPPP 434 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P R P PP P PP P P Sbjct: 411 PPPVIEITRDPSPPPSPVQPPPPPSPP 437 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P L PPPPP + +P P PPP+ PP Sbjct: 57 PSPYLYSSPPPPPYVYN-SP-PPPPPYIYNSPP 87 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP +P P PP PP Sbjct: 67 PPPYVYNSPPPPPPYIYNSP-PRPPYVYKSPPP 98 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P P PPPP + + P PPP P Sbjct: 43 PPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSP 78 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P P P P PPPP PP PP RG Sbjct: 172 PPPSPPYFPPEPPSIPPPP---PPSPPSAASGRG 202 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPP 927 P+ P P P PP P PP PP Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPP 191 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP-PXXXPPKPP-XPXXXRGXPP 957 P P P P P P PPP P PP+PP P PP Sbjct: 158 PPPSPDFP-PFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P PPP PP P P PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPP--PP 905 P P PP R + P P P P P PPP PP Sbjct: 38 PIYSPPPPPYRSPVTIPPPPP-VYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Query: 906 XXXSXTPXPXPPP 944 S P P PP Sbjct: 97 PIYSPPPTPISPP 109 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP-WXPXXPP 965 PPPPP P PPP + P PP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPP PP PP PP P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPP 762 PP P R PP P+ P PP P P PP Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP-WXPXXPP 965 PPPPP P PPP + P PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPP 92 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPX---PXXXRGXPPXXP 966 P P P P PPPP PP PP P PP P Sbjct: 54 PPPPPVYSRP-VAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P + PPPPP P PPP P PP Sbjct: 63 PVAFPPPPPIY-SPPPPPIYPPPIYSPPPPPIYP--PP 97 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGGG G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDG 154 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPPP S P P P Sbjct: 460 PPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSP 492 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S TP P P Sbjct: 360 PPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSP 392 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S TP P P Sbjct: 410 PPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSP 442 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 135 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 167 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 185 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 217 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 210 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 242 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 235 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 267 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 285 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 317 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 335 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 367 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 485 PPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSP 517 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 510 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 542 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 535 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 567 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 560 PPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAP 592 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 585 PPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSP 617 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 610 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 642 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 635 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 667 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P PPP PP Sbjct: 12 PPPPPPSFRSIPRPPPPPSFRSIPP 36 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P PPP P+PP P R PP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPP 36 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P +P P PPPP PP PP Sbjct: 94 PSPPPPSPPPPSQACPPPPL--PPSPP 118 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P P PP PP PP P PP Sbjct: 92 PPPSPPPPSPPPPSQACPP---PPLPPSPPKKSYCPP 125 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 895 PPPXXXPPKPPXPXXXRGXPPXXP 966 PPP PP PP P PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPP 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXS 726 PP P P PP P PP C P S Sbjct: 98 PPSPPPPSQACPPPPLPPSPPKKSYCPPPPS 128 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 62 PPPYIYKSPPPPPYVYS---SPPPPPYIYKSPP 91 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 82 PPPYIYKSPPPPPYVYSSPP---PPPYIYKSPP 111 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 102 PPPYIYKSPPPPPYVYS---SPPPPPYVYKSPP 131 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 142 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 171 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 162 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 191 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 182 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 211 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 202 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 231 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 222 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 251 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 242 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 271 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 262 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 291 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 282 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 311 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 302 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 331 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 362 PSPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 391 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 382 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 411 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 402 PPPYVYKSPPPPPYVYS---SPPPPPYVYKSPP 431 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + P PPP+ PP Sbjct: 122 PPPYVYKSPPPPPYVYN---SPPPPPYVYKSPP 151 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP + P PPP+ PP Sbjct: 322 PPPYVYKSPPPPPYVYN---SPPPPPYVYKSPP 351 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 7/40 (17%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTP-------XPXPPPWXPXXPP 965 P P + PPPPP S P P PPP+ PP Sbjct: 422 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPP 461 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 52 PPPYVYSSPPPPPYIYK---SPPPPPYVYSSPP 81 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 72 PPPYVYSSPPPPPYIYK---SPPPPPYVYSSPP 101 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 92 PPPYVYSSPPPPPYIYK---SPPPPPYVYSSPP 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 112 PPPYVYSSPPPPPYVYK---SPPPPPYVYNSPP 141 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 132 PPPYVYNSPPPPPYVYK---SPPPPPYVYSSPP 161 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 152 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 181 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 172 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 201 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 192 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 221 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 212 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 241 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 232 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 261 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 252 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 281 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 272 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 301 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 292 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 321 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 312 PPPYVYSSPPPPPYVYK---SPPPPPYVYNSPP 341 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 372 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 401 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 392 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 421 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP P PPP+ PP Sbjct: 412 PPPYVYSSPPPPPYVYK---SPPPPPYVYSSPP 441 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P + PPPPP S P PPP+ PP Sbjct: 35 PPSYVYKPPTHIYSSPPPPPYVYS---SPPPPPYIYKSPP 71 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P+ P P P P PP P K P P + P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSP 108 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 PHP P + P PP P PP P PP P Sbjct: 118 PHPTPK----KSPSPPPTPSLPPPAPKKSPSTPSLPPPTP 153 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPP P PP P P P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTP 115 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPX---PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P+P P P + P PPP PP P +G PP P Sbjct: 182 PYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRP 224 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P PPP PP P G PP P Sbjct: 219 PPPSRPGMPPPGGAPMFAPPHP----GMPPAPP 247 Score = 23.8 bits (49), Expect(2) = 2.0 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXP--LXPPXPPXCXPXXSGXRXXGPTXHPP 762 +PP P P GPP P + PP P P G + P PP Sbjct: 161 MPPQP--PFAGQGGPPPPYGMRPPYPGPPPPQYGGQQR--PMMIPP 202 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/106 (22%), Positives = 30/106 (28%), Gaps = 6/106 (5%) Frame = +1 Query: 634 PPXPX---APRXXXXGPPXPLX---PPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXX 795 PP P +P+ PP P PP PP P P + + Sbjct: 186 PPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSP 245 Query: 796 RXXXXXXXXXXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P +P P+ PPP PP P Sbjct: 246 SPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P P P P + PPPP S P PPP+ P Sbjct: 238 PPPPYYSPSPKVNYKSPPPPYVYS---SPPPPPYSP 270 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P + PPPP S P PPP+ P Sbjct: 160 PPPPYYSPSPKVDYKSPPPPYVYS---SPPPPPYYSPSP 195 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P + PPPP + P PPP+ P Sbjct: 350 PPPPYYSPSPTVNYKSPPPPYVYN---SPPPPPYYSPFP 385 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P + PPPP + P PPP+ P Sbjct: 376 PPPPYYSPFPKVEYKSPPPPYIYN---SPPPPPYYSPSP 411 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXG 872 GG G +GGG G G GGGGGF S G Sbjct: 65 GGSTGNNGGGSGSG------GGGGGFGGSGG 89 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G GG G GGGGG+ + G G G G Sbjct: 140 GGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNF 199 Query: 784 GXTGXXGRVGGXXG 743 G G G GG G Sbjct: 200 GGGGGYGVAGGVGG 213 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPP---PPPXXXSXTPXPXPPPWXPXXPP 965 P P P + PP PPP S P PPP+ P P Sbjct: 865 PQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSP 907 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 891 PPP---PPXXXSXTPXPXPPPWXPXXPP 965 PPP PP + P P PPP P PP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 +P P P PPP PP PP P PP Sbjct: 364 SPVP-PPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXR 945 P P P P PPPP P PP P R Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKR 397 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPP 957 P P P PPPP P P PP P G PP Sbjct: 340 PPVPIVNPPSLPPPPPSFPVPLPPVPGLP-GIPP 372 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 853 PXPTAPX-PRXPXXPPPPXXXPPK--PPXPXXXRGXPP 957 P PT P P P PP P PP PP P PP Sbjct: 326 PIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP 363 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +3 Query: 846 PXPXXXXPXPX---LXXXPPPPPXXXSXTPXPXPPP 944 P P P P PPPPP P P PPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPW---XPXXPP 965 P P PPPP + P P PPP P PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP 57 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 8/48 (16%) Frame = +1 Query: 847 PHPXPTAPXP---RXPXXPPPPXXXP-----PKPPXPXXXRGXPPXXP 966 P P P P P R P PPPP P PP P R P P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPP 71 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P PPPPP P PPP P P Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P PR PP P PP PP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPPP P P PPP P P Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P L PP PP P P PPP P P Sbjct: 10 PPPPPPPPRLLVLPPLPP------PPPPPPPQLPFGP 40 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXP 717 PP P PR PP P PP PP P Sbjct: 11 PPPPPPPRLLVL-PPLPPPPPPPPPQLP 37 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP +P P PPP Sbjct: 268 PPPPPGSWQPSPPPPPPP 285 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPP 944 PPPP S P P PPP Sbjct: 267 PPPPPPGSWQPSPPPPP 283 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXS 878 GG G HGGG G G GGGGG+ S Sbjct: 65 GGSIGNHGGGSGSG------GGGGGYGGS 87 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXP-TAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P TAP P P P PP PP P P Sbjct: 342 PAPEPVTAPTPSPADAPSPTAASPPAPPTDESPESAPSDSP 382 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G +GGG G G GGG+ S G G Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P+ P PPP P P P P P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLP 190 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTA-PXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P PTA P P P PPP PP P PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 8/48 (16%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXP--------PPPXXXPPKPPXPXXXRGXPPXXP 966 P P TAP P P P PPP PP P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.1 bits (62), Expect = 4.6 Identities = 24/108 (22%), Positives = 25/108 (23%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXX 822 P +P PP P PP P P T PP Sbjct: 23 PTSPPTATPAPPTPTTPP--PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPA 80 Query: 823 XXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPP PP P P P Sbjct: 81 SPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PP P +P P PP P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP--PATPP 88 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTA-PXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P PTA P P P PPP PP P PP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 8/48 (16%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXP--------PPPXXXPPKPPXPXXXRGXPPXXP 966 P P TAP P P P PPP PP P PP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.1 bits (62), Expect = 4.6 Identities = 24/108 (22%), Positives = 25/108 (23%) Frame = +1 Query: 643 PXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXXXXX 822 P +P PP P PP P P T PP Sbjct: 23 PTSPPTATPAPPTPTTPP--PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPA 80 Query: 823 XXXXXXXXPHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPP PP P P P Sbjct: 81 SPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PP P +P P PP P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPP--PATPP 88 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P PPPP P P P R P P Sbjct: 102 PPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLPRP 141 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P+AP PR P P P+ P P P P Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVP 265 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 HP P+AP P P PPPP P P Sbjct: 22 HP-PSAPLPPPPPLPPPPPPRQSHPESP 48 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G GGG G GGGGG+ G G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G GGGGG G G Sbjct: 91 GGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXP 954 P+P P P P P PPP PP P G P Sbjct: 43 PNPSPP-PPPSNPSPPPPSPTTTACPPPPSSSGGGP 77 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P PPPP P PP P PP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPP 69 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 P PT P P PPPP PP P Sbjct: 58 PKHDPTKPGYGFPPPPPPPLSPPPPP 83 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P A P PPP PP PP PP Sbjct: 20 PPPAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPP 54 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP----PXXXPPKPPXP 933 P PT P P P PP P PKPP P Sbjct: 268 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 298 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP----PXXXPPKPPXP 933 P PT P P P PP P PKPP P Sbjct: 267 PRPTTPKPPSPRSDPPRLDAPRPTTPKPPSP 297 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXG 851 G G +GGG G GGGGG+ G G G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 867 PXPXLXXXP-PPPPXXXSXTPXPXPPPWXPXXPP 965 P P P PPPP P P PP P PP Sbjct: 44 PSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P P P PP PP P Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPP 76 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PTAPXPRXPXXPPP---PXXXPPKPPXPXXXRGXPPXXP 966 P +P P P PPP PP PP P + P P Sbjct: 214 PHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPP 927 P P P P PPPP PP PP Sbjct: 263 PNRPPP--PSSPPPPPPPPPTPP 283 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXP 933 P PPPP PP PP P Sbjct: 263 PNRPPPPSSPPPPPPPP 279 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P + PPPP S P PPP+ P Sbjct: 232 PPPPYFSPSPKVDYKSPPPPYVYS---SPPPPPYYSPSP 267 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P P P PPPP PP+ R PP P Sbjct: 37 PPPPPVYSPPISPPPPPPP--PPPQSHAAAYKRYSPPPPP 74 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PPPP P PPP P PP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPPK--PPXPXXXRGXPP 957 +P P AP P PPPP PP+ PP P PP Sbjct: 8 YPYP-APG-NYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPP 927 P P P PPPP PP PP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXP-PKPPXPXXXRGXPP 957 P+P P P P P P P P P P G PP Sbjct: 169 PYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 206 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/78 (23%), Positives = 20/78 (25%) Frame = +3 Query: 732 PXXRPXXPPTRPXXPVXPXKXXAXXXXXXXXXXXXXXXPXPXXXXPXPXLXXXPPPPPXX 911 P P P+ P P P P P P P P P Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259 Query: 912 XSXTPXPXPPPWXPXXPP 965 +P P P P P P Sbjct: 260 GPDSPLPSPGPDSPLPSP 277 >At4g09270.1 68417.m01535 hypothetical protein same aa sequence as protein T8A17_30 because of location on repetitive section Length = 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P PTA P P PP PP P G Sbjct: 50 PAPAPTAQQPEENVLPQQQQPPPPPPPLPAQMAG 83 >At4g09220.1 68417.m01528 hypothetical protein Length = 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRG 948 P P PTA P P PP PP P G Sbjct: 50 PAPAPTAQQPEENVLPQQQQPPPPPPPLPAQMAG 83 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP P P PPP Sbjct: 326 PPPPPSPEHKAPAPPPPP 343 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPP 927 AP P+ P PPPP PP PP Sbjct: 24 APPPQPP--PPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXP 933 P PPPP PP PP P Sbjct: 26 PPQPPPPPPPPPPPPPP 42 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +1 Query: 847 PHPXPTAPX-----PRXPXXPPPPXXXPPKPPXP 933 P P P P R P PPP PP PP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPP 41 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP-PXXXPPKPPXPXXXRGXP 954 P P P R PPP P PP PP P R P Sbjct: 10 PPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPP + T P P P PP Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPP 66 Score = 26.2 bits (55), Expect(2) = 5.2 Identities = 11/26 (42%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 853 PXPTAPX-PRXPXXPPPPXXXPPKPP 927 P P +P P P PP P PP P Sbjct: 88 PSPPSPTTPSNPRSPPSPNQGPPNTP 113 Score = 21.0 bits (42), Expect(2) = 5.2 Identities = 11/37 (29%), Positives = 12/37 (32%) Frame = +1 Query: 637 PXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGP 747 P P +P PP P PP P S P Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSP 90 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 892 PPPPXXXPPKPPXPXXXRGXPPXXP 966 PPP PPKPP P + P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEP 96 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 868 PXPRXPXXPPPPXXXPPKPP 927 P P+ P P PP PKPP Sbjct: 72 PPPKPPEPPKPPEPEKPKPP 91 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 883 PXXPPPPXXXPPKPPXP 933 P PPPP PP PP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/104 (25%), Positives = 27/104 (25%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G GGGGG G G G G G G Sbjct: 88 GNSGGGGSSG-GRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFK-CGEPG 145 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRG 641 R G G G GG G GG G G Sbjct: 146 HMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGLSCYSCGESG 189 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXG 845 G G HGG G G GGG G G G G G Sbjct: 76 GYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGG 114 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPP--PXXXPPKPPXPXXXRGXPPXXP 966 P P P + P PPP P PP PP PP P Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P PP PP S P PPP P PP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPP--PPPPP 53 Score = 28.7 bits (61), Expect = 6.1 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 3/90 (3%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXP---LXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXX 804 PP P P PP P L PP PP P S P PP H + Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPP---PPPSHQPYSYPPPPPPP-----PHAYYQQG 60 Query: 805 XXXXXXXXXXXXXXPHPXPTAPXPRXPXXP 894 P P P+AP P P P Sbjct: 61 PHYPQFNQLQAPPPP-PPPSAPPPLVPDPP 89 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPPWXPXXPP 965 P PP S P P PP P PP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPP 35 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP--PPXXXPPKPPXPXXXRGXPPXXP 966 P P P+ P P P P P PP PP P P P Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGG 890 GG G GGG G G GGGGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGG 88 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXP 962 P P P P + PPPP S P PPP+ P Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYS---SPPPPPYYSPSP 804 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXP----XPPPWXPXXPP 965 P P + PPPPP S +P P PPP+ PP Sbjct: 559 PTPYVYHSPPPPP-YYSPSPKPAYKSSPPPYVYSSPP 594 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP----XPXPPPWXPXXPP 965 P P P P + PPPP S P P P P PP Sbjct: 91 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPP 134 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 847 PPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSP 879 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 41 PPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSP 73 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 98 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 141 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 173 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 466 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 498 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 744 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 776 >At1g02110.1 68414.m00137 proline-rich family protein contains proline-rich domain, INTERPRO:IPR000694 Length = 679 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P PPPP PKP P Sbjct: 81 PRVPSSHSPEPPPPPIRSKPKPTRP 105 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P PPP P PP P Sbjct: 94 PSSAPPSSLSPSSPPPLSLSPSSPPPP 120 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHP 759 PP +P PP L P PP P S P+ P Sbjct: 49 PPSSLSPSSP---PPLSLSPSSPPPPPPSSSPLSSLSPSLSP 87 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPP 944 PPPPP P P PPP Sbjct: 350 PPPPPVIQPELPQPQPPP 367 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKP 924 P PT P P PP P PP P Sbjct: 34 PTPTLPSPSPATKPPSPALKPPTP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/100 (23%), Positives = 26/100 (26%), Gaps = 2/100 (2%) Frame = +1 Query: 634 PPXPXAPRXXXXGPPXPLXPPXPPXCXPXXSGXRXXGPTXHPPXRXXRLXHXXXRXXXXX 813 P P + P P+ P PP P PT PP + Sbjct: 68 PIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPP 127 Query: 814 XXXXXXXXXXXPHPXPTAPXPRXPXXPP--PPXXXPPKPP 927 P T P P PP P P KPP Sbjct: 128 TPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPP 167 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +3 Query: 852 PXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P + P PP P P PPP Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 867 PXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P PPP P P PPP Sbjct: 28 PPPMRRSAPSPPPMSGRVPPPPPPPP 53 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGG 893 G G HGGG G G GGGG Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGG 37 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 891 PPPPPXXXSXTPXPXPPPWXPXXPP 965 PPPP + P PPP P PP Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPPP 78 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 631 LPPXPXAPRXXXXGPPXPLXPPXPP 705 LPP P + PP P PP PP Sbjct: 142 LPPPPASTAIWSPSPPSPQHPPPPP 166 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXX-XPPKPPXPXXXRGXPPXXP 966 P P+ P P PPPP PP P PP P Sbjct: 111 PPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPP 149 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P L PPP + P P PPP Sbjct: 118 PPPEFSPPPPDLDTTTAPPP-PSTDIPIPPPPP 149 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 850 HPXPTAPXPRXPXXPPPPXXXPP--KPPXPXXXRGXPPXXP 966 HP P P PPPP PP PP PP P Sbjct: 44 HPPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 847 PHPXPTAPXP-RXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P T P P P PPP PP P + P P Sbjct: 270 PPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKP 310 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP--XPXPPPWXPXXPP 965 P P P P + PPPP S P PPP PP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP--XPXPPPWXPXXPP 965 P P P P + PPPP S P PPP PP Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 847 PHPXPTAPXP-RXPXXPP--PPXXXPPKPP--XPXXXRGXPPXXP 966 PHP P A P + P P PP P KPP P PP P Sbjct: 62 PHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKP 106 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 29.1 bits (62), Expect = 4.6 Identities = 37/120 (30%), Positives = 38/120 (31%), Gaps = 3/120 (2%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFX 785 GG G G G+ GG GG G G G G Sbjct: 70 GGFAGVGGVAGVGGLGMPLIGGLGGIGKYGGIGGAA-GIGGFHSIGGVGGLGGVGGGV-G 127 Query: 784 GXTGXXGRVGGXXG-RXXGXRKXXGXXGVXXG-GXAGRGGXKXXXXGPRGG-GGVX*XGK 614 G G G VGG G G G GV G G AG G G GG GGV GK Sbjct: 128 GLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGK 187 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 961 GXXGXHGGGXGXGVXEXXXGGGGG 890 G G GGG G G GGGGG Sbjct: 92 GGGGARGGGYGYGSGNGRSGGGGG 115 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 107 PPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSP 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 57 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTP 89 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 82 PPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSP 114 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 157 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 189 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 182 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 214 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 207 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 239 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 232 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 264 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 282 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 314 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 307 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 339 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 332 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 364 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 357 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 389 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 382 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 414 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 407 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 439 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 457 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 489 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 482 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 514 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 507 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 539 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 557 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 589 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 187 PPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSP 219 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 487 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSP 519 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 112 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 144 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 137 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 169 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 287 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 319 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 312 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 344 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 337 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 369 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 387 PPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSP 419 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 412 PPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSP 444 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 437 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 469 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 462 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 494 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 562 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 594 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPP---PPXXXPPKPPXPXXXRGXPPXXP 966 P P+ P P P PP PP PP P PP P Sbjct: 148 PSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAP 190 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 865 APXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 AP P P PP P PP PP P Sbjct: 122 APSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPP 155 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXG 872 GG G HGGG G G GGGG F G Sbjct: 24 GGGGGGHGGG-GHGRGGHGRGGGGIFFFGGG 53 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTP-----XPXPPPWXP 953 P P P P + PPPP S +P P PP + P Sbjct: 697 PPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPPSYSP 737 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 80 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 112 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 162 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 155 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 187 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 212 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 237 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 262 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 255 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 287 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 312 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 337 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSP 362 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 355 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 387 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSP 412 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 405 PPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSP 437 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 430 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 462 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 455 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 487 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 512 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 537 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 530 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 562 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 580 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 612 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 605 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 637 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 571 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSP 603 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 80 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 112 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 105 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 137 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 130 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 162 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 187 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 180 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 212 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSP 237 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 230 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 262 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSP 287 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 312 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSP 337 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 330 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 362 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 355 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 387 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 380 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSP 412 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 405 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSP 437 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSP 462 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 455 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSP 487 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 512 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 537 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 546 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 578 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSP 628 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 621 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 653 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 646 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 678 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 697 PPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSP 729 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 722 PPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSP 754 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 763 PPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSP 795 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 788 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 820 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSP 845 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 870 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 863 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 895 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 888 PPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSP 920 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 247 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSP 279 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 372 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTP 404 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSP 129 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 122 PPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSP 154 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 172 PPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 204 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 197 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 229 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 254 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 304 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 297 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 329 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 322 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 354 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 347 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 379 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 397 PPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSP 429 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 454 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 447 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 479 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 504 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 497 PPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSP 529 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 522 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 554 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 547 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 579 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 572 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 604 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 664 PPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSP 696 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 689 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 721 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 714 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 746 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 739 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 771 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 764 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 796 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 789 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 821 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 814 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 846 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 839 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSP 871 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 896 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 889 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 921 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 946 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 939 PPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSP 971 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 980 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSP 1012 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 894 PPPPXXXSXTPXPXPPPWXP 953 PPPP P P PPP+ P Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P PPP P PP P R PP Sbjct: 539 PRPPLPPPARARPLPPPARARPMPP-PARARPLPP 572 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-----PXPXXXRGXPP 957 P P + P P PPPP PP P P P PP Sbjct: 46 PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-----PXPXXXRGXPP 957 P P + P P PPPP PP P P P PP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-----PXPXXXRGXPP 957 P P + P P PPPP PP P P P PP Sbjct: 110 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP-----PXPXXXRGXPP 957 P P + P P PPPP PP P P P PP Sbjct: 142 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXP---XPPPWXPXXPP 965 P P P PPPP S P P PPP+ PP Sbjct: 68 PPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPP 110 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 P P + P P PPPP PP P Sbjct: 174 PPPVKSPPPPYLYSSPPPPVKSPPPP 199 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPPWXPXXPP 965 P P P P PPPP S P PPP PP Sbjct: 20 PYPAPYRP-PSSEPYPPPPTNQYSAPYYPYPPPPYATPPP 58 >At1g66260.1 68414.m07522 RNA and export factor-binding protein, putative similar to GI:7159943 from [Mus musculus] (RNA 6 (4), 638-650 (2000)) Length = 295 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -1 Query: 790 FXGXTGXXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRGGXKXXXXGPRGGGG 632 F G GRVG G R+ G AGRGG + G GG G Sbjct: 209 FIGQGVRGGRVGRGRGSGPSGRRLPLQQNQQGGVTAGRGGFRGRGRGNGGGRG 261 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +1 Query: 847 PHPXPTA-PXPRXPXXPP----PPXXXPPKPPXPXXXRGXP 954 P P P+A P P P P PP PP PP G P Sbjct: 48 PAPSPSANPPPSAPTTAPPVSQPPTESPPAPPTSTSPSGAP 88 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 946 HGGGXGXGVXEXXXG-GGGGFXXSXGXGXXXXGXG 845 HGGG G E G GGGG S G G G G Sbjct: 43 HGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G GGG G G GGGGG G G Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 900 PPXXXSXTPXPXPPPWXPXXPP 965 PP S P P PPP P PP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPP 394 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/43 (32%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPK---PPXPXXXRGXPPXXP 966 P+ P P P+ PPP PP+ PP P P P Sbjct: 61 PYGNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGP 103 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 847 PHPXPTAPX--PRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P P +P P P PP PP PP P P P Sbjct: 40 PLPLPLSPISPPFFPLESSPPSPPPPLPPTPPTTFAVFPTFP 81 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 847 PHPXPTAPX--PRXPXXPPPPXXXPPKPP 927 P P PT+P P P PP PP PP Sbjct: 396 PAPSPTSPPLSTPPPARPCPPVYSPPPPP 424 >At5g14140.1 68418.m01654 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 427 Score = 28.3 bits (60), Expect = 8.1 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 8/77 (10%) Frame = -1 Query: 265 FAFARVSTAGAALMTASRTL*PIFSRSLKKLP--------GAAETEAVAKTIANTKTKIF 110 F F R G A+ T P ++ ++ P G E E +AK + T+ Sbjct: 70 FMFVRPMATGMAVDTVGELGFPYWNPIRRRFPPDSPFFASGNVERELLAKQVTLDFTEDE 129 Query: 109 ENFILYFREIETQRTSC 59 N + F EIET+R SC Sbjct: 130 INHLHKFVEIETRRISC 146 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXPXXXRGXPPXXP 966 P P PTA P P PPP PP P P P Sbjct: 24 PAPTPTATPP--PATPPPVATPPPVATPPPAATPAPATPP 61 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 88 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 120 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 138 PPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 170 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 163 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 195 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 188 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 220 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 213 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 245 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 238 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 270 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 263 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 295 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 288 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 320 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 313 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 345 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 338 PPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSP 370 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 363 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 395 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 388 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSP 420 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 847 PHPXPT-APXPRXPXXPPPPXXXPPKPPXPXXXRGXPP 957 P P P P P+ PP P PK P P PP Sbjct: 271 PPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPP 308 >At4g26910.3 68417.m03871 2-oxoacid dehydrogenase family protein similar to SP|P36957 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) {Homo sapiens}; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme Length = 365 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXR 945 P A P+ P PPPP +P P R Sbjct: 107 PVAEKPKAPSSPPPPKQSAKEPQLPPKER 135 >At4g26910.2 68417.m03873 2-oxoacid dehydrogenase family protein similar to SP|P36957 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) {Homo sapiens}; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme Length = 463 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXR 945 P A P+ P PPPP +P P R Sbjct: 205 PVAEKPKAPSSPPPPKQSAKEPQLPPKER 233 >At4g26910.1 68417.m03872 2-oxoacid dehydrogenase family protein similar to SP|P36957 Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor (EC 2.3.1.61) {Homo sapiens}; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme Length = 464 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 859 PTAPXPRXPXXPPPPXXXPPKPPXPXXXR 945 P A P+ P PPPP +P P R Sbjct: 206 PVAEKPKAPSSPPPPKQSAKEPQLPPKER 234 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 867 PXPXLXXXP--PPPPXXXSXTPXPXPPPWXPXXPP 965 P P + P PPP + P P PP P PP Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPP-PXXXPPKP-PXPXXXRGXPPXXP 966 P P P P PPP P PP P P PP P Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKP 924 P P P P P PP P PP P Sbjct: 62 PPPMPMTPPPMPMTPPPMPMAPPPMP 87 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 117 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 149 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 167 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 199 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 192 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 224 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 217 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 249 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 266 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 298 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 291 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 323 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 316 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSP 348 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 341 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 373 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 416 PPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSP 448 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 441 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP 473 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 466 PPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSP 498 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 853 PXPTAPXPRXPXXPPPPXXXPP 918 P P +P P P PPPP P Sbjct: 73 PLPPSPPPTLPPSPPPPPPFSP 94 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 57 PPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSP 89 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 82 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 114 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 157 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 189 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 182 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 214 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 207 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 239 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 232 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 264 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 257 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 289 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 282 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 314 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 307 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 339 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 332 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 364 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 357 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 389 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 407 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 439 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 432 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 464 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 846 PXPXXXXPXPXLXXXPPPPPXXXSXTPXPXPPP 944 P P P P + PPPP S P P P Sbjct: 507 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSP 539 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 28.3 bits (60), Expect = 8.1 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 1/108 (0%) Frame = -1 Query: 952 GXHGGGXGXGVXEXXXGGGGGFXXSXGXGXXXXGXGXXXXXXXXXXXXXGXAXXFXGXTG 773 G GGG G G GG GG G G G G G G G Sbjct: 4 GGCGGGPGRG--GRGFGGRGG-----GPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGG 56 Query: 772 XXGRVGGXXGRXXGXRKXXGXXGVXXGGXAGRG-GXKXXXXGPRGGGG 632 R G R G G G GG G G G GPR GGG Sbjct: 57 RGPRGPGFGPRGPG--PWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGG 102 >At1g45688.1 68414.m05202 expressed protein Length = 342 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 847 PHPXPTAPXPRXPXXPPPPXXXPPKPPXP 933 P P P P+ P P PP PP P Sbjct: 260 PAPPAPLPKPKKKKGAPVPIPDPPAPPAP 288 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 873 PXLXXXPPPPPXXXSXTPXPXPPPWXP 953 P PPP P + P P PPP P Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPP 77 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 GG G GGG G G GGGG S G G Sbjct: 186 GGGGGSFGGGGGGGAGS--YGGGGAGAGSGGGG 216 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 964 GGXXGXHGGGXGXGVXEXXXGGGGGFXXSXGXG 866 G G GGG G G GGGGF G G Sbjct: 71 GAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,012,259 Number of Sequences: 28952 Number of extensions: 322959 Number of successful extensions: 11458 Number of sequences better than 10.0: 177 Number of HSP's better than 10.0 without gapping: 1151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5299 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2343832968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -