BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K20 (947 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 79 7e-15 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 71 1e-12 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 61 1e-09 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 58 8e-09 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 56 3e-08 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 55 1e-07 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 54 2e-07 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 54 2e-07 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 54 2e-07 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 53 3e-07 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 52 5e-07 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 52 7e-07 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 50 2e-06 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 50 3e-06 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 50 4e-06 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 50 4e-06 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 50 4e-06 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 49 5e-06 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 49 6e-06 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 49 6e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 48 8e-06 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 8e-06 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 1e-05 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 46 3e-05 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 46 6e-05 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 46 6e-05 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 45 1e-04 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 44 1e-04 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 44 2e-04 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 44 2e-04 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 44 2e-04 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 44 2e-04 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 44 2e-04 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 42 7e-04 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 42 7e-04 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 42 7e-04 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 42 7e-04 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 41 0.001 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 41 0.001 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 41 0.001 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 41 0.002 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 41 0.002 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 40 0.002 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 40 0.002 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 40 0.003 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 40 0.003 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.003 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 40 0.003 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 40 0.003 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 40 0.004 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 39 0.005 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 39 0.005 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 39 0.007 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 38 0.009 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 38 0.009 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 38 0.009 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 38 0.012 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 38 0.012 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 38 0.012 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 38 0.012 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 38 0.012 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 38 0.016 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 38 0.016 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 37 0.027 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.027 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 37 0.027 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 37 0.027 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 36 0.036 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 36 0.036 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 36 0.048 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 36 0.048 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 36 0.048 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 36 0.063 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 36 0.063 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 36 0.063 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 36 0.063 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 36 0.063 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 36 0.063 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 36 0.063 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 35 0.11 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 34 0.15 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 34 0.15 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 34 0.19 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 34 0.19 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 34 0.19 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 34 0.19 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 34 0.19 SB_11360| Best HMM Match : PDZ (HMM E-Value=0) 34 0.19 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 34 0.19 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.26 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.26 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 33 0.26 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 33 0.26 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 33 0.26 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 33 0.26 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 33 0.34 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 33 0.34 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 33 0.34 SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 33 0.34 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 33 0.34 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 33 0.34 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 33 0.34 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.34 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 33 0.45 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 33 0.45 SB_27662| Best HMM Match : Pentapeptide_2 (HMM E-Value=6.4) 33 0.45 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.45 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 33 0.45 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 33 0.45 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.45 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.57 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 32 0.59 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 32 0.59 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 32 0.59 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 32 0.59 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 32 0.59 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 32 0.78 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 32 0.78 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 32 0.78 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) 32 0.78 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 32 0.78 SB_59527| Best HMM Match : DUF382 (HMM E-Value=4.1e-26) 32 0.78 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 32 0.78 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 32 0.78 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 32 0.78 SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 32 0.78 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 32 0.78 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 26 0.82 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.95 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 0.96 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 31 1.0 SB_8210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 1.0 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 31 1.0 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.0 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 31 1.4 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 31 1.4 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 31 1.4 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 31 1.8 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 31 1.8 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 31 1.8 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_30346| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 31 1.8 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 31 1.8 SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) 31 1.8 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 29 2.3 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 30 2.4 SB_54760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 30 2.4 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 30 2.4 SB_41099| Best HMM Match : VWA (HMM E-Value=0) 30 2.4 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 30 2.4 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 30 2.4 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 30 2.4 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 30 2.4 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_32762| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 30 2.4 SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_59007| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 3.1 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43730| Best HMM Match : Drf_FH1 (HMM E-Value=0.74) 30 3.1 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 30 3.1 SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) 30 3.1 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 30 3.1 SB_1944| Best HMM Match : DUF1482 (HMM E-Value=7.3) 30 3.1 SB_504| Best HMM Match : GRP (HMM E-Value=2.8) 30 3.1 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 30 3.1 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 30 3.1 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 4.2 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 29 4.2 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 29 4.2 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 4.2 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 29 4.2 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 29 4.2 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 29 4.2 SB_48656| Best HMM Match : Extensin_2 (HMM E-Value=0.0009) 29 5.5 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 29 5.5 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 29 5.5 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 7.3 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 7.3 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 29 7.3 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_9191| Best HMM Match : TolA (HMM E-Value=1) 29 7.3 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 29 7.3 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 29 7.3 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_10452| Best HMM Match : TP2 (HMM E-Value=9.5) 29 7.3 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_64| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 29 7.3 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 28 9.6 SB_42387| Best HMM Match : CH (HMM E-Value=2.7) 28 9.6 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_10235| Best HMM Match : Coiled (HMM E-Value=6) 28 9.6 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 28 9.6 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 28 9.6 SB_6877| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) 28 9.6 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 28 9.6 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 28 9.6 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 28 9.6 SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 28 9.6 SB_38952| Best HMM Match : 7tm_2 (HMM E-Value=1.7e-21) 28 9.6 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 28 9.6 SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 78.6 bits (185), Expect = 7e-15 Identities = 32/66 (48%), Positives = 32/66 (48%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPPP PPPP P PPP P PPP PP PPP PP PP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 865 XXPXPP 882 P PP Sbjct: 427 PPPPPP 432 Score = 78.2 bits (184), Expect = 9e-15 Identities = 32/68 (47%), Positives = 33/68 (48%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPPP PPP P +PPP P PPP PP PPP PP PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 865 XXPXPPXP 888 P PP P Sbjct: 425 PPPPPPPP 432 Score = 76.2 bits (179), Expect = 4e-14 Identities = 36/79 (45%), Positives = 36/79 (45%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PPPP P PPP P PP PP PPP PP PP PP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPP------SPPPPPQPPPPPPPPPP-----PPPPPPPPP 413 Query: 883 XPXXXXXPXXXPPXXPXPP 939 P P PP P PP Sbjct: 414 PPPPPAPPPPPPPPPPPPP 432 Score = 72.9 bits (171), Expect = 3e-13 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 PPPPP PP P PPP PP P P P PP P PPPP P Sbjct: 365 PPPPPPPPPPP---------------PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Query: 879 XXPXPPXXPXXXPPXPXPPXPXP 947 P PP P PP P PP P P Sbjct: 410 PPPPPPPPPAPPPPPPPPPPPPP 432 Score = 65.3 bits (152), Expect = 7e-11 Identities = 37/96 (38%), Positives = 37/96 (38%) Frame = +3 Query: 648 SAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXP 827 SA PP P PP PP PP P PPP PP PPP P Sbjct: 358 SAGINMSPPPPPPPPPPPPSPPPPPPP--------------PPPSPPPPPQPPPPPPPPP 403 Query: 828 XFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP P PPPP P PP P PP P PP Sbjct: 404 PPPPPPPPPPP--------PPPPAPPPPPPPPPPPP 431 Score = 64.1 bits (149), Expect = 2e-10 Identities = 29/75 (38%), Positives = 29/75 (38%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P P PPP PP S P PPP PP PPP P PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 852 PPPSXXPXXXXPXPP 896 PPP PP Sbjct: 427 PPPPPPALRLACAPP 441 Score = 61.7 bits (143), Expect = 8e-10 Identities = 27/62 (43%), Positives = 28/62 (45%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPX 933 +PPP P P P PP PPP PP PP PP P PP P P PP P Sbjct: 364 SPPPPPPPPPPPPSPPPP-PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 934 PP 939 PP Sbjct: 423 PP 424 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/65 (41%), Positives = 28/65 (43%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 SPP P PPPPP PP PPP PP PPP P PP P Sbjct: 388 SPPPPPQPPPPPPPPPPPPP-------------------PPPPPPPPPPPAPPPPPPPPP 428 Query: 849 PPPPS 863 PPPP+ Sbjct: 429 PPPPA 433 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 73.3 bits (172), Expect = 3e-13 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 2/86 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP-PXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPPXRXXLP 858 P P PPPP PPP P P P P P PPP P PP P P PP P Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXP 936 P P PP P P PP P P Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/87 (40%), Positives = 36/87 (41%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPP-PXPPXPPPXPPXSPPXRXXLPP 861 P P PPPP P PP P + PP P P P PP PP PP PP PP Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Query: 862 -XXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP Sbjct: 171 NAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 71.3 bits (167), Expect = 1e-12 Identities = 35/89 (39%), Positives = 36/89 (40%), Gaps = 4/89 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP----PXPPXSPPXRXX 852 P P PPPP P PP + PP P PPP P PP P PP PP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Query: 853 LPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP P P PP P PP Sbjct: 187 YPP--PPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 69.7 bits (163), Expect = 3e-12 Identities = 32/85 (37%), Positives = 33/85 (38%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P P PP PPPP P + PP P PP P PPP P P PP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP P PP Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPP 176 Score = 69.3 bits (162), Expect = 4e-12 Identities = 36/93 (38%), Positives = 37/93 (39%), Gaps = 4/93 (4%) Frame = +3 Query: 675 PXXTXXPXPPP--PPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 P P PPP PP PP + P PPP PP PPP PP P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 849 P--PPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPP P P PP P PP P PP P Sbjct: 209 PPYPPPPNAPNPPYPPPPNAP--NPPYPPPPNP 239 Score = 68.9 bits (161), Expect = 6e-12 Identities = 33/91 (36%), Positives = 34/91 (37%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P P PPPP PP + P PPP PP P P PP P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP-PPYPPPP 183 Query: 855 PPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P PP PP P PP P P Sbjct: 184 NPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 68.1 bits (159), Expect = 1e-11 Identities = 32/79 (40%), Positives = 33/79 (41%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP P PP P PPP P P PP PP PP +PP PP P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP---PPPNAPNPP 205 Query: 883 XPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 206 PPNPPYPPPPNAPNPPYPP 224 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/96 (36%), Positives = 37/96 (38%), Gaps = 4/96 (4%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX- 848 P P PP PP P P PPP PP PPP P +PP P Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA 201 Query: 849 --PPPPSXXPXXXXPXPPXXPXXXPP-XPXPPXPXP 947 PPPP+ P P P P PP P PP P P Sbjct: 202 PNPPPPN-PPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 65.7 bits (153), Expect = 5e-11 Identities = 40/119 (33%), Positives = 44/119 (36%), Gaps = 4/119 (3%) Frame = +3 Query: 597 SAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXS---XXXXXXXXXX 767 SA G H PT+ P +PP P PPP PP + Sbjct: 77 SAKCGGHPPTNFSP----------NPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP 126 Query: 768 XXXPXXXPPPXPPXPPPXXPXFPPXPXPP-PPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPP P PP +PP P PP PP P P PP P PP P PP P Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 64.5 bits (150), Expect = 1e-10 Identities = 35/97 (36%), Positives = 37/97 (38%) Frame = +3 Query: 657 ARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP 836 A+ P P PP PP PP P PPP PP PPP +P Sbjct: 78 AKCGGHPPTNFSPNPPYPPPPYPPYPPP------------PPYPPPPNPPYPPPPNAPYP 125 Query: 837 PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P PP P P P PP PP P PP P P Sbjct: 126 PPPNPPYP---PPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 64.1 bits (149), Expect = 2e-10 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP-XXXPXP 879 P PP PPP P PP P PP P PPP PP PP PP P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 880 PXPXXXXXPXXXPPXXPXPP 939 P P P PP PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPP 169 Score = 60.9 bits (141), Expect = 1e-09 Identities = 33/94 (35%), Positives = 35/94 (37%), Gaps = 3/94 (3%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXP--PPXXPXFPPXPX 848 P P PP P PP + P P PP P PP P +PP P Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPN 192 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPP-XPXPPXPXP 947 PP P P P PP P PP P PP P P Sbjct: 193 PPYP-PPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 55.6 bits (128), Expect = 6e-08 Identities = 30/85 (35%), Positives = 31/85 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P L PP + PP P PPP P PPP PP PP PP Sbjct: 70 PDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYP--PPPNPPYPPPPNAPYPP- 126 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P P P PP Sbjct: 127 -PPNPPYPPPPNAPYPPSPNAPYPP 150 Score = 52.0 bits (119), Expect = 7e-07 Identities = 27/76 (35%), Positives = 29/76 (38%), Gaps = 1/76 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP-PXXPXFPPXPX 848 PP P P PP PP + P P P PP PP P P P P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 849 PPPPSXXPXXXXPXPP 896 PPPP+ P P PP Sbjct: 223 PPPPN-APNPPYPPPP 237 Score = 52.0 bits (119), Expect = 7e-07 Identities = 25/66 (37%), Positives = 27/66 (40%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPPP P PP P + PPP PPP P PP PP +P L Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYP-PPPNAPNPPYPPPPNAPNPPYPPPPNPQFAIALCLG 248 Query: 865 XXPXPP 882 P P Sbjct: 249 HGPRSP 254 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 70.9 bits (166), Expect = 1e-12 Identities = 37/88 (42%), Positives = 38/88 (43%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G GG G GG GG GG GGG GG GG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G + GGGG GGGG G G Sbjct: 836 FGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 69.3 bits (162), Expect = 4e-12 Identities = 38/89 (42%), Positives = 39/89 (43%), Gaps = 1/89 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXXX 771 G GG G GG G G G G GG GG+ GG G G G G GGG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GGG G GGGG GGGG G G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 68.1 bits (159), Expect = 1e-11 Identities = 37/88 (42%), Positives = 37/88 (42%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G GG G G GG GG GGG GG GGG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G GGGG GGGG G G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 67.3 bits (157), Expect = 2e-11 Identities = 36/92 (39%), Positives = 36/92 (39%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G GG G GG G GG G G GG G G G G GGG GG GGG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 G GGGGG G GG Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 65.3 bits (152), Expect = 7e-11 Identities = 37/88 (42%), Positives = 37/88 (42%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G GG G GG G GG GGG GG GGG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGG-GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG G G G GGGG G G Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 61.3 bits (142), Expect = 1e-09 Identities = 34/92 (36%), Positives = 34/92 (36%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G GG G G G GG G G GGGG GG GGG GG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 GGGGG G GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 59.3 bits (137), Expect = 4e-09 Identities = 36/89 (40%), Positives = 37/89 (41%), Gaps = 4/89 (4%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G GG G GG GG+ GG G G GG GGG G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG--GGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 758 GVVWXGXXXGGGG----XXGGGGRXGXXG 684 G G G GG GGGG G G Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/69 (44%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G G GG GG GGG GG GGG G G G G GGGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 707 G-GRXGXXG 684 G G G G Sbjct: 829 GYGDGGGFG 837 Score = 52.0 bits (119), Expect = 7e-07 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G GG G G GG GG GGG GG GGG G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDG-GGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Query: 767 XGGGVV 750 GGG V Sbjct: 872 GGGGGV 877 Score = 52.0 bits (119), Expect = 7e-07 Identities = 28/66 (42%), Positives = 29/66 (43%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G G G G GG GG GGG GG GGG G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG--GGGGGGGGGGGGGGGGGGGG 872 Query: 767 XGGGVV 750 GGGV+ Sbjct: 873 GGGGVI 878 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/64 (39%), Positives = 26/64 (40%) Frame = -2 Query: 859 GGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXGXXVX 680 GGGG G GG G G G GG GGG G G GGGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGY------GDGDGGGGGGGGGGG 822 Query: 679 XGGE 668 GG+ Sbjct: 823 GGGD 826 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 62.9 bits (146), Expect = 4e-10 Identities = 30/71 (42%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP---PXPPPXPPXSPPXRXXLPPXXXP 873 PPPP PP P + TPPP P PPP P P PPP P PP PP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP--PPTNGP 404 Query: 874 XPPXPXXXXXP 906 PP P P Sbjct: 405 PPPPPPTNGPP 415 Score = 54.0 bits (124), Expect = 2e-07 Identities = 29/75 (38%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXP---PXPPPXPPXSPPXRXXLPPXXXPXPPXPX 891 PPPP P + P P P PPP P P PPP P PP PP P PP P Sbjct: 346 PPPP---PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP--PPTNGPPPPPPP 400 Query: 892 XXXXPXXXPPXXPXP 936 P PP P Sbjct: 401 TNGPPPPPPPTNGPP 415 Score = 53.2 bits (122), Expect = 3e-07 Identities = 31/83 (37%), Positives = 31/83 (37%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 PPPPP PP PPP P PP P PP PPPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTP----------PPPPPTNKPPPPP--PPTNGPPPPP--PPT 391 Query: 879 XXPXPPXXPXXXPPXPXPPXPXP 947 P PP P PP P PP P Sbjct: 392 NGPPPPPPPTNGPPPPPPPTNGP 414 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PPP PPP PPP PP + P P P PP P P P P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 937 P 939 P Sbjct: 407 P 407 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/83 (33%), Positives = 28/83 (33%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P PPPP PP P P PP PP P PP P Sbjct: 348 PPPTNNPPSPPPPTNNTPP---------------PPPPTNKPPPPPPPTNGPPPPPPPTN 392 Query: 852 PPPSXXPXXXXPXPPXXPXXXPP 920 PP P P PP P PP Sbjct: 393 GPPPPPPPTNGPPPPPPPTNGPP 415 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXP--PXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 PPP P PPP PPP P PP PP P PP P P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP--PPTNGPPPPPPPTNGPPPPPPPTNG 403 Query: 931 XPP 939 PP Sbjct: 404 PPP 406 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 SPP T PPPPP PP P PP P PPP PP P Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPPTNGP-------PPPPPPTNGPPPPPPPTNGPPPPP 408 Query: 849 PP---PPS 863 PP PPS Sbjct: 409 PPTNGPPS 416 Score = 34.7 bits (76), Expect = 0.11 Identities = 25/78 (32%), Positives = 27/78 (34%) Frame = +3 Query: 621 PTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX 800 PT+ P + PP T P PPPPP PP PPP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP--------------------PPPP 399 Query: 801 PPXPPPXXPXFPPXPXPP 854 P PP P PP PP Sbjct: 400 PTNGPPPPP--PPTNGPP 415 Score = 32.3 bits (70), Expect = 0.59 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPP 838 P PP PPPP PP PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 61.3 bits (142), Expect = 1e-09 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGR-XXRXGGEXGGXGGGXGGXGGGXXXXXX 771 G GG G GG G G G G G R R GG GG G G GG GGG Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXG 693 GGG G GG G GGGG G Sbjct: 191 YGGGGYGGGGGGYGGSGYGGGGGYGG 216 Score = 60.9 bits (141), Expect = 1e-09 Identities = 34/85 (40%), Positives = 35/85 (41%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG GG G G GG G GG GG G G GG GGG Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGY 196 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 GGG + G GGGG GGGG G Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 57.2 bits (132), Expect = 2e-08 Identities = 34/85 (40%), Positives = 34/85 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G G G G G G GG G GG G G GG GGG G GG Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG-GYGGGGHGG 188 Query: 758 GVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GGGG GG G G G Sbjct: 189 GGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 56.8 bits (131), Expect = 2e-08 Identities = 34/85 (40%), Positives = 34/85 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG GG G G G G GG GG GG GG G GGG G GG Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Query: 758 GVVWXGXXXGGGGXXGGGGRXGXXG 684 G GGGG GGGR G G Sbjct: 206 SGYGGGGGYGGGGY--GGGRSGGGG 228 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G GG G GG G G GGGG G G G G G GG GGG G Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 55.6 bits (128), Expect = 6e-08 Identities = 35/87 (40%), Positives = 35/87 (40%), Gaps = 2/87 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGX--GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGX 765 GG G GG G G G G GG GG G G G GG GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 764 GGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG G GGGG GGGG G G Sbjct: 183 GGG--HGGGGYGGGGYGGGGGGYGGSG 207 Score = 55.6 bits (128), Expect = 6e-08 Identities = 33/82 (40%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGG-XGGGXXXXXX 771 G GG G GG G GG G G GG GG G G GG GGG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 770 GXGGGVVWXGXXXGGGGXXGGG 705 G GGG + G GGG GGG Sbjct: 207 GYGGGGGYGGGGYGGGRSGGGG 228 Score = 53.2 bits (122), Expect = 3e-07 Identities = 37/99 (37%), Positives = 37/99 (37%), Gaps = 7/99 (7%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXG---GXGXXXXGXXEGGGGXGXG---GXXGXXGGGXGGXG-GG 788 G G G G GG G G G G G GGGG G G G GGG GG G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Query: 787 XXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 G GG GGGGG G GG Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 50.8 bits (116), Expect = 2e-06 Identities = 37/109 (33%), Positives = 38/109 (34%), Gaps = 1/109 (0%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGX-GXGGXXGXXGGGXGGXGGGXXXGXXXX 764 G GG GG G GG G G GGGG G GG G G GG GGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 763 XXXXXXXXXXWXGGXXXGGGGGXGXXVXXGGEXXRAXAEWAXGYXWVGR 617 GG GGGG G GG + G GR Sbjct: 183 GGGH--------GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGR 223 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 + GG G GG GGG G GGG G GGGG GGGG Sbjct: 121 DSGGGGRRGGGYGGG-----RGGGGGYRSGGGYRGGGGYRGGGG 159 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 60.5 bits (140), Expect = 2e-09 Identities = 38/92 (41%), Positives = 38/92 (41%), Gaps = 4/92 (4%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGX----GGGXGGXGGGXXX 780 G GG G GG G G GG G GG GGE GG GGG G GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMG---GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGG 1812 Query: 779 XXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GGG G GG G G GG G G Sbjct: 1813 GGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 57.6 bits (133), Expect = 1e-08 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 3/85 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXG---GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXX 777 G GG G GG G G G G G GG GG GG GGG GG GGG Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG-GGGMGGGGGGMGGG 1820 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGGG 702 G G G GGG GGGG Sbjct: 1821 GEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -2 Query: 946 GXGXGGX-GXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 G G GG G GG G GG G G GGG G GG G GGG GG Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = -1 Query: 857 GRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GR GG GGG GG G G G GGG+ G GGG GG G G Sbjct: 1746 GRQMSSSSSTGGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGG 1800 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 59.3 bits (137), Expect = 4e-09 Identities = 34/82 (41%), Positives = 34/82 (41%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG GG G GGG G GGG G Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG 322 Query: 767 XGGGVVWXGXXXGGGGXXGGGG 702 GG V G GGGG GGGG Sbjct: 323 ATGGGV--GATGGGGGATGGGG 342 Score = 58.4 bits (135), Expect = 8e-09 Identities = 34/88 (38%), Positives = 34/88 (38%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG GG G GGG G GGG G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG--GATGGGGGATGGGVGATGGG 334 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GGGG GGGG G G Sbjct: 335 GGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 58.0 bits (134), Expect = 1e-08 Identities = 35/87 (40%), Positives = 35/87 (40%), Gaps = 2/87 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGX-GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG G GG G GG G GG GG G GGG G GGG G G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Query: 761 GGVVWXGXXXGGGGXXGGG-GRXGXXG 684 V G GGGG GGG G G G Sbjct: 309 ATGVGGGATGGGGGATGGGVGATGGGG 335 Score = 57.6 bits (133), Expect = 1e-08 Identities = 33/82 (40%), Positives = 33/82 (40%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG GG G GGG G GGG G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Query: 767 XGGGVVWXGXXXGGGGXXGGGG 702 GG G GGGG GGGG Sbjct: 330 ATGG--GGGATGGGGGVTGGGG 349 Score = 56.4 bits (130), Expect = 3e-08 Identities = 36/89 (40%), Positives = 36/89 (40%), Gaps = 1/89 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G G GG GG GG GG GG GG GG Sbjct: 239 GRLGGGGATGG---GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 295 Query: 767 XGGGVVWXGXXXGGGGXXG-GGGRXGXXG 684 GGG G GGGG G GGG G G Sbjct: 296 TGGG---GGATGGGGGATGVGGGATGGGG 321 Score = 55.2 bits (127), Expect = 7e-08 Identities = 36/94 (38%), Positives = 36/94 (38%), Gaps = 6/94 (6%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGG-RXXRXGGEXGGXGGGXGGXGG--GXXXX 777 G G G GG G G GG GG GG GG GG GG GG G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Query: 776 XXGXGGGVVWXGXXXGGGGXX---GGGGRXGXXG 684 G GGG G GGG GGGG G G Sbjct: 309 ATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 48.8 bits (111), Expect = 6e-06 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG GG G GGG G GGG G Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGG--GATGGGVGATGGGGGATGGG--GGVTG 346 Query: 767 XGGGVVWXGXXXGGGGXXGGG 705 GGG G G GG G Sbjct: 347 GGGGATGGGGGPGSGGCGEDG 367 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = -2 Query: 919 GGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXX 740 GG G G GGGG GG G GGG G GGG Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Query: 739 XXWXGGXXXGGGGG 698 GG GGGGG Sbjct: 288 ATGGGGGATGGGGG 301 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -1 Query: 845 RXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 R G GG GG GG GG G GGG GGG GGGG G G Sbjct: 236 RSNGRLGG-GGATGGGGGAT-----GGGGGAT----GGGGGATGGGGGATGGGG 279 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 58.4 bits (135), Expect = 8e-09 Identities = 33/95 (34%), Positives = 34/95 (35%), Gaps = 10/95 (10%) Frame = +1 Query: 685 PXXPXLPPP-PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP-------XPPPXPPXSPP 840 P P P P PPPP PPP P PP PP PPP PP +P Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPA 173 Query: 841 XRXXLP--PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P PP P PP Sbjct: 174 ATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 50.4 bits (115), Expect = 2e-06 Identities = 40/148 (27%), Positives = 43/148 (29%), Gaps = 8/148 (5%) Frame = +3 Query: 528 FLPVVWSPKDXGPKAXTSDSKQRSAM-IGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPP 704 F ++ K P T S + G PT A S PP P Sbjct: 64 FFSSLFKKKKQAPTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQA 123 Query: 705 PPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPP-------XPPPXXPXFPPXPXPPPPS 863 P P PP S P PP PP PPP P P P P Sbjct: 124 PSPP--PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAV 181 Query: 864 XXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P PP P PP P P Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P P PPPP P T P P PPP P PP PP PP P Sbjct: 153 PPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPP-PSGGPPPPPPPPPPPPPPPIL 211 Query: 865 XXPXPPXP 888 PP P Sbjct: 212 ELAAPPPP 219 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 5/84 (5%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP-----PPXPPXSPPXRX 849 P P P PPPP P PPP P P P P PP P PP Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPP-- 197 Query: 850 XLPPXXXPXPPXPXXXXXPXXXPP 921 PP P PP P PP Sbjct: 198 --PPPPPPPPPPPPILELAAPPPP 219 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 6/91 (6%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXX--PPPXPPXPP----PXPPXSPPXR 846 P P P PPPP P PPP P PPP PP P P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAA 186 Query: 847 XXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP P PP P PP Sbjct: 187 SPPPPSGGPPPPPP--------PPPPPPPPP 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 33/110 (30%), Positives = 35/110 (31%), Gaps = 6/110 (5%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXP--PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPX 809 P A ++ SPP P PPPP PP PPP PP Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPP---PPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 810 PPPXXPXFPPXPX----PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P PPPPS P P PP P P P P Sbjct: 171 APAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP-PPPPPILELAAPPPP 219 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX---PPPXPP 806 P A + PP PPPPP P P PPP PP Sbjct: 143 PIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Query: 807 XPPPXXPXFPPXPXPPPPS 863 PPP P PPP S Sbjct: 203 PPPPPPPILELAAPPPPGS 221 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 56.4 bits (130), Expect = 3e-08 Identities = 32/79 (40%), Positives = 32/79 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G GG G GG GG G GGG GG G G G G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCG-GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 758 GVVWXGXXXGGGGXXGGGG 702 G G GG G GG G Sbjct: 96 GGNVGGGGSGGVGGNGGSG 114 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/84 (39%), Positives = 33/84 (39%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G GG G G G G GG GG GG GGG G GGG G G G Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGC-GGGNDGGNGGGGAGNGGGGG----GAGNG 85 Query: 755 VVWXGXXXGGGGXXGGGGRXGXXG 684 G GG GGGG G G Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 53.2 bits (122), Expect = 3e-07 Identities = 33/85 (38%), Positives = 33/85 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G GG G GG G GG G G GG G G G G GGG G GGG G Sbjct: 31 GVGVGGGGVGGGG-GNGGGAGN---GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXG 692 GG GG GG G Sbjct: 87 AAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 52.0 bits (119), Expect = 7e-07 Identities = 31/82 (37%), Positives = 31/82 (37%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G G G GG GG GG G GG GG G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGG--GNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Query: 758 GVVWXGXXXGGGGXXGGGGRXG 693 G GGGG G GG G Sbjct: 93 --AGAGGNVGGGGSGGVGGNGG 112 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/91 (32%), Positives = 31/91 (34%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXX 761 G G G GG G GG G G G GG G GG G G GG G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGA-GNGVGAGGCGCGGG-NDGGNGGGGAGNGGGGGGAGNG 85 Query: 760 XXXXXXXXXWXGGXXXGGGGGXGXXVXXGGE 668 G GG GG G G + Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGGNGGSGSD 116 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGX-GGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG GG G GGG GG G G G GGG G GG G GGGG G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGND-GGNGGGGAGNGGGGGGAGNGG 86 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 56.4 bits (130), Expect = 3e-08 Identities = 27/51 (52%), Positives = 28/51 (54%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G GG G GG G G +GGGG G GG G GGG GG GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDG--DGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG GG GGG GG GGG G GGG G GGGG GGGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGG--GDGGGGGGGGDGGGGGGGGGGG 112 Score = 52.0 bits (119), Expect = 7e-07 Identities = 25/49 (51%), Positives = 25/49 (51%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GG GG GGG GG GGG G G G G GGGG GGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G GG G G +G GG G GG G GGG GG GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGG--GGGDGGGGGGGGGG 111 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/60 (46%), Positives = 28/60 (46%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G GG GG GG GGG GG G G GGG G GGGG GGGG Sbjct: 62 GGGGGGGGG-----GGGGGGGGGGGGGDDGDGGGGDGGGGGG----GGDGGGGGGGGGGG 112 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G GG GG+ G GGG GG GGG G GGG GGGG GG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG-----GGDGGG--------GGGGGGGG 112 Query: 707 GGR 699 GR Sbjct: 113 VGR 115 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 + GG GGG GG GGG G G G GGGG G GG G G Sbjct: 60 DDGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGV 753 GG G G GG G GG GG GG GGG G GGG G GGGV Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG----GGGGGGGV 113 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 55.2 bits (127), Expect = 7e-08 Identities = 31/84 (36%), Positives = 32/84 (38%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P LPPP PPP P PPP PPP P PPP P P +PP Sbjct: 1036 PSAQPLPPPRKPSPPPSAVP---IPPP----RKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 1089 RQP-DPIPTNPAHPTEPPPRQPKP 1111 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 3/75 (4%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXX 903 P P P T P P PP P PPP P PP +PP P PP Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 904 PXXXPP---XXPXPP 939 P PP P PP Sbjct: 1073 PRQPPPPSTSQPVPP 1087 Score = 51.6 bits (118), Expect = 9e-07 Identities = 32/98 (32%), Positives = 32/98 (32%), Gaps = 6/98 (6%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP T P PP PP PPP P PPP P PP P Sbjct: 1019 PPGPTEQPVPPKRKAS-PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Query: 852 PP----PSXXPXXXXPXP--PXXPXXXPPXPXPPXPXP 947 PP P P P P P P PP P P P Sbjct: 1078 PPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P PP P P P PPP P PPP PP R PP P PP Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 883 ---XPXXXXXPXXXPPXXPXP 936 P PP P P Sbjct: 1073 PRQPPPPSTSQPVPPPRQPDP 1093 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP-PXPPPXPPXSPPXRXXLPPXXXPXP 879 P P P PP + P P PPP P PPP P SPP PP P P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKP-SPPPSEPAPPPRQPPP 1078 Query: 880 PXPXXXXXPXXXPPXXPXPP 939 P P P P P Sbjct: 1079 PSTSQPVPPPRQPDPIPTNP 1098 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 1/86 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P +PPP PPP PP P PPP P P P P P P Sbjct: 1051 PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPK 1110 Query: 865 XXPXP-PXPXXXXXPXXXPPXXPXPP 939 P P P P P P P Sbjct: 1111 PTPAPRPRSWVESQPELHRPPPPIKP 1136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P PP P P HT P P P PP SPP LPP P PP Sbjct: 993 PSPPMQPAKPPRQ--HTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPP 1050 Query: 883 XPXXXXXPXXXPPXXPXPP 939 P P PP P PP Sbjct: 1051 -PSAVPIP---PPRKPSPP 1065 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 3/77 (3%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP---PXPPPXPPXSPPXRXXL 855 P PPP P PP P + PP P PPP P PPP P P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKP--SPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAH 1100 Query: 856 PPXXXPXPPXPXXXXXP 906 P P P P P Sbjct: 1101 PTEPPPRQPKPTPAPRP 1117 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/95 (31%), Positives = 31/95 (32%), Gaps = 1/95 (1%) Frame = +3 Query: 660 RXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPP 839 R SPP + P PPP PP S P PP PPP Sbjct: 1031 RKASPP--SAQPLPPPRKPSPPP--SAVPIPPPRKPSPPPSEPAPPPRQPPPPS----TS 1082 Query: 840 XPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP-PXP 941 P PPP P P P P P P P P P Sbjct: 1083 QPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/99 (28%), Positives = 29/99 (29%), Gaps = 9/99 (9%) Frame = +3 Query: 672 PPXXTXXPXP-----PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP 836 PP P P PPP PP PPP P P P P P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHP 1101 Query: 837 PXPXP----PPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P P+ P P PP P P P Sbjct: 1102 TEPPPRQPKPTPAPRPRSWVESQP--ELHRPPPPIKPKP 1138 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PP P PP P P PP P P P P PS P Sbjct: 993 PSPPMQPAK-PPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Query: 873 XXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P P P Sbjct: 1052 SAV-PIPPPRK----PSPPPSEPAP 1071 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +1 Query: 694 PXLPPPPXX----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PPPP PPP P T P P P P P S P PP Sbjct: 1073 PRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPP 1132 Query: 862 XXXPXP 879 P P Sbjct: 1133 PIKPKP 1138 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 2/59 (3%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXP--XFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P PP P P PP P P P P P P P Sbjct: 991 PHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSP 1049 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 54.8 bits (126), Expect = 1e-07 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PP PPP P P P P P PP PP PP PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 PP P PP P PP Sbjct: 970 APPLPPPPGGSAPPPPPPPPPP 991 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/85 (35%), Positives = 31/85 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P +PPPP PPP P PPP P PP P P PP P P Sbjct: 914 PPGGSVPPPP--PPPGGNAPL---PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGG 968 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP P PP Sbjct: 969 GAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/55 (45%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +1 Query: 694 PXLPPPPXX-PPPPXXXPXHTTPPPXPXXXXXXPPPX---PPXPPPXPPXSPPXR 846 P PPPP PPP P + PPP PPP PP PPP PP PP R Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMR 996 Score = 52.4 bits (120), Expect = 5e-07 Identities = 32/93 (34%), Positives = 33/93 (35%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 SPP + P PPPP P P PPP PPP P P Sbjct: 913 SPPGGSVPPPPPPPGGNAP-------LPPPPPGGSAPSQPPPPGGNAPPPPPP--PGGSA 963 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P P PP PP P PP P P Sbjct: 964 PPPGGGAPPL--PPPPGGSAPPPPPPPPPPPPP 994 Score = 48.4 bits (110), Expect = 8e-06 Identities = 27/69 (39%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXH-TTPPPXPXXXXXXPPP---XPPXPPPXPPXSPPXRXXLPP 861 P PPPP P P PPP P PPP PP PPP +PP PP Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPP-----PP 985 Query: 862 XXXPXPPXP 888 P PP P Sbjct: 986 PPPPPPPPP 994 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/82 (34%), Positives = 29/82 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PPPP P P + P P PP PPP P S P P P Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP----PPPPPGGSAPPPGGGAP---P 972 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 PP P P PP P PP Sbjct: 973 LPPPPGGSAPPPPPPPPPPPPP 994 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPP-XXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXP 812 P A PP P PPPP PP P PPP P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 813 PPXXPXFPPXPXPPPP 860 PP PP P PPPP Sbjct: 983 PPP----PPPPPPPPP 994 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P P P + PPP P P P PPP P S P + P P PP P Sbjct: 904 PGGSESPSASPPGGSVPPPPPP-----PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Query: 889 XXXXXPXXXPPXXPXPP 939 P P PP Sbjct: 959 PGGSAPPPGGGAPPLPP 975 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/69 (31%), Positives = 25/69 (36%) Frame = +3 Query: 609 GDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX 788 G + P P SA ++ PP P PPPP PP P Sbjct: 927 GGNAPLPPPPPGGSAPSQPP-PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPP 985 Query: 789 PPPXPPXPP 815 PPP PP PP Sbjct: 986 PPPPPPPPP 994 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP---XPPXPXP 947 P PP PP PPPP P P PP P PP P P Sbjct: 910 PSASPPGGSVPPP---PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P SPP PP P P P P P PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +2 Query: 791 PPXXPPP----PPXXPPXPPXXXPXSPL 862 PP PPP PP PP PP P L Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPPPMRKL 998 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 54.8 bits (126), Expect = 1e-07 Identities = 27/52 (51%), Positives = 28/52 (53%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG+ GG GGG GG GGG G GGG G GGGG GGGG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGAGGAG 706 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/55 (49%), Positives = 27/55 (49%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GG G G GGGG G GG G GGG GG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/53 (50%), Positives = 27/53 (50%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G GG G GG G G GGGG G GG G GGG GG G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GG G G GGGG G GG G G G G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 51.6 bits (118), Expect = 9e-07 Identities = 24/48 (50%), Positives = 25/48 (52%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G+ G GGG GG GGG G GGG G GGGG GGGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G G GG G GG G GG G G GGGG G GG G G G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GG GG GGG GG GGG G GGG G GGGG G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G GG GG GG GGG GG GGG G GGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Query: 707 GG 702 G Sbjct: 715 DG 716 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G GG G GG G GG G G GGGG G GG G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G GG G G GG G GG GG GG GGG GG GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Query: 755 VV 750 V Sbjct: 717 DV 718 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 54.0 bits (124), Expect = 2e-07 Identities = 31/86 (36%), Positives = 32/86 (37%), Gaps = 4/86 (4%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL---PPX 864 P PP PPP H+ P P P PP PP PP PP L PP Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMN--MPPPPPAMPPDGPPKFMGLPPPPPG 1258 Query: 865 XXPXPP-XPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP Sbjct: 1259 MRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 +PPPP PP PPP P PP PP PP P PP P P P Sbjct: 1234 MPPPPPAMPPDGPPKFMGLPPPPPGMRPM--PPQPPFMPPPPRMQPPG-----PPGPPGP 1286 Query: 880 PXP 888 P P Sbjct: 1287 PGP 1289 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPP---PSXXPXXXXPXPPXXPXXXPPXPX-PPXPXP 947 PPP P PP P F P PPP P P PP PP P PP P P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPX---PPXPPPXPPXSPPXRXXLPPXXXPXPPXPXX 894 PPP PPP P PP PP PP P PP +PP PP P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRP-MPPQPPFMPPPPRMQPPGPPG 1282 Query: 895 XXXPXXXPP 921 P P Sbjct: 1283 PPGPPGPQP 1291 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP---PXXPXFPPXPXPPPPS 863 PPPPP P P PP P PP P P PP P P PS Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQPS 1292 Score = 37.5 bits (83), Expect = 0.016 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Frame = +1 Query: 685 PXXPXLPP--PPXX----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P +PP PP PPPP P PP P PP PP PP P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP-GPPGPPGPPGPQP 1291 Score = 36.7 bits (81), Expect = 0.027 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP-XXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 PP PPPP PP P PP P PP P PP P Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP- 1283 Query: 849 PPPPSXXP 872 P PP P Sbjct: 1284 PGPPGPQP 1291 Score = 36.7 bits (81), Expect = 0.027 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +3 Query: 777 PXXXPPPXP--PXPPPXXPXFPPXP--XPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PP P PPP PP P PPPP P P PP P PP P P Sbjct: 1242 PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQP----PGPPGPP--GPPGPQP 1291 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 10/56 (17%) Frame = +1 Query: 703 PPPPXXPP--PPXXXPXHTTPP---PXPXXXXXXPPPX---PPXP--PPXPPXSPP 840 PPPP PP PP PP P P PPP PP P PP PP P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 35.1 bits (77), Expect = 0.084 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +2 Query: 785 PXPPXXPPPPP----XXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 P PP PP P PP PP P P P P PP P P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPP--QPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP PP P PP P PP P P P PP P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMG-LPPPPPGMRPMPPQPPFMPP 1271 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 792 PPXPPXPPPXXPXFP-PXPXPPPPSXXPXXXXPXPPXXPXXXPP--XPXPPXP 941 PP PPP P PPP P PP P PP PP P Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPP 1256 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 54.0 bits (124), Expect = 2e-07 Identities = 34/86 (39%), Positives = 34/86 (39%), Gaps = 1/86 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G G G GG GG GG GG GG GG Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGG-GGATGGGGGATGGHGGATGGGGGATGDGGGA 96 Query: 767 XGGGVVWXGXXXGGGGXXGG-GGRXG 693 GGG G GGGG GG GG G Sbjct: 97 TGGG---GGATGGGGGATGGHGGATG 119 Score = 54.0 bits (124), Expect = 2e-07 Identities = 34/87 (39%), Positives = 34/87 (39%), Gaps = 2/87 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G GG GG GG GG GG GG GG GG Sbjct: 64 GGGGATGG---GGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGG 120 Query: 758 GVVWXGXXXGGGGXXGG--GGRXGXXG 684 GV G G G GG GG G G Sbjct: 121 GVGATGGHGGATGGHGGATGGHGGATG 147 Score = 52.8 bits (121), Expect = 4e-07 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 1/89 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G GG G GG GG G GGG G G G G Sbjct: 41 GATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGG 100 Query: 767 XGGGVVWXGXXXGGGGXXGGG-GRXGXXG 684 G G G GG GGG G G G Sbjct: 101 GGATGGGGGATGGHGGATGGGVGATGGHG 129 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/90 (38%), Positives = 35/90 (38%), Gaps = 2/90 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG G GG GG GG GG GG GG G Sbjct: 71 GGGGATGGHGGATGGGGGATGDGG-GATGGGGGATGGG--GGATGGHGGATGGGVGATGG 127 Query: 767 XGGGVVWXGXXXGG--GGXXGGGGRXGXXG 684 GG G GG G GGGG G G Sbjct: 128 HGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGX--GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXX 774 G GG G G G G GG G GG GG G GGG G GG Sbjct: 74 GATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGG-HGGAT 132 Query: 773 XGXGGGVVWXGXXXGGGGX--XGGGGRXGXXG 684 G GG G GGGG GGGG G G Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 52.4 bits (120), Expect = 5e-07 Identities = 34/87 (39%), Positives = 34/87 (39%), Gaps = 5/87 (5%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGG-RXXRXGGEXGGXGGGXGGXG---GGXXX 780 G G G GG G G GG GG GG GG GG GG G GG Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Query: 779 XXXGXGGGVVWXGXXXGG-GGXXGGGG 702 G GG G GG GG GGGG Sbjct: 124 ATGGHGGATGGHGGATGGHGGATGGGG 150 Score = 51.2 bits (117), Expect = 1e-06 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 2/90 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGX--GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXX 774 G GG G G G G GG G GG GG G GG GG GG Sbjct: 81 GATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGG-HGGATGGHGGAT 139 Query: 773 XGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GG G GGGG GGG G Sbjct: 140 GGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 48.0 bits (109), Expect = 1e-05 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 3/91 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG--GXGGGXXXXX 774 G GG GG GG G GG G G GGG G G GGG Sbjct: 55 GATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGH 114 Query: 773 XGXGGGVVWXGXXXGGGGXXGG-GGRXGXXG 684 G GG V G G GG GG GG G G Sbjct: 115 GGATGGGV--GATGGHGGATGGHGGATGGHG 143 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/83 (33%), Positives = 28/83 (33%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G G G G GG G G GGGG GG G GG G GGG Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Query: 766 XXXXXXXXXXXWXGGXXXGGGGG 698 GG GG GG Sbjct: 94 GGATGGGGGATGGGGGATGGHGG 116 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/88 (34%), Positives = 30/88 (34%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G GG GG GG G GG GG GG G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA-----TG 105 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG GGG GG G G Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATG 133 Score = 47.2 bits (107), Expect = 2e-05 Identities = 28/66 (42%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXG-GGG 702 G G GG GG G GGG G GGG G GG G GGGG G GGG Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGG--HGGATGGGGGATGDGGG 95 Query: 701 RXGXXG 684 G G Sbjct: 96 ATGGGG 101 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGX-GGXGXXXGGRXXRXGGEXG--GXGGGXGGXGGGXXXXXXG 768 GG G GG G GG G GG GG G G GGG G GGG G Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Query: 767 XGGGV 753 GGV Sbjct: 166 ATGGV 170 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP---XXXXPXPPXXPXXXPPXPXP 932 P PPP PP PPP PP P PPPP P P PP P P P P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/63 (38%), Positives = 26/63 (41%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P P PPPP P +PPP P PP PP PPP PP + PP Sbjct: 195 PTSPSQITQPPPPPPRPP-PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPN 253 Query: 874 XPP 882 PP Sbjct: 254 MPP 256 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PPPP PPP P P P P PPP PP P PP +PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 50.0 bits (114), Expect = 3e-06 Identities = 29/72 (40%), Positives = 29/72 (40%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PPP P PP P PPP P P P PP PPP PP SPP P P Sbjct: 204 PPPPPPRPPPSPP----PPPPP------PSPSPPRPPPPPPPSPPR-----PLAAKLPEP 248 Query: 886 PXXXXXPXXXPP 921 P P PP Sbjct: 249 PPIPNMPPTLPP 260 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP PP PPP P PP P P PP P P PP P P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPP-RPPPPPPPSPPRPLAAKLPEP-PPIP 252 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/63 (44%), Positives = 28/63 (44%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 T PPP P PPP PP PPP PP P R PP P PP P P PP Sbjct: 202 TQPPPPPPR----PPPSPP-PPPPPPSPSPPRP--PPPPPPSPPRPLAAKLP-EPPPIPN 253 Query: 931 XPP 939 PP Sbjct: 254 MPP 256 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP--XPXXXXXPXXXPPXX 927 T P PPP PP PPP PP PP PP P PP P PP Sbjct: 192 TSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPI 251 Query: 928 PXPP 939 P P Sbjct: 252 PNMP 255 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP---PXPXP 947 PP PPP P PP P PPPPS P P PP P PP P P P P Sbjct: 204 PPPPPPRPPPSPPPP-PPPPSPSP----PRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PPPP PP P PPP P P PP P PP PP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXX 900 P P PPP P PPP P PP PP PP P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNM 254 Query: 901 XPXXXPP 921 P PP Sbjct: 255 PPTLPPP 261 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P PPPP P P P PP P P PP P P PP LP Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/81 (32%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = +3 Query: 648 SAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXP 827 ++ ++ PP P P PPP PP S P PPP PP PP P Sbjct: 196 TSPSQITQPPPPPPRPPPSPPPPPPPPSPS-------------PPRPPPPPPPSPP--RP 240 Query: 828 XFPPXPXPPP-PSXXPXXXXP 887 P PPP P+ P P Sbjct: 241 LAAKLPEPPPIPNMPPTLPPP 261 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 7/75 (9%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXP-------PPXXP 827 SP T P PPP P PP P PPP PP P PP P Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPPR----PPPPPPPSPPRPLAAKLPEPPPIP 252 Query: 828 XFPPXPXPPPPSXXP 872 PP PP P Sbjct: 253 NMPPTLPPPTLGYLP 267 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P PPPP P P PP P PP P PP P Sbjct: 195 PTSPSQITQPPPPPP--RPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P PP PPPPP PP P P P P P P P PP Sbjct: 209 PRPPPSPPPPP-PPPSPSPPRPPPP---PPPSPPRPLAAKLPEPP 249 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP 798 P P PPPP PP PPP P PPP Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P PP P P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRP 229 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P PPPP PP + PPP P PPP PP P P PP Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPS 350 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP PP Sbjct: 351 MGMAPPPVGGAAPPPPPPPPVGGPP 375 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPP PPP PPP PPP P PP PP R PP P Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP--PPSRGAPPPPSMGMAP 355 Query: 883 XPXXXXXPXXXPP---XXPXPP 939 P P PP P PP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPP 377 Score = 49.2 bits (112), Expect = 5e-06 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 7/86 (8%) Frame = +1 Query: 703 PPPPXX--PPPPXXXPXHTTPPPXPXXXXXXPPPXP---PXPPPXPPXSPPXRXXLPPXX 867 PPPP PPP P PPP P PPP PPP PP R P Sbjct: 288 PPPPSRGAAPPP---PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 868 XPXPPXPXXXXXP--XXXPPXXPXPP 939 P PP P PP P PP Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 49.2 bits (112), Expect = 5e-06 Identities = 33/107 (30%), Positives = 34/107 (31%), Gaps = 5/107 (4%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXX---PPXXSXXXXXXXXXXXXXPXXXPPPXPP 806 P S + PP PPPPP PP S P PP Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP 365 Query: 807 XPPPXXPXFPPXPXPPPPSXXP--XXXXPXPPXXPXXXPPXPXPPXP 941 PPP P P P PPP P P PP P P P P P Sbjct: 366 PPPP--PVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 48.8 bits (111), Expect = 6e-06 Identities = 31/91 (34%), Positives = 32/91 (35%), Gaps = 12/91 (13%) Frame = +1 Query: 703 PPPPXX---PPPPXXXPXHTTPPPXPXXXXXXPPPX----PPXP-----PPXPPXSPPXR 846 PPPP PPPP PPP P PPP PP P PP + P Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP 365 Query: 847 XXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP P P P PP Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/106 (29%), Positives = 34/106 (32%), Gaps = 9/106 (8%) Frame = +3 Query: 657 ARXXSPPXXTXXPXPPPPP---XXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXP 827 +R +PP + PPPP PP PPP PPP Sbjct: 292 SRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSM 351 Query: 828 XFPPXP----XPPPPSXXPXXXXPXPPXXPXXXPPXP--XPPXPXP 947 P P PPPP P P PP PP PP P P Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/92 (30%), Positives = 29/92 (31%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP + PPPP PP PPP PP P P P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARM-GTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPPS PP PP P PP P Sbjct: 347 PPPSMG----MAPPPVGGAAPPPPPPPPVGGP 374 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/96 (33%), Positives = 32/96 (33%), Gaps = 15/96 (15%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPP------XPPXPPPXXPXFPPXP--- 845 P PPP PP S P PPP PP PP PP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAP--PPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Query: 846 XPPPPS------XXPXXXXPXPPXXPXXXPPXPXPP 935 PPPPS P PP P PP P PP Sbjct: 345 APPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 8/105 (7%) Frame = +3 Query: 657 ARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPX---PPPXXP 827 +R PP + PPPPP P PP P PPP Sbjct: 301 SRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGG 360 Query: 828 XFPPXPXP-----PPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P P PPP P P PP P P P Sbjct: 361 AAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL 855 P PPPP PPP P PP PPP P P P P R L Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSS--LGNPPPPPPPGRGAPPPGPMIPGRAGL 415 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPP---XSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 PP P PPP PP PP +PP P PP P P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 931 XPP 939 PP Sbjct: 347 PPP 349 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P PP PPP T PPP P P PP PPP PP P LPP PP Sbjct: 283 PVPPMTPPPAVV----TAPPPAPPLPNFTSPSPPP-PPPLPPAMPAMDDLLPPEVLSPPP 337 Query: 883 XPXXXXXPXXXPPXXPXP 936 P P P P Sbjct: 338 PPPPSEDFYSMPSSLPMP 355 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/95 (31%), Positives = 31/95 (32%), Gaps = 10/95 (10%) Frame = +1 Query: 685 PXXPXLPPPPXX--PPPPXXXPXHTTP--PPXPXXXXXXP------PPXPPXPPPXPPXS 834 P P PPP PPP P T+P PP P P PP PPP PP S Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPS 342 Query: 835 PPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP Sbjct: 343 EDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 2/93 (2%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP--PXPX 848 P T PP PP + P PPP PP P P P Sbjct: 251 PPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNFTSPS 310 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPPP P P P PP P P P Sbjct: 311 PPPPPPLP----PAMPAMDDLLPPEVLSPPPPP 339 Score = 35.1 bits (77), Expect = 0.084 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 10/91 (10%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP--PP----- 857 P P P PP S PPP PP PPP P PP PP Sbjct: 217 PSPSPSAAPP--SSLRVKPVSGRLGLSNIKPPP-PPVPPPTIPSVPPGSETYVPPGSATY 273 Query: 858 PSXXPXXXXPXPPXXP---XXXPPXPXPPXP 941 S P PP P P P PP P Sbjct: 274 ESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 5/81 (6%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 +PP PPPP PP P PPP P P P P Sbjct: 300 APPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPP---PPPPPSEDFYSMPSSLPMPS 356 Query: 849 PP-----PPSXXPXXXXPXPP 896 PP P+ P P PP Sbjct: 357 PPEDLYDAPATLPSPIMPPPP 377 Score = 31.5 bits (68), Expect = 1.0 Identities = 22/89 (24%), Positives = 22/89 (24%), Gaps = 2/89 (2%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX--PPXPPPXXPXFPPXP 845 PP P P PP PP PP PPP F P Sbjct: 290 PPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMP 349 Query: 846 XPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P P P P P P P Sbjct: 350 SSLPMPSPPEDLYDAPATLPSPIMPPPPP 378 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 4e-07 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXP-----XPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP PP PP P PP P PPPP+ P P PP PP P P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PPP P PP P PP P PPP P PP PP PP PP P P Sbjct: 50 PPPPPPSPPAAAP---AAPPPPAAAPAAPPP-PAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Query: 886 P 888 P Sbjct: 106 P 106 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = +1 Query: 685 PXXPXLPPP--PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP-PPXPPXSP-PXRXX 852 P P PP P PPPP P PP P PPP PP P PP PP P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAP---AAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Query: 853 LPPXXXP 873 PP P Sbjct: 108 APPHFLP 114 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 777 PXXXPP---PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PP P P PP P PP P PP + P P PP P P P P P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/63 (33%), Positives = 24/63 (38%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 ++PPP P P PP PP P +PP P P PP P P P P Sbjct: 48 SSPPPPPPSPPAAAPAAPP-PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Query: 931 XPP 939 P Sbjct: 107 PAP 109 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +1 Query: 769 PXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP-XPPXPXXXXXPXXXPPXXPXPP 939 P PPP PP PP P +PP PP P PP P PP P PP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPP-----PPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +1 Query: 703 PPPPXXPPP--PXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPPXRXXLPPXXXP 873 PPPP PP P P P P P PP PP P PP P PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP---P 107 Query: 874 XPP 882 PP Sbjct: 108 APP 110 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +2 Query: 785 PXPPXXP--PPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P P P PPPP PP P P PL P P P P P PP P Sbjct: 66 PPPAAAPAAPPPPAAPPAAP--PPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP-PPPSXXPXX 878 PPPP PP + P P P PP P PP P P P P P Sbjct: 50 PPPPPPSPPAAAPAAP---------PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQ 100 Query: 879 XXPXPPXXPXXXPP 920 P PP P P Sbjct: 101 PAPQPPPAPPHFLP 114 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 SPP P P PP + P PP P PPP P P P Sbjct: 49 SPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP--APQPP 106 Query: 849 PPPPSXXP 872 P PP P Sbjct: 107 PAPPHFLP 114 Score = 36.7 bits (81), Expect = 0.027 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP 815 P A +PP P PPPP P PPP PP P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPP-------------------AAPPAAPPPPPPLPA 93 Query: 816 PXXPXFPPXPXPPP 857 P P P P PPP Sbjct: 94 PPPPPAQPAPQPPP 107 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP----XXXPPXPXPPXP 941 PPP PP PPP P P PPPP P PP P PP P PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP----XPPXSPPXRXXLPP 861 LP PP PPPP PPP P PP PP PPP PP PP + P Sbjct: 709 LPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/83 (33%), Positives = 28/83 (33%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 PPPPP PP S PP PP PPP PP P P P Sbjct: 694 PPPPPPPPPPLLSGTLPM-------------PPPPPPPPPGCAGLPPPPPSPQPGCAGLP 740 Query: 879 XXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P PP P Sbjct: 741 PPPPPPPPGCAGLPPPPPPIDVP 763 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 13/74 (17%) Frame = +1 Query: 700 LPPPPXXPPPPXXX---PXHTTPPPXPXXXXXXPPPXP----------PXPPPXPPXSPP 840 +PPPP PPPP P PPP P PPP P P PPP PP Sbjct: 693 VPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAG 752 Query: 841 XRXXLPPXXXPXPP 882 PP P P Sbjct: 753 LPPPPPPIDVPMKP 766 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 6/73 (8%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-----PXPPXSP-PXRXXLPPXXXPXPP 882 PPPP PPP PPP PP PP P PP SP P LPP P PP Sbjct: 694 PPPPPP-----PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPP--PPPPP 746 Query: 883 XPXXXXXPXXXPP 921 P P PP Sbjct: 747 PPGCAGLPPPPPP 759 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 5/71 (7%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP-----PPXPPXSPPXRX 849 P P PPPP P PPP P PPP P P PP PP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPP--PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCA 751 Query: 850 XLPPXXXPXPP 882 LPP P PP Sbjct: 752 GLPP---PPPP 759 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +2 Query: 785 PXPPXXPPPPPXX---PPXPPXXXPXSPLXXPXXXPXPPXXX--PXPXPPXXXPXXP 940 P PP PPPPP PP PP P P P PP P P PP P P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PPP P PPP PP P LP P PP P P PP P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLP--PPPPSPQP 734 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P LPPPP P P PPP P PPP PP P P Sbjct: 720 PGCAGLPPPP-PSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 6/59 (10%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP------XPXPPXPXP 947 PPP PP P P PPPP P P P PP P PP P P Sbjct: 677 PPPPPPLPVIEGSSLS-VPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/94 (27%), Positives = 28/94 (29%), Gaps = 7/94 (7%) Frame = +1 Query: 565 QKPXXRTPSRDPP*LVITSXXXXXXXXXXXXXXXXXXXXXPXXPXLPPPPXX-----PPP 729 Q+ + P PP VI P P PPPP PPP Sbjct: 670 QEKLKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP 729 Query: 730 PXXXPXHT--TPPPXPXXXXXXPPPXPPXPPPXP 825 P P PPP P P PP P P Sbjct: 730 PSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +2 Query: 791 PPXXPPPPPXX----PPXPPXXXPXSPL 862 PP PPPPP PP PP P PL Sbjct: 740 PPPPPPPPPGCAGLPPPPPPIDVPMKPL 767 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 52.0 bits (119), Expect = 7e-07 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 3/79 (3%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPPXRXX-LPPXXXPXPPX 885 P PP P P TPP P PP PP P P PP SP L P P PP Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPN 235 Query: 886 PXXXXXPXXXP-PXXPXPP 939 P P P P PP Sbjct: 236 PSKAIATPNPPMPETPLPP 254 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/84 (34%), Positives = 30/84 (35%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PP P P P P TP P P P P P PP PP +P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLP-PGSPHIPPAPLHPHIPPAPP-NPSKAIATPNP 245 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 246 PMPETPLPPATPNP-FIPPASPNP 268 Score = 46.4 bits (105), Expect = 3e-05 Identities = 32/94 (34%), Positives = 34/94 (36%), Gaps = 9/94 (9%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP--PXXXPXHTTPPPXPXXXXXXPP-PXPPXPPPXPPXSP-PXRXX 852 P P P PP P P P P + PP P PP P P PP P P P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLF 304 Query: 853 LP-----PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 +P P P PP P P P P PP Sbjct: 305 IPSAPPNPHIPPAPPNPYIPTAP-PNPSIPPAPP 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 6/91 (6%) Frame = +1 Query: 685 PXXPXLPPPPXXP--PPPXXXPXHTTPPPXPXXXXXXP-PPXP--PXPPPXP-PXSPPXR 846 P P P PP P PP P PP P P PP P P PP P P PP Sbjct: 206 PPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPAS 265 Query: 847 XXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P P P P Sbjct: 266 PN--PSIPPAPPNPSIPAPPNPSIPLAPPNP 294 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/89 (33%), Positives = 32/89 (35%), Gaps = 4/89 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP----PXSPPXRXX 852 P P +P PP P P P PP P PP P PP P P +PP Sbjct: 274 PPNPSIPAPPN-PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPN--- 329 Query: 853 LPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P P P PP Sbjct: 330 --PSIPPAPPNPSIPPAP-PNPSIPPAPP 355 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 4/89 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXP--PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP-PXRXXL 855 P P +PP P P PP P P P PP P P PP SP P Sbjct: 215 PGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPN-PFIPPASPNPSIPPA 273 Query: 856 PP-XXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP P P P P PP Sbjct: 274 PPNPSIPAPPNPSIPLAP-PNPYIPPAPP 301 Score = 44.0 bits (99), Expect = 2e-04 Identities = 47/180 (26%), Positives = 53/180 (29%), Gaps = 3/180 (1%) Frame = +3 Query: 417 WAXQNAQATIDLNRQIGGR--SGMTASGSGVWDLDKNPTFLPVVWSPKDXGPKAXTS-DS 587 WA Q AT+ IG S + V D P P + S T ++ Sbjct: 117 WAQQKGTATLTFEGVIGKSFLSDIAVDDISVEDCTGTPE--PTITSKPPVTETTTTKPET 174 Query: 588 KQRSAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXX 767 K +PT P A SPP T P PP P PP Sbjct: 175 KPPKPPAPSTIPTPPTPPA------PPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLH-- 226 Query: 768 XXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P P PP P P P P P P P P P P P Sbjct: 227 ---PHIPPAPPNPSKAIATPN-PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAP 282 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PP P P PP P PP P P P PP P P P Sbjct: 268 PSIPPAPPNPSIPAPPN--PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPT 325 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 326 APPNPSIPPAPPNP-SIPPAPPNP 348 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP--PXSPPXRXXLP 858 P P PP P PP P + PP P P P P PP P P +PP P Sbjct: 285 PSIPLAPPNPYIPPAPPNL-FIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP 343 Query: 859 -PXXXPXPPXPXXXXXPXXXP 918 P PP P P P Sbjct: 344 APPNPSIPPAPPNLFIPPATP 364 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/96 (30%), Positives = 31/96 (32%), Gaps = 3/96 (3%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP-PXXPXFPPXP 845 +P P PP P PP P P P P PP P P PP P Sbjct: 235 NPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNP 294 Query: 846 X--PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP+ P P P PP P P P Sbjct: 295 YIPPAPPNLFIPSAPPNPHIPP--APPNPYIPTAPP 328 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/81 (34%), Positives = 29/81 (35%), Gaps = 9/81 (11%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTP------PPXPXXXXXXP-PPXPPXPP-PXPPXSPPX-RXXL 855 P P PP T P PP P P PP PP PP P P +PP L Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPL 213 Query: 856 PPXXXPXPPXPXXXXXPXXXP 918 PP PP P P P Sbjct: 214 PPGSPHIPPAPLHPHIPPAPP 234 Score = 41.9 bits (94), Expect = 7e-04 Identities = 30/86 (34%), Positives = 32/86 (37%), Gaps = 2/86 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP-PPXPXXXXXXPPP-XPPXPPPXPPXSPPXRXXLP 858 P P P P PP P P + P PP P P P PP PP S P +P Sbjct: 259 PFIPPASPNPSIPPAP---PNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIP 315 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P P PP P P Sbjct: 316 P-APPNPYIPTAPPNP-SIPPAPPNP 339 Score = 41.5 bits (93), Expect = 0.001 Identities = 28/91 (30%), Positives = 29/91 (31%), Gaps = 4/91 (4%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXP--- 845 P + P PP P PP S P P P P P P PP P Sbjct: 266 PNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAP-PNPHIPPAPPNPYIP 324 Query: 846 -XPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP PS P P P P P PP Sbjct: 325 TAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/94 (30%), Positives = 31/94 (32%), Gaps = 9/94 (9%) Frame = +1 Query: 685 PXXPXLPPPPXXPP-----PPXXXPXHTTPP--PXPXXXXXXPPPXPPXPPPXPPXSPPX 843 P P +PP P P P P PP P P P P P PP P P Sbjct: 224 PLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP 283 Query: 844 RXXLP--PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 +P P PP P P PP PP Sbjct: 284 NPSIPLAPPNPYIPPAPPNLFIP-SAPPNPHIPP 316 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 1/91 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PP PP P P P P PP P PP P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPN-PHIPPAPPN 320 Query: 852 P-PPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P+ P P P P P P P P Sbjct: 321 PYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP 351 Score = 38.3 bits (85), Expect = 0.009 Identities = 33/119 (27%), Positives = 35/119 (29%), Gaps = 5/119 (4%) Frame = +3 Query: 600 AMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXP 779 A + H+P P A A P T P P P PP P Sbjct: 223 APLHPHIPPAP-PNPSKAIATPNPPMPETPLPPATPNPFI-PPASPNPSIPPAPPNPSIP 280 Query: 780 XXXPPPXPPXPP-PXXPXFPP----XPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP P P PP PP P P P P P P PP P Sbjct: 281 APPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Score = 38.3 bits (85), Expect = 0.009 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 3/91 (3%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX-PPXPP-PXXPXFPPXP 845 PP P PP P P P P PP PP P P PP P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNP 330 Query: 846 -XPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP P P P P P PP Sbjct: 331 SIPPAPPNPSIPPAPPNPSIPPAPPNLFIPP 361 Score = 34.3 bits (75), Expect = 0.15 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 16/106 (15%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXX-------PPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP----- 815 PP PP PP PP P P PP PP Sbjct: 221 PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Query: 816 ----PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP P PP P P P P P P P P Sbjct: 281 APPNPSIPLAPPNPYIPP--APPNLFIPSAPPNPHIPPAPPNPYIP 324 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 P P P TT P P P P P P SPP P P PP Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPI-----PTAPPTPPM 208 Query: 886 PXXXXXPXXXPPXXPXP 936 P P P P P Sbjct: 209 P-ETPLPPGSPHIPPAP 224 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 785 PXPPXXPPPP-PXXPPXPPXX--XPXSPLXXPXXXPXPPXXXPXPXPP 919 P P P PP P P PP P P P P PP P PP Sbjct: 310 PNPHIPPAPPNPYIPTAPPNPSIPPAPP--NPSIPPAPPNPSIPPAPP 355 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 51.2 bits (117), Expect = 1e-06 Identities = 33/79 (41%), Positives = 33/79 (41%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G G G G GG G GG R GGE G GG GG GGG G G G Sbjct: 128 GRGGWRGRGGGEGNGAGG-GIGRGGGRGRGGGEGGW--GGRGGNGGGRGGGEGGGGRGRG 184 Query: 749 WXGXXXGGGGXXGGGGRXG 693 G GGGG G GR G Sbjct: 185 TGGGSRGGGGDGRGRGRGG 203 Score = 48.4 bits (110), Expect = 8e-06 Identities = 35/99 (35%), Positives = 35/99 (35%), Gaps = 1/99 (1%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEG-GGGXGXGGXXGXXGGGXGGXGGGXXXGXXXX 764 G G GG G GG G G GGG G GG G GGG GG GG G Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGR-GGGEGGWGGRGGNGGGRG 173 Query: 763 XXXXXXXXXXWXGGXXXGGGGGXGXXVXXGGEXXRAXAE 647 GG GGGG G GG R E Sbjct: 174 GGEGGGGRGRGTGGGSR-GGGGDGRGRGRGGTEERTRIE 211 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG R GGE G GGG G GG G GG G G GG GGGGR G Sbjct: 130 GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGG--RGGNGGGRGGGEGGGGRGRGTG 186 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -1 Query: 917 GXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGX 738 G G G GG GG GG G GGG G GG G GG G Sbjct: 118 GWRRGGVQRGGRGGWRGRGGGEGNGAGGGIG-RGGGRGRGGGEGGWGGRGGNGGGRGGGE 176 Query: 737 XXGGGGXXGGGGRXGXXG 684 GG G GGG G G Sbjct: 177 GGGGRGRGTGGGSRGGGG 194 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G G G G G G GGG G G G GG GG G G G Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGG-XXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G GG G G GGG G G GGG G GGG G G GG GG Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGG 174 Query: 707 GGRXGXXG 684 G G G Sbjct: 175 GEGGGGRG 182 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/79 (36%), Positives = 32/79 (40%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P +PPPP PPPP PPP P PPP P PPP PP +PP + P Sbjct: 677 PIQTMVPPPP--PPPP--------PPPPP---PPPPPPQPSTPPPPPPSTPPVQQSGAPG 723 Query: 865 XXPXPPXPXXXXXPXXXPP 921 P P PP Sbjct: 724 SPAGSPSGTSAGNPQQQPP 742 Score = 46.8 bits (106), Expect = 3e-05 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P PPP PP PPP PP PP + PP P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PPP P PPP PP P PP PP + P P P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Query: 937 P 939 P Sbjct: 744 P 744 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/66 (37%), Positives = 26/66 (39%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPPP PPPP +TPPP P PP P P SP P Sbjct: 686 PPPPPPPPPPPPPPPPQP----STPPPPP---PSTPPVQQSGAPGSPAGSPSGTSAGNPQ 738 Query: 865 XXPXPP 882 P PP Sbjct: 739 QQPPPP 744 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P T P PPPPP PP P PPP P PPP P PP Sbjct: 677 PIQTMVPPPPPPPPPPPP----------------PPPPPPPQPSTPPPPPPSTPPVQQSG 720 Query: 855 PPSXXPXXXXPXPPXXPXXXPPXP 926 P P PP P Sbjct: 721 APGSPAGSPSGTSAGNPQQQPPPP 744 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 PPP PP PPP PP PP P P PP P P P Sbjct: 683 PPPPPPPPPPPPPPPPPP----PQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G GG GG G GG GG G G GG GG G G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNN 621 Query: 766 XXXXXXXXXXXWXGGXXXGGGGG 698 GG GG G Sbjct: 622 NGGNTGGNNGGNTGGNNNGGNSG 644 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P PP P PPPP P P PP P PP P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPP---PPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXX 755 GG G G GG G GG G G GG GG GG G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNN 621 Query: 754 XXXXXXXWXGGXXXG--GGGGXGXXVXXGGE 668 GG G GG G GE Sbjct: 622 NGGNTGGNNGGNTGGNNNGGNSGGSNSHSGE 652 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 P PPPPP PP PP P P P P PP P P P P Sbjct: 677 PIQTMVPPPPP--PPPPPPPPPPPPPPQPSTPPPPPPSTP-PVQQSGAPGSP 725 Score = 35.1 bits (77), Expect = 0.084 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 1/93 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG-XGGGXXXGXX 770 G GG GG G G G GG G GG GG GG Sbjct: 501 GENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNN 560 Query: 769 XXXXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 GG G GG GG Sbjct: 561 NGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGG 593 Score = 35.1 bits (77), Expect = 0.084 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G G G G G G GG GG G G GG G G Sbjct: 549 GSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG-GNTGGNNNGGNTGGNNGGN 607 Query: 749 WXGXXXGG--GGXXGGGGRXGXXG 684 G GG GG GG G G Sbjct: 608 TGGNNNGGNTGGNNNGGNTGGNNG 631 Score = 35.1 bits (77), Expect = 0.084 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P PPPPP PP S P P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPS-TPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQP 741 Query: 852 PPPSXXP 872 PPP P Sbjct: 742 PPPGQLP 748 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/85 (24%), Positives = 21/85 (24%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G G GG G GG G G Sbjct: 447 GDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 506 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 G G GG GG G Sbjct: 507 NNNGGNNNGGNNNGGNNNGGNNNGG 531 Score = 34.3 bits (75), Expect = 0.15 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 6/94 (6%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGX-GXXXGGRXXRXGGEXGGX--GGGXGGXGGGXXXX 777 G G GG G GG G GG GG GG GG GG GG Sbjct: 553 GGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGN--NNGGNTGGNNNGGNTGGNNGGNTGG 610 Query: 776 XXGXGG-GVVWXGXXXGG--GGXXGGGGRXGXXG 684 G G G GG GG GG G G Sbjct: 611 NNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/85 (24%), Positives = 21/85 (24%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G G GG G GG G G Sbjct: 442 GGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNG 501 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 G G GG GG G Sbjct: 502 ENNGGNNNGGNNNGGNNNGGNNNGG 526 Score = 33.1 bits (72), Expect = 0.34 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 3/91 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G GG GG GG G G Sbjct: 539 GGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 598 Query: 767 XGGGVVWXGXXXGG---GGXXGGGGRXGXXG 684 GG G GG GG GG G G Sbjct: 599 NTGGN--NGGNTGGNNNGGNTGGNNNGGNTG 627 Score = 32.7 bits (71), Expect = 0.45 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G G GG GG G G G GG G Sbjct: 520 GGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNG-GNTGGNNNGGNTGGNN 578 Query: 758 GVVWXGXXXGG--GGXXGGGGRXGXXG 684 G G GG GG GG G G Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNG 605 Score = 31.9 bits (69), Expect = 0.78 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 5/93 (5%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGG--XGGGXGGXGGGXXXXX 774 G G G G GG GG GG GG GG GG Sbjct: 526 GNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGN 585 Query: 773 XGXG--GGVVWXGXXXG-GGGXXGGGGRXGXXG 684 G GG G G GG GG G G Sbjct: 586 NNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTG 618 Score = 31.5 bits (68), Expect = 1.0 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGX-GXXXXGXXEGGGGXGX--GGXXGXXGGGX--GGXGGG 788 G GG GG G GG G G GG G GG G GG GG GG Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 2/90 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXX--RXGGEXGGXGGGXGGXGGGXXXXX 774 G G GG G G G GG GG G G GG Sbjct: 467 GNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGG 526 Query: 773 XGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G GG G G G Sbjct: 527 NNNGGNN--NGENNGGNNNGGNNGGSNNGG 554 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/84 (26%), Positives = 22/84 (26%), Gaps = 3/84 (3%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG G G G G G G GG G GG Sbjct: 413 GNSNNGGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGG 472 Query: 755 VVWXGXXXGG---GGXXGGGGRXG 693 G GG GG GG G Sbjct: 473 NNNGGNNNGGNNNGGNNNGGNNNG 496 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/78 (24%), Positives = 21/78 (26%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PP +P P P P PP P P + P P Sbjct: 707 PPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLPGQQPGQAGGRPGLNPQGQ 766 Query: 883 XPXXXXXPXXXPPXXPXP 936 P P P Sbjct: 767 VTTATTAPSSNPNESTTP 784 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/79 (27%), Positives = 22/79 (27%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXG 741 GG G G G GG GG G G GG G G G Sbjct: 505 GGNNNGGNNNGGNNNGGNNNGGN--NNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNG 562 Query: 740 XXXGGGGXXGGGGRXGXXG 684 GG GG G G Sbjct: 563 GNTGGNN--NGGNTGGNNG 579 Score = 29.1 bits (62), Expect = 5.5 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 2/87 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGG--XGGGXGGXGGGXXXXX 774 G G GG G G G GG GG GG GG G G Sbjct: 511 GNNNGGNNNGGNNNG-GNNNGGNNNGENNGGN--NNGGNNGGSNNGGNDGSNNNGGNTGG 567 Query: 773 XGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GG G G G GG G Sbjct: 568 NNNGGNT--GGNNGGNTGGNNNGGNTG 592 Score = 28.7 bits (61), Expect = 7.3 Identities = 21/88 (23%), Positives = 21/88 (23%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G G GG G GG G G Sbjct: 477 GNNNGGNNNGGNNNGGNNNGGNNN-GENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNG 535 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GG G G G Sbjct: 536 ENNGGNNNGGNNGGSNNGGNDGSNNNGG 563 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/87 (24%), Positives = 21/87 (24%), Gaps = 2/87 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G GG G G GG G Sbjct: 424 GNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGN 483 Query: 767 XGGGVVWXGXXXGG--GGXXGGGGRXG 693 GG G GG G GG G Sbjct: 484 NNGGNNNGGNNNGGNNNGENNGGNNNG 510 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/85 (23%), Positives = 20/85 (23%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G G G G GG G GG Sbjct: 433 GGNNGGNNNGGNTGG--DNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNN 490 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG GG G Sbjct: 491 GGNNNGGNNNGENNGGNNNGGNNNG 515 Score = 28.3 bits (60), Expect = 9.6 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G G G GG G GG G G Sbjct: 482 GNNNGGNNNGGNNNGGNNN-GENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG 540 Query: 767 XGGGVVWXGXXXGGG-GXXGGGGRXG 693 G G GG G GG G Sbjct: 541 NNNGGNNGGSNNGGNDGSNNNGGNTG 566 Score = 28.3 bits (60), Expect = 9.6 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = -1 Query: 947 GXXGGXGXXG--GXXXGXXXXXGXGGXGXXXGGRXXRXGGEX-GGXGGG---XGGXGGGX 786 G GG G G G G G GG GG GG G GG Sbjct: 545 GNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN 604 Query: 785 XXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G G G GG GG G Sbjct: 605 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 635 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/59 (44%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXX--GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G G G G G G +GGGG G GG G GG GG GGG G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 Score = 44.8 bits (101), Expect = 1e-04 Identities = 32/79 (40%), Positives = 32/79 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G G GG GG GG G G GG GG G GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG---GGCDGGGGDGDGGGGGDGD----GGGG 100 Query: 758 GVVWXGXXXGGGGXXGGGG 702 G GGGG GGGG Sbjct: 101 G-------DGGGGGDGGGG 112 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G GG GG+ G GGG G GGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 767 XGGG 756 GGG Sbjct: 108 DGGG 111 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXG 711 G GG G G G G G GGG GG G G GGG GGGG G Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG-----DGDGGGGGDG 103 Query: 710 GGGRXGXXG 684 GGG G G Sbjct: 104 GGGGDGGGG 112 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G GG G G GGG G GG G GGG G GG G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGG----GGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G G G GG G +GGGG G G GGG G GGG Sbjct: 60 GDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGX---GGGVVWXGXXXGGGGXXGGGGRXGXXG 684 + GG GGG GG G G G GG G GGG GGGG G G Sbjct: 46 DSGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGG 98 Score = 35.9 bits (79), Expect = 0.048 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG G+ G G GGG G GG G GGG GGGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGD----GDGGGGGDGDGGGGGDG 103 Query: 692 XXG 684 G Sbjct: 104 GGG 106 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/59 (44%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXX--GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G G G G G G +GGGG G GG G GG GG GGG G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 Score = 44.8 bits (101), Expect = 1e-04 Identities = 32/79 (40%), Positives = 32/79 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G G GG GG GG G G GG GG G GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG---GGCDGGGGDGDGGGGGDGD----GGGG 115 Query: 758 GVVWXGXXXGGGGXXGGGG 702 G GGGG GGGG Sbjct: 116 G-------DGGGGGDGGGG 127 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G GG GG+ G GGG G GGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 767 XGGG 756 GGG Sbjct: 123 DGGG 126 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXG 711 G GG G G G G G GGG GG G G GGG GGGG G Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGG-----DGDGGGGGDG 118 Query: 710 GGGRXGXXG 684 GGG G G Sbjct: 119 GGGGDGGGG 127 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G GG G G GGG G GG G GGG G GG G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGG----GGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G G G GG G +GGGG G G GGG G GGG Sbjct: 75 GDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGX---GGGVVWXGXXXGGGGXXGGGGRXGXXG 684 + GG GGG GG G G G GG G GGG GGGG G G Sbjct: 61 DSGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGG 113 Score = 35.9 bits (79), Expect = 0.048 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG G+ G G GGG G GG G GGG GGGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGD----GDGGGGGDGDGGGGGDG 118 Query: 692 XXG 684 G Sbjct: 119 GGG 121 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 50.0 bits (114), Expect = 3e-06 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 7/87 (8%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXP------PPXPPXPPPXPPXSPPXRXXLPP 861 LP PP PP P P PP P P PP PP PP PP PP P Sbjct: 258 LPSPPRYPPSPLRYP--PIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQ 315 Query: 862 XXXPXPPXP-XXXXXPXXXPPXXPXPP 939 PP P P PP P P Sbjct: 316 SPLRYPPSPIRYPPLPSRYPPSPPRYP 342 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXP---PPXPPXPPPXPPXSPPXRXXLPPXXXPX 876 PP P PP P P P P PP P PP PP P PP Sbjct: 296 PPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRY 355 Query: 877 PPXPXXXXXPXXXPPXXPXP 936 PP P P P P P Sbjct: 356 PPSP--PRYPSSHPRYPPSP 373 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 12/97 (12%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP-PXXXPXH-----TTPPPXPXXXXXXPPPXPPXPP-----PXPPX 831 P P PP P PP P P T PP P PP P PP P P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPL 318 Query: 832 S-PPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP PP PP P P P P PP Sbjct: 319 RYPPSPIRYPPLPSRYPPSP--PRYPSSHPRYPPSPP 353 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 8/71 (11%) Frame = +1 Query: 694 PXLPP-PPXXPP-PPXXXPXHTTPPPXPXXXXXXP---PPXPPXPPPXPPXSP---PXRX 849 P PP PP PP PP P P P P PP P PP PP P P Sbjct: 290 PRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYP 349 Query: 850 XLPPXXXPXPP 882 PP P PP Sbjct: 350 PSPPRYPPSPP 360 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/95 (29%), Positives = 29/95 (30%), Gaps = 10/95 (10%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-----PPXPPXPPPXXPXFPPXPX--P 851 P PP P PP P P PP PP PP +P P P Sbjct: 262 PRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYP 321 Query: 852 PPPS---XXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P P P P P Sbjct: 322 PSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYP 356 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PP PP +PP P PP PP PP PP P PP Sbjct: 314 PQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPS-PPRYPPSPPRYPSSHPRYPPS 372 Query: 865 XXPXPPXP 888 P P Sbjct: 373 PLRYLPSP 380 Score = 36.3 bits (80), Expect = 0.036 Identities = 27/93 (29%), Positives = 28/93 (30%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 SPP P PP P P PP PP P P +PP P Sbjct: 295 SPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPS-PPRYPSSHPRYPPSPP 353 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPS P P PP P P P Sbjct: 354 RYPPSP------PRYPSSHPRYPPSPLRYLPSP 380 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXX 881 PP P PP S P PP PP PP P +P PPS P Sbjct: 321 PPSPIRYPPLPSRYPPSPPRYPSSHPRY--PPSPPRYPPSPPRYPSSHPRYPPS--PLRY 376 Query: 882 XPXPPXXP 905 P P P Sbjct: 377 LPSPIRYP 384 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/78 (28%), Positives = 22/78 (28%), Gaps = 3/78 (3%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXP---PPXPPXPPPXPPXSPPXRXXLPPXXXPX 876 PP P PP H PP P P PP P P PP PP Sbjct: 352 PPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPSHLRYPPSSLRY 411 Query: 877 PPXPXXXXXPXXXPPXXP 930 P P P P Sbjct: 412 LPSHLRYPPPPLRYPPSP 429 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +1 Query: 703 PPPPXXPPPPXXXPX-HTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 P P PP P P H PP P PP PP P P PP P P Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRY----PPSPPRYPSSHPRYPPSPLRYLPSPIRYP 384 Query: 880 P 882 P Sbjct: 385 P 385 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXP-PXXXPXXP 940 P P PP P PP PP P P P PP P P P P P Sbjct: 322 PSPIRYPPLPSRYPPSPPRY----PSSHPRYPPSPPRYPPSPPRYPSSHPRYP 370 Score = 30.3 bits (65), Expect = 2.4 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 13/89 (14%) Frame = +1 Query: 694 PXLPP-PPXXPPPPXXXPX-HTTPPPXPXXXXXXP---PPX--------PPXPPPXPPXS 834 P PP PP PP P P H PP P P PP P PP Sbjct: 346 PRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPSHLRYP 405 Query: 835 PPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 P LP PP P PP Sbjct: 406 PSSLRYLPSHLRYPPPPLRYPPSPLRYPP 434 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXP 910 P PP PP PP P P P P PP P Sbjct: 350 PSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYP 391 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 2/84 (2%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXX--PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P PP PP P H PP P P PP P R LP Sbjct: 395 PRYPPSHLRYPPSSLRYLPSHLRYPPPPLRYPPSPLRYPPSLSPICHHLFAIRLHLPAIR 454 Query: 868 XPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P Sbjct: 455 HQLPLYPPSPARYATLPPRFPPSP 478 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXXPXFPPXPX--PPPPSXXPXXXXPXPPXXPXXXPPXP-XPPXP 941 P P +PP P PP P P P P P P PP P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSP 303 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +1 Query: 694 PXLPP--PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P PP P P P P + PP PP P P P PP P Sbjct: 335 PPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSH 394 Query: 868 XPXPP 882 PP Sbjct: 395 PRYPP 399 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 785 PXPPXXP---PPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXP 910 P PP P P P PP P P P P P P P P Sbjct: 336 PSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 49.6 bits (113), Expect = 4e-06 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 1/86 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXG-GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXX 771 G G G G G G G G G GG G + G GGG G GGG Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG G GG GGG G Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG G+ GG GG GG GG Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGG------GDDGGDGGDDGGGSGGGGDDGGS 200 Query: 767 XGGGVVWXGXXXGGG 723 GGG G GG Sbjct: 201 DGGGGGNDGGRDDGG 215 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 49.6 bits (113), Expect = 4e-06 Identities = 32/87 (36%), Positives = 33/87 (37%), Gaps = 5/87 (5%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPX-----PPPXPPXSPPXRXXLP 858 P LPP P P P + TPPP P P P PP PPP P PP Sbjct: 298 PPLPPSRDQAPAPPP-PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 356 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP Sbjct: 357 P-----PPPPGRAPQPLGGPP--PPPP 376 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/94 (30%), Positives = 29/94 (30%), Gaps = 2/94 (2%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P PPPP PP PP PP P P P Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP--PTSTRSAPP 358 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXP--XPPXPXP 947 PPP P PP P PP PP P P Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PPPPP PP + P PPP PP P P P P Sbjct: 332 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Query: 852 PPPSXXP 872 PP P Sbjct: 392 PPAMDKP 398 Score = 46.4 bits (105), Expect = 3e-05 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 12/97 (12%) Frame = +1 Query: 685 PXXPXLPPPP-----XXPPPPXXXPXH----TTPPPXPXXXXXXPPPXPP---XPPPXPP 828 P PPPP PPPP P T PP P P P PP PPP PP Sbjct: 264 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Query: 829 XSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P P P P PP Sbjct: 324 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP--XPPXPPPXPPXSPPXRXXLP 858 P P PP PPPP PPP PPP PP P PP R Sbjct: 310 PPPPLNATPP--PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP-Q 366 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P P PP Sbjct: 367 PLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 10/92 (10%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR------XXL 855 P PP PPPP P PP P P PPP P PP L Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 300 Query: 856 PP--XXXPXPPXPXXXXXPXXXP--PXXPXPP 939 PP P PP P P P P PP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 332 Score = 45.2 bits (102), Expect = 8e-05 Identities = 31/102 (30%), Positives = 32/102 (31%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP 815 P HS PP + P PPPPP P S P PPP PP Sbjct: 196 PPPHSRHGSAPPPPERSSGP-PPPPPGRGP---SQRSLAPPPTGSSRPLPAPPPGENRPP 251 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPPP P P P PP P P Sbjct: 252 PPMRGPTSGGEPPPPKNAP----PPPKRGSSNPPPPPTRGPP 289 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 11/79 (13%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXPXHTTPPPX---PXXXXXXPPPXP---PXPPPXPPXSPPXRX 849 PPPP PPPP PPP P PPP P P P PP PP R Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Query: 850 XLPPXXXPXPPXPXXXXXP 906 P PP P P Sbjct: 380 PPSGKINPPPPPPPAMDKP 398 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 6/84 (7%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXP-XHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 PPPP PPPP P + PP P P P P PP P PP Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 265 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 PP P PP P Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/72 (30%), Positives = 24/72 (33%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXX 903 PPP H + PP P PPP P P +PP P P PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAP-PPGENRPPP 252 Query: 904 PXXXPPXXPXPP 939 P P PP Sbjct: 253 PMRGPTSGGEPP 264 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 7/91 (7%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTT---PPPXPXXXXXXPPPXPP----XPPPXPPXSPPX 843 P P PPP P T+ PPP P PP P PPP P P Sbjct: 167 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQ 226 Query: 844 RXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 R PP P P PP P Sbjct: 227 RSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 257 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/93 (26%), Positives = 26/93 (27%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 +PP PPPPP P PP PP P P P Sbjct: 309 APPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 368 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP PP P P P Sbjct: 369 GGPPPPPPGR---RPPSGKINPPPPPPPAMDKP 398 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTT--PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPX 876 PPPP P +T PPP P PP PP PP PP R P Sbjct: 174 PPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPP-PPERSSGPPPPPPGRG---PSQRSL 229 Query: 877 PPXPXXXXXPXXXPP---XXPXPP 939 P P P PP P PP Sbjct: 230 APPPTGSSRPLPAPPPGENRPPPP 253 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/101 (30%), Positives = 31/101 (30%), Gaps = 16/101 (15%) Frame = +1 Query: 685 PXXPXLPPPP-XXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP------XPPXSPPX 843 P PPPP P P PP P PPP P PP P PP Sbjct: 244 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPS 303 Query: 844 RXXLPP-----XXXPXPPXPXXXXXPXXXPP----XXPXPP 939 R P P PP P P PP P PP Sbjct: 304 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP 344 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 7/76 (9%) Frame = +1 Query: 700 LPPPPXX-----PPPPXXXPXHTT--PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 LPPPP PPPP P +T PP P P PP PPP P + P Sbjct: 330 LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP-GRRPPSGKINPP 388 Query: 859 PXXXPXPPXPXXXXXP 906 P P P P Sbjct: 389 PPPPPAMDKPSFTNGP 404 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PPP P PPP P PP P + P PP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKP---SQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPP 196 Query: 883 XPXXXXXPXXXPP---XXPXPP 939 P PP P PP Sbjct: 197 PPHSRHGSAPPPPERSSGPPPP 218 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 PPP PP PP P P P PPPS Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPPS 26 Score = 37.1 bits (82), Expect = 0.021 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 4/95 (4%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXP---PXPPPXXPXFPPXP 845 P PPPPP PP S PPP PPP P P Sbjct: 160 PSQGSF--PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPP--PERSSGP 215 Query: 846 XPPPPSXXPXXXXPXPPXXPXXXP-PXPXPPXPXP 947 PPPP P PP P P P P P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRP 250 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/92 (28%), Positives = 26/92 (28%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PPPPP PP S PP PP PP Sbjct: 271 PPPKRGSSNPPPPPTRGPPSNSFTTQG-------------PPLPPSRDQAPAPPPPLNAT 317 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P PP P PP P Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP 349 Score = 35.1 bits (77), Expect = 0.084 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 PPPPP P P PPP P P PPP P Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSS-RPLPAPPPGENRPPP 252 Query: 879 XXPXPPXXPXXXPPXPXPPXP 941 P PP PP P Sbjct: 253 PMRGPTSGGEPPPPKNAPPPP 273 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PP PPPP P PPP P PPP P PP Sbjct: 134 PPKNSSPPPPFGAP----PPPDRGGQLAKKPSQGSFPPPPPMGKPP 175 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPPP PPPP PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 3/85 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHT---TPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P PPP P P T P P P PPP P PP PP Sbjct: 215 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 274 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 275 RGSSNPPPPPTRGPPSNSFTTQGPP 299 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXS 856 P PP PPPPP P P P S Sbjct: 4 PPPPPGPPPPPSAPSGPVKPPPSS 27 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXP 871 PPPPP P PP P P+ P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P L PPP P P P P PP P PP PP R P Sbjct: 224 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNP- 280 Query: 865 XXPXPP--XPXXXXXPXXXPPXXP 930 P PP P PP P Sbjct: 281 --PPPPTRGPPSNSFTTQGPPLPP 302 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP PP PP P PP P PP P P P Sbjct: 121 PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL 855 PP P PPP P P PP S R L Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPPSSKNRGAL 33 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPP 896 P PP P PPPP P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 859 GGGGXGXGGXXGXXGGGXGGXGGG 788 GGGG GG GGG GG G Sbjct: 77 GGGGFSGGGGGSMGGGGLGGLFAG 100 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 785 PXPPXXPPPPPX-XPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P P PPPP PP P + P PP P P P Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 182 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 785 PXPPXXPPPPP--XXPPXPPXXXPXSPLXXPXXXPXPPXXXP 904 P PP P P PP PP P S P P P P Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PP P P P P P+ P PP P PP P Sbjct: 231 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 280 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 49.6 bits (113), Expect = 4e-06 Identities = 32/87 (36%), Positives = 33/87 (37%), Gaps = 5/87 (5%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPX-----PPPXPPXSPPXRXXLP 858 P LPP P P P + TPPP P P P PP PPP P PP Sbjct: 210 PPLPPSRDQAPAPPP-PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 268 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP Sbjct: 269 P-----PPPPGRAPQPLGGPP--PPPP 288 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/94 (30%), Positives = 29/94 (30%), Gaps = 2/94 (2%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P PPPP PP PP PP P P P Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP--PTSTRSAPP 270 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXP--XPPXPXP 947 PPP P PP P PP PP P P Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PPPPP PP + P PPP PP P P P P Sbjct: 244 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Query: 852 PPPSXXP 872 PP P Sbjct: 304 PPAMDKP 310 Score = 46.4 bits (105), Expect = 3e-05 Identities = 31/97 (31%), Positives = 31/97 (31%), Gaps = 12/97 (12%) Frame = +1 Query: 685 PXXPXLPPPP-----XXPPPPXXXPXH----TTPPPXPXXXXXXPPPXPP---XPPPXPP 828 P PPPP PPPP P T PP P P P PP PPP PP Sbjct: 176 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Query: 829 XSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P P P P PP Sbjct: 236 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP--XPPXPPPXPPXSPPXRXXLP 858 P P PP PPPP PPP PPP PP P PP R Sbjct: 222 PPPPLNATPP--PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP-Q 278 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P P P PP Sbjct: 279 PLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 10/92 (10%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR------XXL 855 P PP PPPP P PP P P PPP P PP L Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 212 Query: 856 PP--XXXPXPPXPXXXXXPXXXP--PXXPXPP 939 PP P PP P P P P PP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 244 Score = 45.2 bits (102), Expect = 8e-05 Identities = 31/102 (30%), Positives = 32/102 (31%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP 815 P HS PP + P PPPPP P S P PPP PP Sbjct: 108 PPPHSRHGSAPPPPERSSGP-PPPPPGRGP---SQRSLAPPPTGSSRPLPAPPPGENRPP 163 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPPP P P P PP P P Sbjct: 164 PPMRGPTSGGEPPPPKNAP----PPPKRGSSNPPPPPTRGPP 201 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 11/79 (13%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXPXHTTPPPX---PXXXXXXPPPXP---PXPPPXPPXSPPXRX 849 PPPP PPPP PPP P PPP P P P PP PP R Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Query: 850 XLPPXXXPXPPXPXXXXXP 906 P PP P P Sbjct: 292 PPSGKINPPPPPPPAMDKP 310 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 6/84 (7%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXP-XHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 PPPP PPPP P + PP P P P P PP P PP Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 177 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 PP P PP P Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/72 (30%), Positives = 24/72 (33%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXX 903 PPP H + PP P PPP P P +PP P P PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAP-PPGENRPPP 164 Query: 904 PXXXPPXXPXPP 939 P P PP Sbjct: 165 PMRGPTSGGEPP 176 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 7/91 (7%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTT---PPPXPXXXXXXPPPXPP----XPPPXPPXSPPX 843 P P PPP P T+ PPP P PP P PPP P P Sbjct: 79 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQ 138 Query: 844 RXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 R PP P P PP P Sbjct: 139 RSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 169 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/93 (26%), Positives = 26/93 (27%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 +PP PPPPP P PP PP P P P Sbjct: 221 APPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 280 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP PP P P P Sbjct: 281 GGPPPPPPGR---RPPSGKINPPPPPPPAMDKP 310 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTT--PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPX 876 PPPP P +T PPP P PP PP PP PP R P Sbjct: 86 PPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPP-PPERSSGPPPPPPGRG---PSQRSL 141 Query: 877 PPXPXXXXXPXXXPP---XXPXPP 939 P P P PP P PP Sbjct: 142 APPPTGSSRPLPAPPPGENRPPPP 165 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/101 (30%), Positives = 31/101 (30%), Gaps = 16/101 (15%) Frame = +1 Query: 685 PXXPXLPPPP-XXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP------XPPXSPPX 843 P PPPP P P PP P PPP P PP P PP Sbjct: 156 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPS 215 Query: 844 RXXLPP-----XXXPXPPXPXXXXXPXXXPP----XXPXPP 939 R P P PP P P PP P PP Sbjct: 216 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP 256 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 7/76 (9%) Frame = +1 Query: 700 LPPPPXX-----PPPPXXXPXHTT--PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 LPPPP PPPP P +T PP P P PP PPP P + P Sbjct: 242 LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP-GRRPPSGKINPP 300 Query: 859 PXXXPXPPXPXXXXXP 906 P P P P Sbjct: 301 PPPPPAMDKPSFTNGP 316 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PPP P PPP P PP P + P PP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKP---SQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPP 108 Query: 883 XPXXXXXPXXXPP---XXPXPP 939 P PP P PP Sbjct: 109 PPHSRHGSAPPPPERSSGPPPP 130 Score = 37.1 bits (82), Expect = 0.021 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 4/95 (4%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXP---PXPPPXXPXFPPXP 845 P PPPPP PP S PPP PPP P P Sbjct: 72 PSQGSF--PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPP--PERSSGP 127 Query: 846 XPPPPSXXPXXXXPXPPXXPXXXP-PXPXPPXPXP 947 PPPP P PP P P P P P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRP 162 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/92 (28%), Positives = 26/92 (28%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PPPPP PP S PP PP PP Sbjct: 183 PPPKRGSSNPPPPPTRGPPSNSFTTQG-------------PPLPPSRDQAPAPPPPLNAT 229 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P PP P PP P Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP 261 Score = 35.1 bits (77), Expect = 0.084 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 PPPPP P P PPP P P PPP P Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSS-RPLPAPPPGENRPPP 164 Query: 879 XXPXPPXXPXXXPPXPXPPXP 941 P PP PP P Sbjct: 165 PMRGPTSGGEPPPPKNAPPPP 185 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PP PPPP P PPP P PPP P PP Sbjct: 46 PPKNSSPPPPFGAP----PPPDRGGQLAKKPSQGSFPPPPPMGKPP 87 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 3/85 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHT---TPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P PPP P P T P P P PPP P PP PP Sbjct: 127 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 186 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 187 RGSSNPPPPPTRGPPSNSFTTQGPP 211 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P L PPP P P P P PP P PP PP R P Sbjct: 136 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNP- 192 Query: 865 XXPXPP--XPXXXXXPXXXPPXXP 930 P PP P PP P Sbjct: 193 --PPPPTRGPPSNSFTTQGPPLPP 214 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP PP PP P PP P PP P P P Sbjct: 33 PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 785 PXPPXXPPPPPX-XPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P P PPPP PP P + P PP P P P Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKP 94 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 785 PXPPXXPPPPP--XXPPXPPXXXPXSPLXXPXXXPXPPXXXP 904 P PP P P PP PP P S P P P P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PP P P P P P+ P PP P PP P Sbjct: 143 PPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNP 192 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 49.6 bits (113), Expect = 4e-06 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXG-GXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GG G G GGGG G G G G GGG GGG G Sbjct: 187 GYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 49.2 bits (112), Expect = 5e-06 Identities = 31/66 (46%), Positives = 31/66 (46%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G GG R GG GG GG GG GGG G G G G GGGG GGGG Sbjct: 179 GGGGSQGGG--YRSGG--GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGY-GGGG 233 Query: 701 RXGXXG 684 R G Sbjct: 234 RHDYGG 239 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/71 (39%), Positives = 29/71 (40%) Frame = -1 Query: 905 GXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGG 726 G G G G GG GG GG GGG GG G G G GGG G GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGY--GGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Query: 725 GGXXGGGGRXG 693 GGG + G Sbjct: 234 RHDYGGGSKGG 244 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/66 (39%), Positives = 27/66 (40%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXG 741 GG G G GG G GG GG G G G GG GGG G GG + G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Query: 740 XXXGGG 723 GGG Sbjct: 240 GSKGGG 245 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG GG GG G G G GG G GG G G G G GGG G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGG--XGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 GG GG GG GG GGG GG GGG G GGG G GGG GG Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG-GGGYGGGGRHDYGGGSKGG 244 Query: 707 G 705 G Sbjct: 245 G 245 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G G GG GG GG GG GG GG G GGG GGGG GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGG-----GYGGG-------RGGGGYGGG 223 Query: 707 GGRXGXXG 684 G G G Sbjct: 224 HGGGGYGG 231 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PPPP T P P P PP P P P PP P PP Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPP 977 Query: 883 XP 888 P Sbjct: 978 PP 979 Score = 46.8 bits (106), Expect = 3e-05 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 4/88 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP-PPXPXXXXXXPPPXPP---XPPPXPPXSPPXRXX 852 P P PPP PPPP T P P P P PP PPP P P Sbjct: 913 PLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPP-PP 971 Query: 853 LPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 LPP P PP P PP P Sbjct: 972 LPP--LPPPPPPVQTTTAPTLPPASCMP 997 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/93 (31%), Positives = 31/93 (33%), Gaps = 14/93 (15%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP--------PXSPPXRXXL- 855 P PP P TTP P P PP P PPP P P +P + Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTT 947 Query: 856 -----PPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP PP P P PP P PP Sbjct: 948 RPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 7/60 (11%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPP-------PSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP PP PPP P P P P+ P PP PP P PP P P Sbjct: 919 PPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPP 978 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/89 (31%), Positives = 29/89 (32%), Gaps = 4/89 (4%) Frame = +3 Query: 672 PPXXTXXPXPPPP-PXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXP- 845 PP P PPPP P PP + P P PPP PP P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP----PPPTSALPPPIPA 964 Query: 846 --XPPPPSXXPXXXXPXPPXXPXXXPPXP 926 PPPP P P PP P P Sbjct: 965 TQVPPPP--LPPLPPPPPPVQTTTAPTLP 991 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 6/95 (6%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP------ 836 P T P P P P + P PPP P P P Sbjct: 888 PKTTTAP-PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQAST 946 Query: 837 PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPPP+ P P PP P PP P Sbjct: 947 TRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +3 Query: 777 PXXXPPPXPPXPPP-XXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P PPP PP P PPPP P P P P P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPI-QTTRPTVPTTPTTQASTTRPTPPPP 954 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P + P P PP PP P PP P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 49.2 bits (112), Expect = 5e-06 Identities = 30/84 (35%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP +P R +PP Sbjct: 449 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGAPHQR--VPPPG 505 Query: 868 XPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 506 APHPRVPPPGAPHPRVPPPGAPHP 529 Score = 49.2 bits (112), Expect = 5e-06 Identities = 30/84 (35%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP +P R +PP Sbjct: 469 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRV-PPPGAPHPRVPPPGAPHPR--VPPPG 525 Query: 868 XPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 526 APHPRVPPPGAPHPRVPPPGAPHP 549 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +1 Query: 706 PPPXXPPP--PXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PPP P P P H PP PPP P P PP +P R P P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRV 561 Query: 880 PXPXXXXXPXXXPPXXPXP 936 P P P PP P P Sbjct: 562 P-PPGAPHPRVPPPGAPHP 579 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/84 (34%), Positives = 32/84 (38%), Gaps = 3/84 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP +P R +PP Sbjct: 479 PRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRV-PPPGAPHPRVPPPGAPHPR--VPPPG 535 Query: 868 XPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P PP P Sbjct: 536 APHPRVPPPGAPHPRVPPPGASHP 559 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/82 (35%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP +P R +PP Sbjct: 529 PRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRV-PPPGAPHPRVPPPGAPHPR--VPPPG 585 Query: 868 XPXP-PXPXXXXXPXXXPPXXP 930 P P P P PP P Sbjct: 586 TPHPRVPPPGAPHPKVPPPGAP 607 Score = 46.0 bits (104), Expect = 4e-05 Identities = 29/84 (34%), Positives = 32/84 (38%), Gaps = 3/84 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP + R +PP Sbjct: 509 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGASHPR--VPPPG 565 Query: 868 XPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 566 APHPRVPPPGAPHPRVPPPGTPHP 589 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/82 (35%), Positives = 31/82 (37%), Gaps = 5/82 (6%) Frame = +1 Query: 706 PPPXXP----PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PPP P PPP PP P PPP P P PP +P R +PP P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHPR--VPPPGAP 547 Query: 874 XP-PXPXXXXXPXXXPPXXPXP 936 P P P PP P P Sbjct: 548 HPRVPPPGASHPRVPPPGAPHP 569 Score = 45.2 bits (102), Expect = 8e-05 Identities = 29/92 (31%), Positives = 30/92 (32%), Gaps = 11/92 (11%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXP-----------XXXXXXPPPXPPXPPPXPPXSPP 840 P + PPP PPPP P PP P PPP P PP P Sbjct: 319 PGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGEPY 378 Query: 841 XRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 R P P P P P PP P P Sbjct: 379 ARMPPPGATHPRVPSP-GASHPRVPPPGAPHP 409 Score = 44.8 bits (101), Expect = 1e-04 Identities = 29/82 (35%), Positives = 31/82 (37%), Gaps = 5/82 (6%) Frame = +1 Query: 706 PPPXXP----PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PPP P PPP PP P PPP P P PP +P R +PP P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAP--HPRVPPPGAPHPRFPPPGAPHPR--VPPPGAP 457 Query: 874 XP-PXPXXXXXPXXXPPXXPXP 936 P P P PP P P Sbjct: 458 HPRVPPPGAPHPRVPPPGAPHP 479 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P P PPP P P P P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRV 501 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P P PPP P P P P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRV 521 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/84 (33%), Positives = 30/84 (35%), Gaps = 3/84 (3%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +P P P PP P PPP PP P P PP +P R PP Sbjct: 389 PRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPP-GAPHPRVPPPGAPHPR--FPPPG 445 Query: 868 XPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 446 APHPRVPPPGAPHPRVPPPGAPHP 469 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/80 (33%), Positives = 29/80 (36%), Gaps = 1/80 (1%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P P P PPP P PP PPP P P PP +P R +PP P Sbjct: 423 PPGAPHPRVPPPGAPHPRF---PPPGAPHPRVPPPGAPHPRVPPPGAPHPR--VPPPGAP 477 Query: 874 XP-PXPXXXXXPXXXPPXXP 930 P P P PP P Sbjct: 478 HPRVPPPGAPHPRVPPPGAP 497 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/81 (33%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +1 Query: 706 PPPXXP----PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PPP P PPP PP P PPP P P PP +P R PP Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHPRVP-PPGAPH 498 Query: 874 XPPXPXXXXXPXXXPPXXPXP 936 P P PP P P Sbjct: 499 QRVPPPGAPHPRVPPPGAPHP 519 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/82 (34%), Positives = 30/82 (36%), Gaps = 5/82 (6%) Frame = +1 Query: 706 PPPXXP----PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PPP P PPP PP P PPP P PP +P R +PP P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHQRVPPPGAPHPR--VPPPGAP 517 Query: 874 XP-PXPXXXXXPXXXPPXXPXP 936 P P P PP P P Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHP 539 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PPP P P PP +P R Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV-PPPGAPHPKVPPPGAPYQRLPYSGAY 617 Query: 868 XP--XPPXPXXXXXPXXXPPXXPXP 936 P PP P P P P Sbjct: 618 HPRLPPPGPPYQRVPPPGAPIQRVP 642 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 1/92 (1%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPXP 851 P P PPP P P PPP P P P P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 482 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP + P P P P P P P P Sbjct: 483 PPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P P PPP P P P Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRV 571 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P PPP P P P P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRV 461 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP PPP P P PPP P P P P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 551 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/82 (28%), Positives = 25/82 (30%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P + PP PPP P PPP PP P PP +PP Sbjct: 308 PRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPP---- 363 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 364 -PDGPYTRALPPGEPYARMPPP 384 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P LPP P H P PPP P P PP + R P Sbjct: 367 PYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGA 426 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 427 PHPRVP-PPGAPHPRFPPPGAPHP 449 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 3/95 (3%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P P PPP P P P P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV 591 Query: 849 PPPPSXXPXXXXPXPP--XXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 592 PPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGP 626 Score = 36.7 bits (81), Expect = 0.027 Identities = 31/110 (28%), Positives = 32/110 (29%), Gaps = 8/110 (7%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPP--PXPPX 809 P S +R P PP P P P PP P P Sbjct: 352 PYPGSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRV 411 Query: 810 PPPXX------PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP P P P PPP P P PP P P P P P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPG-APHPRFP-PPGAPHPRVPPPGAPHP 459 Score = 36.7 bits (81), Expect = 0.027 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXP--PXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXP 845 PP P PPP P P P PPP P P P P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRV-PPPGAPHPRVPPPGAPHPR 580 Query: 846 XPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP + P P P P P P Sbjct: 581 VPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLP 612 Score = 35.9 bits (79), Expect = 0.048 Identities = 25/84 (29%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P +PPP P PP P PPP PP P P P +PP Sbjct: 549 PRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP---HPRVPPPGAPHPKVPPPG 605 Query: 868 XPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P PP Sbjct: 606 APYQRLPYSGAYHPRLPP--PGPP 627 Score = 35.5 bits (78), Expect = 0.063 Identities = 24/93 (25%), Positives = 25/93 (26%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP P PPP P P PPP P P P P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRL 611 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P + P P PP P P P P Sbjct: 612 PYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLP 644 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/97 (25%), Positives = 26/97 (26%), Gaps = 5/97 (5%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXP-----PXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP 836 PP P PPPP P P PPP P P P Sbjct: 318 PPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGEP 377 Query: 837 PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P Sbjct: 378 YARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/85 (27%), Positives = 25/85 (29%), Gaps = 4/85 (4%) Frame = +1 Query: 694 PXLPP-PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL---PP 861 P +P P P P +P PP P PPP P PP L PP Sbjct: 664 PRIPTVTPRVPISPLAESPQKSPLEPVTATQMTPPVAPRVPPPSPRMQPPASGFLRMHPP 723 Query: 862 XXXPXPPXPXXXXXPXXXPPXXPXP 936 P P PP P Sbjct: 724 ASGFPRMHPPASGFPRMHPPASGPP 748 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 P T P P P PP P P PP R PP P P Sbjct: 287 PESDMSYQTAPGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQG 346 Query: 907 XXXPPXXP 930 P P Sbjct: 347 ASQTPPYP 354 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 5/62 (8%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXP----PPPSXXPXXXXPXPPXXPXXXPPX-PXPPXP 941 P P P P P PP P PPP P P PP P P P Sbjct: 383 PPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFP 442 Query: 942 XP 947 P Sbjct: 443 PP 444 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P P PPP + P P P P P P P Sbjct: 382 PPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPP 434 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 49.2 bits (112), Expect = 5e-06 Identities = 24/46 (52%), Positives = 25/46 (54%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG GG GGG G GGG G GGG + G GGGG GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGG--FGGGGGGGGGFGGGGG 124 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 GGR GG G GGG GG GGG G GGG G GGGG G G R Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG----GGGFGGGGGGGFGSR 130 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/84 (35%), Positives = 31/84 (36%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 G GGGG G GG G GGG GG GGG G GG GGGGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG----------------GGFGGGGGGGFG 128 Query: 691 XXVXXGGEXXRAXAEWAXGYXWVG 620 A + G W G Sbjct: 129 SRARPASSNSNACRHFLKGNCWHG 152 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 925 GXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G GG G G GGGG G GG G GG GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXG 803 G G G G GG G GG G G GGGG G GG G GGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGF-GGGGGGGGGFGGGGGGGFG 128 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 GG G G G GG G G GGG G GG G GGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG 794 G GG GG G GG G G GGG G GG G GGG GG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG--GFGGGGGGGFG 128 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/61 (44%), Positives = 27/61 (44%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G GG GG GG GGG GG GG G GGG G GGGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGG------GGGGG---GGFGGGGGGGFGSRA 131 Query: 701 R 699 R Sbjct: 132 R 132 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG GG GG GG GGG G GGG G GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G GG GG G GGG G GGG G GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/81 (33%), Positives = 29/81 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P +PP PP P PPP PPP PP PP P +PP P Sbjct: 225 PMIPPVGMLGHPPMGAP----PPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMP 280 Query: 874 XPPXPXXXXXPXXXPPXXPXP 936 PP P P P P P Sbjct: 281 -PPMPPGGMPPNMEQPPPPPP 300 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPP PPP P P P P P PPP PP P PP Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGM---PPPGMPPPMPPGGMPPNMEQPP- 296 Query: 865 XXPXPP 882 P PP Sbjct: 297 --PPPP 300 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP + P PPP PP P PPP PP P PP P Sbjct: 242 PPPHSMPPPGMPPPGMMPPP-GFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPP---P 297 Query: 852 PPPSXXPXXXXPXPP 896 PPPS PP Sbjct: 298 PPPSSGVSNSGMMPP 312 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/85 (30%), Positives = 28/85 (32%), Gaps = 6/85 (7%) Frame = +1 Query: 694 PXLPPPPXXPPP---PXXXPXHT-TPPPX--PXXXXXXPPPXPPXPPPXPPXSPPXRXXL 855 P +PPP PPP P P PPP P PP PPP PP S + Sbjct: 250 PGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGM 309 Query: 856 PPXXXPXPPXPXXXXXPXXXPPXXP 930 P P P P P Sbjct: 310 MPPHMQNPQHMGHQMMPGMMPQQFP 334 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP PPP P PP PPP P P P P P PP P Sbjct: 237 PMGAPPPPHSMPPPGMP--PPGMMPPP--GFPPMGMPGMGGMPPPGMPPPMPPGGMP 289 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +3 Query: 777 PXXXPPPXPPXP---PPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP P P PP P FPP P P PP P PP P P P Sbjct: 244 PHSMPPPGMPPPGMMPP--PGFPPMGMPGMGGMPPPGM--PPPMPPGGMPPNMEQPPPPP 299 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P P P P PPP P P P P P P P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP 284 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 48.8 bits (111), Expect = 6e-06 Identities = 40/142 (28%), Positives = 41/142 (28%), Gaps = 4/142 (2%) Frame = +3 Query: 534 PVVWSPKDXGPKAXTSDSKQRSAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPP-- 707 P P P S + I LP P A SA PP T P P Sbjct: 310 PAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAP-----PPWATSNSGPKPLM 364 Query: 708 -PPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX-PPXPPPXXPXFPPXPXPPPPSXXPXXX 881 P PP P P P PPP P P PP P Sbjct: 365 STPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYI 424 Query: 882 XPXPPXXPXXXPPXPXPPXPXP 947 P PP P PP P PP P Sbjct: 425 PPPPPGFPQFQPPPPPPPSDAP 446 Score = 42.3 bits (95), Expect = 6e-04 Identities = 35/121 (28%), Positives = 38/121 (31%) Frame = +3 Query: 525 TFLPVVWSPKDXGPKAXTSDSKQRSAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPP 704 T P W+ + GPK S QR P P PP P Sbjct: 347 TSAPPPWATSNSGPKPLMSTPVQR--------PPGMRPPGAGNGPGGPPPPWSKPGGILP 398 Query: 705 PPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXX 884 PP PP + P P P PPP P F P P PPPPS P Sbjct: 399 GPPPPGPPMLNMAPSIP-------PWQTTPGYIPPPPPGFPQFQPPP-PPPPSDAPWIER 450 Query: 885 P 887 P Sbjct: 451 P 451 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +1 Query: 703 PPPPXXPPP----PXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXX 870 PPPP P P P PPP PPP P PP + P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMST 366 Query: 871 PXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPP 389 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 PPP P P PP PPPP P P P PP Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPP 351 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +1 Query: 706 PPPXXPP----PPXXXPXHTTP---PPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 PPP PP P P TTP PP P PP PP P P P R Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAPWIERPKR 453 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 PPP P PP PPP P PP P P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 48.8 bits (111), Expect = 6e-06 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP-XP-XXXXXXPPPXPPXPPP--XPPXSPPXRXXLPP 861 P P P PP P T PPP P PPP PP PP PP PP PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPID---PP 203 Query: 862 XXXPXPPXPXXXXXPXXXPPXXPXP 936 P PP P PP P P Sbjct: 204 RTQP-PPIPPIDPPRTQPPPIFPQP 227 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 8/76 (10%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXP--XXXXXXPPPXPP------XPPPXPPXSPP 840 P P PP PP P T PPP P PPP PP PPP PP PP Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Query: 841 XRXXLPPXXXPXPPXP 888 PP P P P Sbjct: 217 RTQ--PPPIFPQPTTP 230 Score = 42.3 bits (95), Expect = 6e-04 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 3/96 (3%) Frame = +3 Query: 648 SAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPP--XPPPX 821 SA + P PP PP P PP PP PPP Sbjct: 138 SATTKPVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPI 197 Query: 822 XPXFPPXPXPPP-PSXXPXXXXPXPPXXPXXXPPXP 926 P PP PPP P P P PP P P P Sbjct: 198 PPIDPPRTQPPPIPPIDPPRTQP-PPIFPQPTTPAP 232 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPP--PSXXPXXXXPX-PPXXPXXXPPXPXPPXPXP 947 P P PP P PP PPP P P P PP P P P PP P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Frame = +3 Query: 777 PXXXPPPX----PPX--PPPXXPXFPPXPXPPP-PSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PPP PP PPP P PP PPP P P P P P PP PP Sbjct: 164 PRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP--IPPIDPPRTQPP 221 Query: 936 XPXP 947 P Sbjct: 222 PIFP 225 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 3/84 (3%) Frame = +3 Query: 705 PPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPP-XXPXFPPXPXPP--PPSXXPX 875 P P PP S P P PP PP P P P PP PP P Sbjct: 150 PAPMTLPPI-SPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPP 208 Query: 876 XXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P P P P Sbjct: 209 PIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 28.3 bits (60), Expect = 9.6 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PP P P TT P P P PP PP P P Sbjct: 113 PPCYIPCPTATATTSTTATTPAKTTSATTKPVMTPTTPAPMTLPPISPIDPPRTQPPPIF 172 Query: 886 PXXXXXPXXXPPXXPXPP 939 P P PP P PP Sbjct: 173 P--IDPPRTQPP--PIPP 186 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 48.4 bits (110), Expect = 8e-06 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 PPPP PPPP PPP P PPP PP PPP P Sbjct: 464 PPPPPPPPPP--------PPPPPPPPPPPPPPFPPPPPPTP 496 Score = 48.0 bits (109), Expect = 1e-05 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PPP PP PPP P PP P PPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PP PPP PP PP PP P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXP 887 PPP PP PPP P PP P PPPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PPP PPPP PPP P PPP PP PPP PP PP Sbjct: 464 PPPPPPPPP--------PPPPP------PPPPPPPPPPFPPPPPP 494 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXP 893 P PP PPP P PP P PPPP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 PP P PPPP P P PP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPPP P P PP P PP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 PP P PPP PP PPP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXP 771 P P PPPP PPPP P PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPL 862 P PP PPPPP PP P P +PL Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 806 PPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXP 910 PPPP PP PP P P P P PP P P Sbjct: 464 PPPP--PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXH 750 P P PPPP PPPP P H Sbjct: 477 PPPPPPPPPPPFPPPPPPTPLH 498 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPP 818 +PP P PPPPP PP PPP PP PPP Sbjct: 463 APPPPPPPPPPPPPPPPPPP------------------PPPPPFPPPPPP 494 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 811 PPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PPP PP PP PP P PP P P PP P PP Sbjct: 464 PPPPPPPPPP-----PP---PPPPPP-----PPPPPPFPPPPP 493 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PPPP PPP P PPP PP PPP +PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PP PPP P P PPPP P P PP P P PP P Sbjct: 290 PVPP-PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P PP PP P PP P PPPP P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PP P PP P PP + P P PP PP P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP---PXPPXSPP 840 P PP PPP PPP P PPP PP PP PP PP Sbjct: 290 PVPP--PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPPP P PP P PP P PP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 P P PP PPP P PPP P PPP PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P PP PPP PP P PPPP P PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPP-----PXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 P P P PP PP P PP PP PP P PP P P PP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP 813 P P PPPP P PPP P PP PP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PPP P P PP PPPP P P PP PP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP----PPPPGDGGAPPPPPPP 337 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXP----PXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPP PPP P P PPP PP PP PP P PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP--PPPPP 337 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 P PPPPP P PPP PP PPP P PPPP+ Sbjct: 290 PVPPPPPADGSAPAPPPPPP--------PGGAPPPPPPPPPPPPGDGGAPPPPPPPT 338 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP--XPPXPXP 947 P PPP P P PPPP P P PP P PP PP P P Sbjct: 290 PVPPPP-PADGSAPAPPPP--PPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P PP P PP PP P P P P P P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 609 GDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPP 728 G P P A + PP P PPPPP PP Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 48.4 bits (110), Expect = 8e-06 Identities = 27/65 (41%), Positives = 29/65 (44%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G R + GG GGG G GGG G GG + G GGGG GG Sbjct: 733 GGGGYGGGYNDRRMQQGGYGNRSGGGYRG-GGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Query: 707 GGRXG 693 G R G Sbjct: 792 GHRGG 796 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 4/86 (4%) Frame = -2 Query: 946 GXGXGGXGXG-GXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG---XGGGXXX 779 G G GG G G GG G G GGGG G GG GGG GG GGG Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Query: 778 GXXXXXXXXXXXXXXWXGGXXXGGGG 701 G GG G GG Sbjct: 791 GGHRGGSYSGYRGSYKSGGYGQGSGG 816 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGG--XXXXXXGXGGGVVWXGXXXGGGGXX 714 G GG G GG R GG GG G GG GGG G G G G GG Sbjct: 761 GGGGYGGGGGG--YRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYG 818 Query: 713 GGGG 702 G G Sbjct: 819 QGSG 822 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXG-GXXGXXGGGXGGXGGGXXXGXXXX 764 G GG G GG GGGG G G GG G GG G Sbjct: 706 GYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGY 765 Query: 763 XXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 G GGGG G GG Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 35.1 bits (77), Expect = 0.084 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGG-GVVWXGXXXGGGGXXGGGG 702 + GG GGG G GGG GG G G GGGG GGGG Sbjct: 728 QRGGRGGG--GYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGG 770 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXG-GXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G GG G G G G G G G G G GG G GG Sbjct: 770 GGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = -2 Query: 946 GXGXGGXG--XGGXXXGXXGGXGXXXXGXXEGGGGXGXGG--XXGXXGGGXGGXGGG 788 G G GG G GG G G G G GG G G G G G GG G G Sbjct: 764 GYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 Score = 31.5 bits (68), Expect = 1.0 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGG--XGGXGGGXXXXXXGX 765 GG G GG G G G GG R GG G G GG G G G Sbjct: 763 GGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHR-GGSYSGYRGSYKSGGYGQGSGGYGQGS 821 Query: 764 GG 759 GG Sbjct: 822 GG 823 Score = 28.3 bits (60), Expect = 9.6 Identities = 24/88 (27%), Positives = 25/88 (28%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXX 716 GG G + GG G G G GG GGG GG Sbjct: 705 GGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYND----RRMQQGGYGNRSGGGYR 760 Query: 715 XGGGGGXGXXVXXGGEXXRAXAEWAXGY 632 GGG G G GG GY Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGY 788 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS--PPXRXXLPPXX 867 P PPPP PP P P H T PP PP P P PP P R Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVPSHRHVFHHVT 195 Query: 868 XPXPPXPXXXXXPXXXP 918 P PP P P Sbjct: 196 HPAPPPMQMAPAPCMPP 212 Score = 45.2 bits (102), Expect = 8e-05 Identities = 32/106 (30%), Positives = 34/106 (32%) Frame = +3 Query: 618 LPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPP 797 +PT P A PP P PPPPP PP + P PPP Sbjct: 87 MPTSCAPACPPACCAPPPPPP----PPPPPPPPPPPPPITLHHEQHVVSHVMHP-APPPP 141 Query: 798 XPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP P P P P S P PP P PP P Sbjct: 142 PPPPPAPCMP--PCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVP 185 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP PP PPP PP P PPPP PP P PP P P Sbjct: 97 PACCAPPPPPPPPP-----PPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP-----XRXXLPPXXXPXPPXPXXXXXP 906 P P P PPP PP PPP PP PP + + P PP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPA 147 Query: 907 XXXPP 921 PP Sbjct: 148 PCMPP 152 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P+ P P PP P PP P PP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 32.7 bits (71), Expect = 0.45 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PPPPP PP PP PP P P PP P Sbjct: 136 PAPPPPPPP-PPAPCMPPCHQTQVVHSVQLHASPPGPPPAP--MPAPPPMVVPSHRHVFH 192 Query: 873 XXXXPXPPXXPXXXPPXPXPP 935 P PP P P P P Sbjct: 193 HVTHPAPP--PMQMAPAPCMP 211 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PPPP PPP PPP P PPP PP PP PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PPP PP PPP P PPPP P P PP P P PP Sbjct: 656 PEAGPPPPPP-PPPGGQAGGAPPPPPPP--LPGGAAPPPPPPIGGGAPPPPPP 705 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PPP P PPP P PP P P PP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 35.1 bits (77), Expect = 0.084 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP----PXPPXSPPXRXXLPPXXXPX 876 P PPPP PPP P PP PP PP PP PP PP P Sbjct: 656 PEAGPPPP--------PPPPPGGQAGGAPP-PPPPPLPGGAAPPPPPPIGGGAPP---PP 703 Query: 877 PP 882 PP Sbjct: 704 PP 705 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 7/51 (13%) Frame = +1 Query: 790 PPPXPPXPP-------PXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 PPP PP PP P PP P LP P PP P P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPP-----LPGGAAPPPPPPIGGGAPPPPPP 705 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +3 Query: 684 TXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXP--PXPPPXXPXFPPXPXPPP 857 T PPPPP PP P PPP P PPP P P PPP Sbjct: 655 TPEAGPPPPPP--PPPGG--------QAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Query: 858 P 860 P Sbjct: 705 P 705 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPPP PP P P PP P P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 47.6 bits (108), Expect = 1e-05 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTP-PPXPXXXXXXPPPXPPXPPPXPPXSPPXR-XXLPPXXXPX 876 PPPP P PP P P P P PP P PPP PP LPP P Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPP 421 Query: 877 PP 882 PP Sbjct: 422 PP 423 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 694 PXLPPPPXXP----PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P +PPP P PPP P + PP P PPP P PP P P Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPP-PTMIQTLPPPSVPPPPIGVPNRP 430 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 10/61 (16%) Frame = +3 Query: 789 PPPXPPXPPPXXPXF----------PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPX 938 PPP P PPP P P PPPP P PP PP PP Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPP 422 Query: 939 P 941 P Sbjct: 423 P 423 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 8/74 (10%) Frame = +1 Query: 685 PXXPXLP-PPPXXP-------PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P +P PPP P PPP P PPP PP PP PP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPL-----IPPPQASIPPPTMIQTLPP 416 Query: 841 XRXXLPPXXXPXPP 882 PP P P Sbjct: 417 PSVPPPPIGVPNRP 430 Score = 33.5 bits (73), Expect = 0.26 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGG------EXGGXGGGXGGXGGGXXXX 777 GG G GG G GG GG E GG GG GG Sbjct: 2261 GGRGGKGGVVFESVGGINPMNFGASAGGGLYSDGGASPGDFETGGKSFLNGGEGGESRAG 2320 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGGG 702 G GG GGGG GGG Sbjct: 2321 PVGGFGGGGSSRIRPGGGGGYSGGG 2345 Score = 31.9 bits (69), Expect = 0.78 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 2/89 (2%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP PPPP PP PP P PPP PP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQ 412 Query: 852 --PPPSXXPXXXXPXPPXXPXXXPPXPXP 932 PPPS P PP P P Sbjct: 413 TLPPPS------VPPPPIGVPNRPSVLYP 435 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPP P P P P P P P P P PP P P P Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNP--HVPPPMIGPVTVPPPPLIPPP 401 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PPP P PP P +P P P P PP P P Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP 815 P A A PP PPPP PP S PPP P PP Sbjct: 371 PPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMI-------QTLPPPSVPPPP 423 Query: 816 PXXPXFPPXPXP 851 P P P Sbjct: 424 IGVPNRPSVLYP 435 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 46.8 bits (106), Expect = 3e-05 Identities = 29/89 (32%), Positives = 31/89 (34%), Gaps = 5/89 (5%) Frame = +1 Query: 685 PXXPXLPPPPXX-----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRX 849 P P + PPP PPPP H+ P P PP P P PP PP Sbjct: 2133 PARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSP----LGAPPSVPPPMGAPPSGPPP-M 2187 Query: 850 XLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PP P P P PP P P Sbjct: 2188 GAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 36.3 bits (80), Expect = 0.036 Identities = 24/96 (25%), Positives = 25/96 (26%) Frame = +3 Query: 660 RXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPP 839 R +PP P P PP S P PP P Sbjct: 2120 RYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGA 2179 Query: 840 XPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP P P P PP PP P Sbjct: 2180 PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 35.9 bits (79), Expect = 0.048 Identities = 28/97 (28%), Positives = 29/97 (29%) Frame = +3 Query: 645 HSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXX 824 + A AR P PPP P S P PP P PP Sbjct: 2130 YGAPARPAMGPPPMGSSRYGPPPPMGPARHS--------PSGPSPLGAPPSVP--PPMGA 2179 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P PPS P P P PP PP Sbjct: 2180 PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 35.5 bits (78), Expect = 0.063 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP + PPPP S P PP PP P P PP Sbjct: 2141 PPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP-PMGAPPSGPPPMGT 2199 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXP 926 PP P P P P P Sbjct: 2200 PPSGHPPMGAPPMGPPPSGSHSPAP 2224 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPP--PXPPXPPPXPPXSPPXR 846 P + PP PPP P + PPP PP P PPP SP R Sbjct: 2175 PPMGAPPSGPPPMGAPP--SGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAPR 2225 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/78 (25%), Positives = 21/78 (26%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PPP P PP PP P P P +PP P Sbjct: 2124 PPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSG 2183 Query: 886 PXXXXXPXXXPPXXPXPP 939 P P PP PP Sbjct: 2184 PPPMGAPPSGPPPMGTPP 2201 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P + P PPPP P PPP P PPP PP PP P PP Sbjct: 546 PAVTPSEEPPPPP---PGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P P PPP P PPP PP P PP PP PP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPP--GVDIPPPLPPSEDPKPPPPPPE----PPEECPPPP 590 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +3 Query: 777 PXXXPPPXPPX---PPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P PPP PP PPP P P P PPPP P P PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPE-PPEECPPPPP 591 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXP 916 P PPPPP PP P P P PP P P P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P P PP P P P PPS P P PP P PP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDP-KPPPPPPEPPEECPPPP 590 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 813 PPXXPXFPPXPXPPPPSXXPXXXXPXPP-XXPXXXPPXPXPPXPXP 947 P P P PPPP P PP P PP P PP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECP 587 Score = 35.1 bits (77), Expect = 0.084 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PPP PP LPP P PP P P P P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPP---PLPPSEDPKPPPP-----PPEPPEECPPPP 590 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PPP PP PPP P PP P PPPP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 42.3 bits (95), Expect = 6e-04 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP 860 PPP PP PPP PP P PPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 +PPPP PPPP P +PPP PP PP PPP P Sbjct: 1156 IPPPPPPPPPPP--PSSPSPPP---------PPPPPPPPPTP 1186 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PP PP PPP P P P PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 P PPP PP P P PP P PPPP+ Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PP PPP P PP PP P PP P Sbjct: 1159 PPPPPPPPPPSSPSPPP-----PPPPPPPPPTP 1186 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P P P PP PPP PP +P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P PPPP P P PP P PP P PP P Sbjct: 1157 PPPPPPPPP---PPPSSPSPPPPP---PPPPPPPTP 1186 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP 813 P PPPP PPP P PPP P PPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSP----PPPPP------PPPPPPTP 1186 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PPP P PPP P PPP PP PP Sbjct: 1157 PPPPPPPPP--PPPSSPSPPPPPPPPPP 1182 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXP 904 PPPPP PP P P SP P P PP P Sbjct: 1157 PPPPPPPPPPP----PSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.084 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PP P PP P PPP PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 35.1 bits (77), Expect = 0.084 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P P PP PPP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PPP P P PP PPP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 P PPP P P P P PP P PP P+ Sbjct: 1160 PPPPPPPPPSSPSPPPPP-PPPPPPPTPT 1187 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 844 RXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 R +PP P PP P P PP P PP Sbjct: 1153 RDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPPP P P PP P PP P PP P P Sbjct: 1157 PPPPPPPP----PPPPSSPSPPPPPP-PPPPPP 1184 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXP 771 P P PPPP P P P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTT 756 P P P PP PPPP P TT Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTPTT 1188 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTT 756 P PPPP PPPP P TT Sbjct: 1167 PPSSPSPPPPPPPPPPPPTPTTTT 1190 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTT 756 P P PPPP PPPP TT Sbjct: 1168 PSSPSPPPPPPPPPPPPTPTTTTT 1191 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 827 PXPPXXXPXSPLXXPXXXPXPPXXXPXPXP 916 P PP P P P P PP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP + P PPPPP PP Sbjct: 1166 PPPSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 1164 PPPPPSSPSPPPPPPPPPP 1182 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGX-GXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GG G G GGGG G GG G GGG GGG G Sbjct: 95 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYG-GGRGGGYGGGRRDYGGGSKGG 151 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXG--GXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG GG G G G G GGGG G G G GGG GG GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGX--GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXX 714 G G G G GG GG GG GG GGG G GG G GGG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRD 143 Query: 713 GGGGRXG 693 GGG G Sbjct: 144 YGGGSKG 150 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G G G GG G G GG G G GG GGG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXG 741 G G G G GG GG GG GGG G G G G GGG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSR--GGYGGGRGGGGYGGGRGGGGYGGGRGGG-YGGG 140 Query: 740 XXXGGGGXXGGG 705 GGG GGG Sbjct: 141 RRDYGGGSKGGG 152 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -1 Query: 857 GRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GG G GG GG G GGG G G GG GGGR G G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGS---SRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 2/65 (3%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGG--XGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G GG GG G GG GG GGG G G G G GG GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGG 146 Query: 707 GGRXG 693 G + G Sbjct: 147 GSKGG 151 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGX--GGXGGGXXXXX 774 G G G G G G GGR GG GG GGG GG GGG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGG--GGYGGGRGGGGYGGGRGGGYGGGR 141 Query: 773 XGXGGG 756 GGG Sbjct: 142 RDYGGG 147 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -1 Query: 947 GXXGGX--GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXG 795 G GG G GG G G GG G GGR GG GGG G G Sbjct: 101 GGYGGSSRGGYGGGRGGGGYGGGRGG-GGYGGGRGGGYGGGRRDYGGGSKGGG 152 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 45.6 bits (103), Expect = 6e-05 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXX 755 GG G G G GG G G GGG G G GG GG GGG G Sbjct: 142 GGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGG-GMGGGMGGGMGGGMEGGMGGGMME 200 Query: 754 XXXXXXXWXGGXXXGG-GGGXG 692 GG GG GGG G Sbjct: 201 GMQGMGSMGGGMMGGGMGGGMG 222 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/82 (37%), Positives = 32/82 (39%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G GG G G GG G GG GG GG GG G GGG G GG + Sbjct: 129 GGEGGMGGGMSMGGGMGG-GMSMGG----MGGGMGGMMGG-GSMGGGMMSMAGGGMGGGM 182 Query: 749 WXGXXXGGGGXXGGGGRXGXXG 684 G G G GGG G G Sbjct: 183 GGGMGGGMEGGMGGGMMEGMQG 204 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/85 (34%), Positives = 29/85 (34%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G G GG G GG GGG G G G GG GG GGG G Sbjct: 145 GGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEG--- 201 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXG 692 GG GGG G G Sbjct: 202 ------MQGMGSMGGGMMGGGMGGG 220 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/91 (37%), Positives = 36/91 (39%), Gaps = 11/91 (12%) Frame = -1 Query: 947 GXXGGXGXX--GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGX-------GGXG 795 G GG G GG G GG G GG GG GG GGG G G Sbjct: 152 GMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGG--GMGGGMEGGMGGGMMEGMQGMGSMG 209 Query: 794 GGXXXXXXGXGGGVVWXGXXXGG--GGXXGG 708 GG G GGG+ + G GG GG GG Sbjct: 210 GGMMGG--GMGGGMGFNGMEDGGKEGGMGGG 238 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/94 (32%), Positives = 32/94 (34%), Gaps = 2/94 (2%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G GG GG G GG G GGG G GG GGG GG GG G Sbjct: 137 GMSMGGGMGGGMSMGGMGGG----MGGMMGGGSMG-GGMMSMAGGGMGGGMGGGMGGGME 191 Query: 766 XXXXXXXXXXXWXGGXXXGG--GGGXGXXVXXGG 671 G GG GGG G + G Sbjct: 192 GGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNG 225 Score = 38.7 bits (86), Expect = 0.007 Identities = 25/75 (33%), Positives = 27/75 (36%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G G G G GG GGG G G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG 234 Query: 767 XGGGVVWXGXXXGGG 723 GGG++ G GGG Sbjct: 235 MGGGMLQMGDSNGGG 249 Score = 38.3 bits (85), Expect = 0.009 Identities = 30/87 (34%), Positives = 32/87 (36%), Gaps = 3/87 (3%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGG-EXGGXGGGXGGXGGGXXXXXXGXGG 759 G GG G GG G GG GG GGG GG GG GG Sbjct: 114 GGPSEGGLMQKQFIEGGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGG-----SMGG 168 Query: 758 GVVWXGXXXGGGGXXG--GGGRXGXXG 684 G++ GGG G GGG G G Sbjct: 169 GMMSMAGGGMGGGMGGGMGGGMEGGMG 195 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G GG G GG G GG G GG GG GGG Sbjct: 189 GMEGGMG--GGMMEGMQGMGSMGG-GMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDS 245 Query: 767 XGGGV 753 GGG+ Sbjct: 246 NGGGM 250 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 45.6 bits (103), Expect = 6e-05 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 5/79 (6%) Frame = +1 Query: 700 LPPPPXX-----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 LPPPP P PP P PP P P PPP PP R PP Sbjct: 427 LPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPP 486 Query: 865 XXPXPPXPXXXXXPXXXPP 921 P PP P PP Sbjct: 487 FGPPPPFYRGPPPPRGMPP 505 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXP---XPPPPSXX 869 PPPP PP P PP PP PP PP P PPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGG---PPQLPPNLPP-PPGGMRGMPPPPMGMYPPPRGFP 483 Query: 870 PXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP PP PP P Sbjct: 484 PPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 40.7 bits (91), Expect = 0.002 Identities = 33/104 (31%), Positives = 34/104 (32%), Gaps = 4/104 (3%) Frame = +3 Query: 648 SAXARXXSPPXXTXXPXPPPP----PXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPP 815 +A R PP T P P PP PP P PPP PP Sbjct: 422 AANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMP---PPPMGMYPP 478 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P FPP P PPP P P PP PP P P Sbjct: 479 PRG--FPPPPFGPPP---PFYRGPPPPRG-MPPPPRQRMPSQGP 516 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/72 (36%), Positives = 27/72 (37%), Gaps = 10/72 (13%) Frame = +1 Query: 703 PP--PPXXPPPPXXXPXHTTPPPX--PXXXXXXPPPXPPXPP----PXPPXS--PPXRXX 852 PP PP PPPP PP P PPP P PP P PP PP R Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQR 510 Query: 853 LPPXXXPXPPXP 888 +P P P Sbjct: 511 MPSQGPPQVHYP 522 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/97 (26%), Positives = 28/97 (28%), Gaps = 3/97 (3%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPP-PPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXP 812 P H+ + P PP PP PP P PP P P Sbjct: 430 PPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGP 489 Query: 813 PPXXPXFPPXP--XPPPPSXXPXXXXPXPPXXPXXXP 917 PP PP P PPPP P P P Sbjct: 490 PPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQDP 526 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G G GG GG GG GG GG G GG GG GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Query: 701 RXGXXG 684 G G Sbjct: 823 ASGGAG 828 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/85 (32%), Positives = 29/85 (34%), Gaps = 2/85 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G G G G GG GG GG GG GG GG G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Query: 767 XGGGVVWXGXXXGG--GGXXGGGGR 699 GG G GG GG GG + Sbjct: 823 ASGGA---GSSSGGASGGADGGSNK 844 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G G GG GG GG GG G GG G GG GG G G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSS 830 Query: 698 XG 693 G Sbjct: 831 SG 832 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVW-XGXXXGGGGXXGGGGRX 696 G GG GG GG G GG GG G GG G GG G GG Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Query: 695 GXXG 684 G G Sbjct: 837 GADG 840 Score = 31.9 bits (69), Expect = 0.78 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG---GGXXXG 776 G G G G G GG G G G GG GG GG G GG G Sbjct: 764 GDGHASSGAGSSSGGASGGAG--------GSSGGANGGAGSSSGGASGGAGGSSGGASGG 815 Query: 775 XXXXXXXXXXXXXXWXGGXXXGGGGG 698 GG G GG Sbjct: 816 AGGSSGGASGGAGSSSGGASGGADGG 841 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 GGR R G GG GG GG GGG G GGG + GGGG Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 GG G G GGGG G GG G G GG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGG 127 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 GG G GG G GG G G GGGG G G GGG GG Sbjct: 100 GGRGGGG---GYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = -1 Query: 845 RXGG---EXGGXGGGXG-GXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 R GG E GG GGG G G GGG GGG G G GGGG Sbjct: 91 RGGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 GG G G R GG G GGG G GGG G GGG GGGG Sbjct: 92 GGGGRRERG--GRGGGGGYGGGGGYG--GGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = -2 Query: 925 GXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXG---GGXGGXGGG 788 G G G GG G G GGGG GG G G GG GGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 887 GXGGX---GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG G GG GG GG G GG GGG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGG 138 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 803 GXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG G GGG G GGG GGGG G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 905 GXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G GG G GG GG GGG G GGG G GGG Sbjct: 95 GRRERGGRGGGGGYGGGGGYGGGGR--SYGGG--GGGGGFYQDSYGGGGG 140 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 797 GGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG G GGG G GGGG GGG G G Sbjct: 92 GGGGRRERGGRGGG----GGYGGGGGYGGGGRSYGGGG 125 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 E GG G G GGG G GGG G GGGGG G Sbjct: 89 ENRGGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDS---YGGGGGGG 142 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.2 bits (102), Expect = 8e-05 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 1/93 (1%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXPX 848 PP T P PPP P P PPP P P P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGD 82 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP + P P P P P P P P Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/91 (35%), Positives = 35/91 (38%), Gaps = 16/91 (17%) Frame = +1 Query: 712 PXXPPP----PXXXPXHTT----PPPXPXXXXXXPP--PXPPXPPP-XP-PXSPPXRXXL 855 P PPP P P +TT PPP PP P P PPP P P +PP + Sbjct: 10 PGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPI 69 Query: 856 ---PPXXXPXP-PXPXXXXXPXXXPPXXPXP 936 PP P P P P PP P P Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIP 100 Score = 38.3 bits (85), Expect = 0.009 Identities = 37/126 (29%), Positives = 41/126 (32%), Gaps = 5/126 (3%) Frame = +3 Query: 570 AXTSDSKQRSAMIGDHLPTHX*PXAHSAX-ARXXSPPXXTXXPXPPPPPXXXP--PXXSX 740 A D +A+ GD P P A A P T P PPP P P + Sbjct: 8 AIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNT 67 Query: 741 XXXXXXXXXXXXPXXXPP--PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXX 914 P PP P P PPP P P PPP+ P P PP P Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPI----PGDPPPNT-PIPGDP-PPNTPIQG 121 Query: 915 PPXPXP 932 P P Sbjct: 122 DPLTIP 127 Score = 37.5 bits (83), Expect = 0.016 Identities = 27/90 (30%), Positives = 29/90 (32%), Gaps = 1/90 (1%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXX-PPPXPPXPPPXXPXFPPXP 845 +PP T P PP P P PPP P P P P P Sbjct: 32 APPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPN-TPIP 90 Query: 846 XPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PPP+ P P PP P P P P Sbjct: 91 GNPPPN-TPIPGDP-PPNTPIPGDPPPNTP 118 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 6/68 (8%) Frame = +1 Query: 703 PPPPXXP--PPPXXXPXHTTPPPXPXXXXXXPP--PXPPXPPPXP--PXSPPXRXXLPPX 864 PP P PPP P PPP PP P P PPP P +PP +P Sbjct: 44 PPNTPIPGDPPP-NIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGD 102 Query: 865 XXPXPPXP 888 P P P Sbjct: 103 PPPNTPIP 110 Score = 36.7 bits (81), Expect = 0.027 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 8/67 (11%) Frame = +1 Query: 706 PPPXXP----PPPXXXPXHTTPPPXPXXXXXXPP--PXPPXPPPXP--PXSPPXRXXLPP 861 PPP P PPP P PPP PP P P PPP P PP +P Sbjct: 53 PPPNIPIPGNPPP-NTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPG 111 Query: 862 XXXPXPP 882 P P Sbjct: 112 DPPPNTP 118 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P P PPP + P P P P P P P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPP 65 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPP PP P PP P P P P P P P PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXP--PPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXX 927 TPPP P PPP PP P PP P P P PP P P P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGA 87 Query: 928 PXPP 939 PP Sbjct: 88 IGPP 91 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/90 (31%), Positives = 29/90 (32%), Gaps = 8/90 (8%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPP------PXPPXPP--PXPPXSPPXRX 849 P PPP PPPP P PP P P P PP PP PP +P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAI 88 Query: 850 XLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P PP Sbjct: 89 GPPGLPGPNGVNGPPGELGDMGPPGPPGPP 118 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/89 (29%), Positives = 27/89 (30%), Gaps = 4/89 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPP--PXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P P PP PP PP P P P PP PP P + Sbjct: 66 PGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPG 125 Query: 859 PXXXPXPPXPXXXXXP--XXXPPXXPXPP 939 P P PP P PP PP Sbjct: 126 PPGLPGPPGPAGPPGTNGELGPPGDVGPP 154 Score = 36.7 bits (81), Expect = 0.027 Identities = 28/95 (29%), Positives = 29/95 (30%), Gaps = 4/95 (4%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPP-PXPPXPP--PXXPXFPP 839 +PP PPPPP PP P P P PP PP P P Sbjct: 28 TPPPPPPYEAPPPPP--GPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPA 85 Query: 840 XPXPPPPSXXPXXXXPXPPXXPXXXPP-XPXPPXP 941 PP P P PP P PP P Sbjct: 86 GAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGP 120 Score = 35.5 bits (78), Expect = 0.063 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 792 PPXPPXPP-PXXPXFPPX-PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP PP PP P P PP P PP P+ P P P P P Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGP 160 Score = 35.1 bits (77), Expect = 0.084 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP--PPXPPXSPPXRXXLPPXXXPX 876 P PP PP PP P PP PP P PP P P L P P Sbjct: 859 PGPPGINGPPGQV-GEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGP---PG 914 Query: 877 PPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 915 DAGPAGNTGGAGCQPAPPCPP 935 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P P P P P P PP P P P P PP L Sbjct: 56 PQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG----PPGLPGPNGVNGPPGE--LGDM 109 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP Sbjct: 110 GPPGPPGPPGPQMP-PGPPGLPGPP 133 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP--PXPPXSPPXRXXLPPXXXPXP 879 P P P P P PP P PP PP P P P P L P P Sbjct: 179 PGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 238 Query: 880 P 882 P Sbjct: 239 P 239 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPP 840 P PP PP PP P PP PP PP P P PP Sbjct: 689 PGPPGINGPPGQI-GEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPP 840 P PP PP PP P PP PP PP P P PP Sbjct: 774 PGPPGINGPPGQV-GEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 P P PP P PP P P P P PP PP P Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNP 157 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPX-PXPPPPSXXPXXXXPXPP 896 PP P P P P PP P PP P+ P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP--PXPPXSPPXRXXLP 858 P P P P P P PP P PP PP P P P P L Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLG 316 Query: 859 PXXXPXPP 882 P PP Sbjct: 317 PPGDVGPP 324 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPX-PXPPPPSXXPXXXXPXPP 896 PP P P P P PP P PP P P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 31.1 bits (67), Expect = 1.4 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 15/97 (15%) Frame = +1 Query: 694 PXLPPP--PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP-----------PXS 834 P LP P P PP P P P P PP PP P P Sbjct: 197 PGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAG 256 Query: 835 PPXRXXLP-PXXXPXPPXPXXXXXPXXXP-PXXPXPP 939 P LP P PP P P P P P P Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMP 293 Score = 30.7 bits (66), Expect = 1.8 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 8/87 (9%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP---XPPXPPPXPPXSPPXRXXLPPXXXP 873 PP P PP P P P P PP PP P P P Sbjct: 287 PPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPN 346 Query: 874 XPPXPXXXXXP-----XXXPPXXPXPP 939 P P P PP P PP Sbjct: 347 GQPGPPGINGPPGPLGDVGPPGLPGPP 373 Score = 30.7 bits (66), Expect = 1.8 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 8/87 (9%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP---XPPXPPPXPPXSPPXRXXLPPXXXP 873 PP P PP P P P P PP PP P P P Sbjct: 372 PPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPN 431 Query: 874 XPPXPXXXXXP-----XXXPPXXPXPP 939 P P P PP P PP Sbjct: 432 GQPGPPGINGPPGPLGDVGPPGLPGPP 458 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP-PXSPP-XRXXLPPXXXPX 876 P PP PP PP P PP PP P P P PP L P Sbjct: 434 PGPPGINGPPGPL-GDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAG 492 Query: 877 PP 882 PP Sbjct: 493 PP 494 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP-PXSPP-XRXXLPPXXXPX 876 P PP PP PP P PP PP P P P PP L P Sbjct: 519 PGPPGINGPPGPL-GDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAG 577 Query: 877 PP 882 PP Sbjct: 578 PP 579 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP--PXPPXSPPXRXXLPPXXXPX 876 P PP PP PP P PP PP P P P P L P Sbjct: 349 PGPPGINGPPGPL-GDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVG 407 Query: 877 PP 882 PP Sbjct: 408 PP 409 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 8/87 (9%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP---XPPXPPPXPPXSPPXRXXLPPXXXP 873 PP P PP P P P P PP PP P P P Sbjct: 457 PPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPN 516 Query: 874 XPPXPXXXXXP-----XXXPPXXPXPP 939 P P P PP P PP Sbjct: 517 GQPGPPGINGPPGPLGDVGPPGLPGPP 543 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPP 840 P PP PP P P PP PP PP P P PP Sbjct: 604 PGPPGVNGPPGEI-GEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXX-PPXPXPPXPXP 947 PP PP P P PP P PP P PP P P P Sbjct: 691 PPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXX-PPXPXPPXPXP 947 PP PP P P PP P PP P PP P P P Sbjct: 776 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P PP P P P P P P P P P P P Sbjct: 196 PPGLPGPQGPQMPPGPPGLPGAPGPKGP---PGTNGPLGPPGDVGPPGNPGGP 245 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P PP P P P P P P P P P P P Sbjct: 281 PPGLPGPPGPQMPPGPPGLPGAPGPKGP---PGTNGPLGPPGDVGPPGNPGGP 330 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P PP P P P P P P P P P P P Sbjct: 366 PPGLPGPPGPQMPPGPPGLPGAPGPKGP---PGTNGPLGPPGDVGPPGNPGGP 415 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-PPXPP-XPPPXXPXFPPXPXPPPPSXXP 872 P PP PP P P PP PP P P P P P PP P Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-PPXPP-XPPPXXPXFPPXPXPPPPSXXP 872 P PP PP P P PP PP P P P P P PP P Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P PP P P P P P P P P P P P Sbjct: 451 PPGLPGPPGPQMPPGPPGLPGAPGPNGP---PGINGPLGPPGEAGPPGNPGGP 500 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P PP P P P P P P P P P P P Sbjct: 536 PPGLPGPPGPQMPPGPPGLPGAPGPNGP---PGINGPLGPPGEAGPPGNPGGP 585 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 PP P PP P P P P PP PP P Sbjct: 542 PPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNP 582 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPX--PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP PP P P PP P+ P P P P PP P P P Sbjct: 606 PPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGP-KGPPGPNGPLGPP 658 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PP P P P P PP P PP P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGP 903 Score = 28.7 bits (61), Expect = 7.3 Identities = 31/101 (30%), Positives = 32/101 (31%), Gaps = 16/101 (15%) Frame = +1 Query: 685 PXXPXLP--PPPXXPPP---PXXXPXHTTPPPXPXXXXXXP----PPXPPXP--PPXPP- 828 P P LP P P PP P P PP P P P P P PP Sbjct: 379 PGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPG 438 Query: 829 -XSPP-XRXXLPPXXXPXPPXPXXXXXPXXXP--PXXPXPP 939 PP + P P PP P P P P PP Sbjct: 439 INGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTP-PPXPXXXXXXPPPXPPXPPP 819 PP P PP + P PP P P P P PP Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +3 Query: 792 PPXPPXP--PPXXPXFPPXPXPPPPSXXPXXXXPXPPXX---PXXXPPXPXPP 935 PP PP PP P P PP P P P P P P PP Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 324 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 791 PPXXPPPP-PXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PP P PP P PP PP P +P P P P P P Sbjct: 281 PPGLPGPPGPQMPPGPP-GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 330 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 791 PPXXPPPP-PXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PP P PP P PP PP P +P P P P P P Sbjct: 366 PPGLPGPPGPQMPPGPP-GLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 415 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/64 (37%), Positives = 26/64 (40%), Gaps = 3/64 (4%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXX---PPPXPPXPPPXPPXSPPXRXXLPPXXX 870 LPP P PPP P PPP P PP P P PP + P + LPP Sbjct: 448 LPPLPSDEPPPLP-PDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHS 506 Query: 871 PXPP 882 PP Sbjct: 507 NGPP 510 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 1/83 (1%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPP-PXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXX 870 P LPP PPPP P PP P P P PP P P PP PP Sbjct: 457 PPLPPDEEKPPPP---PAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP-LR 512 Query: 871 PXPPXPXXXXXPXXXPPXXPXPP 939 P P P P P Sbjct: 513 QTPMSSSLSATPVSTPDTTPRTP 535 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 777 PXXXPPPXPPX----PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P PPP PP PPP P PP P PP P PP PP P Sbjct: 452 PSDEPPPLPPDEEKPPPPPAPALPPLPLPP---ELPGSPGDSPPATSPKQPPLP 502 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPP-PSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P PP P P PPP P+ P P P P PP P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQP 499 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 785 PXPPXXPPP--PPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 P P PPP P P PP PL P P P P P P P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP--PPXPXXXXXXPP 795 P P LP PP P P P T+P PP P PP Sbjct: 472 PALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP-XPPXPXXX 897 PP P + P P PP P PP PP PP P PP P Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAAT-LPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 Query: 898 XXP 906 P Sbjct: 482 ELP 484 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPP----PXPPXSPPXRXXLPPXXXP-XPPXP 888 PPP P PPP P P P PP P PP P PP P Sbjct: 456 PPPLPPDEEKPPPP--PAPALPPLPLPPELPGSPGDSPPATSPKQPPLP 502 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +3 Query: 777 PXXXPPPXPPXPP----PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PP PP P P P P P PP+ P P PP P P Sbjct: 461 PDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSP-KQPPLPPKHSNGPPLRQTP 515 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXX 900 PP P P T PP P PPP P PP P S P LPP P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPM--PCSAP----LPPAPAPFSAAPHLPP 801 Query: 901 XPXXXPPXXPXPP 939 P P PP Sbjct: 802 APNISAEPPPPPP 814 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/61 (36%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPP---PXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPX 933 P P PP PP PP P PP +PP +PP P PP P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPP-APPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAA 796 Query: 934 P 936 P Sbjct: 797 P 797 Score = 35.9 bits (79), Expect = 0.048 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +1 Query: 685 PXXPXLPPP--PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P LPP P P PP P PP P P PP P P + P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAP--VPPPCAPIPPMPCSAPLPPAPAPF--SAAPHLPPAP 803 Query: 859 PXXXPXPPXPXXXXXP 906 PP P P Sbjct: 804 NISAEPPPPPPVARKP 819 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP-PXXXPXPPXPXXXXXPXXXPP 921 T PP P P PP PP P PP P P P PP P PP Sbjct: 745 TKSPPAPPLPPKVTPK-PPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPP 801 Score = 35.5 bits (78), Expect = 0.063 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 15/67 (22%) Frame = +3 Query: 792 PPXPPXPP------PXXPXFPP-----XPXPPPPSXXPXXXXPXPPXXPXXXPPXP---- 926 PP PP PP P P F P P PP P P P P PP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISA 807 Query: 927 XPPXPXP 947 PP P P Sbjct: 808 EPPPPPP 814 Score = 34.7 bits (76), Expect = 0.11 Identities = 26/88 (29%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFP-PXPXP 851 P PP PP PP + PP P PPP P P P P Sbjct: 740 PSEVTTKSPPAPPL--PPKVT------------PKPPAPPQFAPVPPPCAPIPPMPCSAP 785 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP+ P P P P P PP Sbjct: 786 LPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P P P P P P P P P P P PP P P Sbjct: 765 PQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARKP 819 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/87 (26%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP--PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P P P P PP P P PP P PPP P P S + L Sbjct: 773 PCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARKPSRSNSTSSQRSLE 832 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P Sbjct: 833 LQSPSREEGPSLITAEPPPPPPVARKP 859 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP P P PP P P P P P P PP P Sbjct: 738 PSPSEVTTKSPPAP-PLPPKVTPKPPAP-PQFAPVPPPCAPIPPMP 781 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/103 (22%), Positives = 25/103 (24%), Gaps = 3/103 (2%) Frame = +3 Query: 636 PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPP---PXPP 806 P SA P + P PPPP P + P P Sbjct: 790 PAPFSAAPHLPPAPNISAEPPPPPPVARKPSRSNSTSSQRSLELQSPSREEGPSLITAEP 849 Query: 807 XPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PPP P PP PP P PP Sbjct: 850 PPPPPVARKPSRSNSTSSQQSIESAPGSPPTGADDFPPPPPPP 892 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/47 (48%), Positives = 24/47 (51%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 + GG GGG GG GGG G GGG GGGG GGGG G Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGG--------GGGGGGGGGGGDG 168 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 GG G G GGGG G GG G GGG GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 892 GXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G GGGG G GG G GGG GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 GG G G GGGG G GG G GGG GG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 904 GXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG 794 G GG G G GGGG G GG G GGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 886 GXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GGGG G GG G GGG GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 +GGGG G GG G GGG GG GGG G Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 824 GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GGG GG GGG G GGG G GGGG GGGG G G Sbjct: 132 GGGGGGGGGGGG------GGGGG----GGGGGGGGGGGGGGGGGGDG 168 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 GG GG GG GGG GG GGG G GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 + GGG G GG G GGG GG GGG G Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 GG G GG GG GG GGG GG GGG G G G Sbjct: 132 GGGGGGGGG-----GGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP PP PP P P PPP P PP P PP PP P P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAP----AAPPAPPFGGPPSAPPPPPAP 208 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPP-PPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP PP P P PP P PP P+ P PP P PP P PP Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP---PPPPAPP 209 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP PP PP P +P PP P P P PP P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P PP P PP PP P P +PP PP P PP P Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGG--PPSAPPPPPAP 208 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPP-PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PP P PP P P PP P PPP P PP PP P PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAP---AAPPAP------PPPGAPAAPPAPPFGGPPSAPPPP 205 Query: 862 XXXPXPP 882 P PP Sbjct: 206 ---PAPP 209 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 785 PXPPXXPPPPPXXPP-XPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P PP P P PP PP P +P P P P P P PP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGP-PSAPPPPPAPP 209 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP--XPPXP 888 P + PP P P P PP PP P PP P PP P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 P P P PP P P P PP P P PP P Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 1/86 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXG-GRXXRXGGEXGGXGGGXGGXGGGXXXXXX 771 G GG G GG G G G GR GG GG GG GG GG Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGG--RFDAS 252 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXG 693 GG G GG G GG+ G Sbjct: 253 NMGGATGGTGNMFGGVGGTAAGGQTG 278 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG G GG GG G GG GG GG GGG G GGG GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G GGR GG GG GGG GG GGG G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGG--GGYGGGRGGG-GGYGGGRRDYGGGSKG 239 Query: 758 G 756 G Sbjct: 240 G 240 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXG--GXGXXXXGXXEGGGGXGXG-GXXGXXGGGXGGXGGGXXXG 776 G GG GG G G G G GGGG G G G G GGG GGG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGX-GXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG 794 G GG G GG G GG G G GGGG G GG GGG G G Sbjct: 191 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG-GYGGGRRDYGGGSKGGG 241 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXGXXV 683 E GGG GG GGG GG G G + GG GGG G G Sbjct: 181 ERGGGGSQGGGYRSGGGGYGGSSRGGYGG--------GRGGGGYGGGRGGGGGYGGGRRD 232 Query: 682 XXGG 671 GG Sbjct: 233 YGGG 236 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 815 GGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G GGG G GG G GG GGGG G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGS-----SRGGYGGGRGGGGYGGGRG 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGX---GXXXGGRXXRXGGEXGGXGGGXGGXGGG 789 G GG GG G G GG G GGR G GG GGG GGG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR-----GGGGGYGGGRRDYGGG 236 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PPPP P PP PP P PP PP P P P P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYP 174 Query: 874 XPPXPXXXXXPXXXPPXXP 930 P P P P P Sbjct: 175 PQPPPQAYPQPGYPPQGYP 193 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP P PP +P PP P P P PP P P P P Sbjct: 115 PTGPPPPYSPIPPQVP--YPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYP 169 Score = 35.9 bits (79), Expect = 0.048 Identities = 25/84 (29%), Positives = 26/84 (30%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P +P P PP PPP PP P P PP PP Sbjct: 124 PIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP---PPQ 180 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 181 AYPQPGYP-----PQGYPPTGPYP 199 Score = 35.1 bits (77), Expect = 0.084 Identities = 25/87 (28%), Positives = 26/87 (29%), Gaps = 4/87 (4%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX--PPXPPPXXPXFPPXPXPPP--PSX 866 PPPP PP PPP PP P P +P P P P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQP-YPAQPYPQQGYPPQ 176 Query: 867 XPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P P Sbjct: 177 PPPQAYPQPGYPPQGYPPTGPYPQTQP 203 Score = 32.7 bits (71), Expect = 0.45 Identities = 29/104 (27%), Positives = 30/104 (28%), Gaps = 2/104 (1%) Frame = +3 Query: 642 AHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPX 821 A A PP T P P PP S P P PPP Sbjct: 94 ASDASTMTTGPP--TSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPG 151 Query: 822 XPXFPPXPXPPPP-SXXPXXXXPXPPXXPXXXPPXP-XPPXPXP 947 +PP PP P P PP P P P PP P Sbjct: 152 --GYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYP 193 Score = 30.7 bits (66), Expect = 1.8 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 11/77 (14%) Frame = +1 Query: 685 PXXPXLPPPPXXPP---PPXXXPXHTTP----PPXPXXXXXXPPPXPPX--PP--PXPPX 831 P PPP PP PP P P PP P P PP PP P P Sbjct: 142 PTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYPQT 201 Query: 832 SPPXRXXLPPXXXPXPP 882 P P P P Sbjct: 202 QPGYAGATPQAHYPQQP 218 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXP-PPXPPXSPPXRXXLPPXXXPXPP-XPXXXXXPXXXPPX 924 TT PP P PP P P PP P PP P P P P Sbjct: 101 TTGPPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPP 160 Query: 925 XPXP 936 P P Sbjct: 161 QPYP 164 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 43.6 bits (98), Expect = 2e-04 Identities = 33/83 (39%), Positives = 33/83 (39%), Gaps = 1/83 (1%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G G G G GG GG GG G G G G GG Sbjct: 199 GGIGGLGGL--GGLGGLGVIGTGVIGAGAVGGLGG-LGGLGGVGGLGGVGGLGGIGGLGG 255 Query: 758 GVVWXGXXXG-GGGXXGGGGRXG 693 G V G G GGG G GG G Sbjct: 256 GGVIAGAGAGIGGGVIGTGGIPG 278 Score = 39.5 bits (88), Expect = 0.004 Identities = 34/96 (35%), Positives = 35/96 (36%), Gaps = 8/96 (8%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXG-GRXXRXGG--EXGGXGGG--XGGXGGGXX 783 G GG G G G G GG G G G GG GG GGG G G G Sbjct: 208 GGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIG 267 Query: 782 XXXXGXGG--GVVWXGXXXGG-GGXXGGGGRXGXXG 684 G GG G + G G G G GG G G Sbjct: 268 GGVIGTGGIPGGILPGLAHGNLAGLLGHGGLAGLAG 303 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/82 (32%), Positives = 28/82 (34%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G G G GG G G G G GG GG GG G G Sbjct: 186 GGTGPVITEVAGLGGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVG 245 Query: 758 GVVWXGXXXGGGGXXGGGGRXG 693 G+ G GGG G G G Sbjct: 246 GLGGIGGLGGGGVIAGAGAGIG 267 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G GG GGG GG GGG G G G GGGG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 + GG GGG GG GGG G G G GGG GGGG Sbjct: 40 DGGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 +GGGG G GG GGG GG GGG G GG G G G G Sbjct: 40 DGGGGGGGGG-----GGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG GG GGG GG GG G G GGGG G G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -2 Query: 904 GXXGGXGXXXXGXXEGGGGXGXGGXXGXXG----GGXGGXGGGXXXG 776 G GG G G GGGG G G G GG GG GGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = -1 Query: 827 GGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGG-----GXXGGGGRXGXXG 684 GG GGG GG GGG GGG G G G GGGG G G Sbjct: 41 GGGGGGGGGGGGG--------GGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/90 (32%), Positives = 30/90 (33%), Gaps = 2/90 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXG--GGXXXXX 774 G GG G G G G G G GG+ GG GG G GG Sbjct: 74 GDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGG 133 Query: 773 XGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGV G GGG G G G G Sbjct: 134 DDDSGGVGDDGGDDGGGDDDSGSGVGGGDG 163 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGX-GGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGX 765 GG G GG G G G G GG G G+ GG GG GG Sbjct: 71 GGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDD 130 Query: 764 GGGVVWXGXXXGGGGXXGGG 705 GGG G GG GGG Sbjct: 131 GGGDDDSGGVGDDGGDDGGG 150 Score = 35.5 bits (78), Expect = 0.063 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 7/86 (8%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGX--GXXXGGRXXRXG-GEXGGXGGGXGGXGG-GXXXXXX 771 GG G GG G G G G GG G G+ GG GGG GG G Sbjct: 54 GGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDD 113 Query: 770 GXG---GGVVWXGXXXGGGGXXGGGG 702 G G G V GGG GG Sbjct: 114 GGGDDDSGGVGDDGGDDGGGDDDSGG 139 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGG--EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 GG G G GG + GG GG GG GG G GG GG Sbjct: 40 GGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGG 99 Query: 707 GGRXGXXG 684 G G Sbjct: 100 DDDSGGVG 107 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPX-FPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PP P PPP PP P PPP P P P PP PP P Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPX----PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPX 944 P P PP P P P PP P PP P+ P P P PP PP Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQ 73 Query: 945 P 947 P Sbjct: 74 P 74 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PP PP P P T P P PPP P PP + P PP P PP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPP--SPNTPPPVTQPPVTQPPVTQPP-VTQPPVTQPPPP 77 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP P P P PP P PP P P P PP P P Sbjct: 33 PPPGTNIPTPPSPNTPP-PVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPPXPP----XSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 T P P P PP P PP +PP PP P P P PP Sbjct: 11 TKRPVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Query: 922 XXPXPP 939 PP Sbjct: 71 VTQPPP 76 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P PPP P P P TPPP PP P P PP P Sbjct: 27 PPKPDTPPPGTNIPTP---PSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPE 83 Query: 865 XXP 873 P Sbjct: 84 QEP 86 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PP P PPP P TPP PP P PP + P PP P Sbjct: 27 PPKPDTPPPGTNIP---TPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +1 Query: 751 TTPPPXPXXXXXX-PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 T PP P PPP P P P +PP PP P P P PP Sbjct: 19 TPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPP-VTQPPVTQPPVTQPPVTQPPVTQPP 75 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXX 903 PP P TPPP P PP P PP + P PP P P Sbjct: 22 PPQPTPPKPDTPPPGTNI------PTPPSPNTPPPVTQPP-VTQPPVTQPPVTQPPVTQP 74 Query: 904 PXXXPPXXPXP 936 P PP P Sbjct: 75 P---PPVTQSP 82 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +3 Query: 684 TXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPP 860 T P P PP P P PP P PP PPPP Sbjct: 19 TPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXP 930 T+ P P P P P PP PP PP PP P PP P PP P Sbjct: 1003 TSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTP---PPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 742 PXHTT--PPPXPXXXXXXPPPXPPXPPP-XPPXSPPXRXXLPPXXXPXPPXP 888 P TT P P P PP PP PPP PP PP PP P P P Sbjct: 1009 PGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP-PTQP 1059 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P P P P P P PP PP PPP P + P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P P PP P PP P P P P P PP P P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP--PTDPPTQP 1059 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP--XPPPXPPXSPP 840 P P P P T PP P PP PP PP PP PP Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P P PP P PP P TPPP PP PP PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPP--TPPPTE------PPTPPPTDPPTQP 1059 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 837 PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P P P PP PP PP P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P PP PP P T PP P PPP P P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 813 PPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P PP P P P P PP PP PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -2 Query: 934 GGXGX-GGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGG 809 GG G GG G GG G G GG G G GGG Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGG 844 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P P P+ P PP P PP P P P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEP 1047 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/69 (39%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGX--GGGXGGXG-GGXXXXXXGXGGGVVWXGXXXGGGGXXG 711 GG G G R GG GG GGG GG G GG GG + GGG G Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGG 201 Query: 710 GGGRXGXXG 684 G G G G Sbjct: 202 GPGYGGGQG 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -1 Query: 947 GXXGGX--GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXX 774 G GG G GG G G GG GG G GG G G GGG Sbjct: 145 GYRGGYRGGYRGGYRGGRDRGGGYGG--GGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGG 202 Query: 773 XGXGGGVVWXGXXXGGGG 720 G GGG + GGGG Sbjct: 203 PGYGGGQGYGSYSGGGGG 220 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G GG G G G GGGG GG G G G GG Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGG 217 Score = 38.7 bits (86), Expect = 0.007 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 G G GG G G G G GGE GG G G G GG GG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGE-GGYGMGGGDYSGGCGYGSSYGGG 196 Query: 758 GVVWXGXXXGGG---GXXGGGG 702 G G GGG G GGG Sbjct: 197 GDYGGGPGYGGGQGYGSYSGGG 218 Score = 38.3 bits (85), Expect = 0.009 Identities = 31/85 (36%), Positives = 31/85 (36%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G G GGR GG GG G G G GGG G Sbjct: 138 GRDGGGGGYRGGYRG-------GYRGGYRGGRDR--GGGYGGGGEGGYGMGGGDYSGGCG 188 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 G G GGG GGG G Sbjct: 189 YGSSY-GGGGDYGGGPGYGGGQGYG 212 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 42.3 bits (95), Expect = 6e-04 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G G GG GR GG GG G G G G Sbjct: 4 GGMAGEGNNSNSTHGWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGM 63 Query: 767 XGGGVVWXGXXXGG--GGXXGGGGRXG 693 GGG+ G GG G GGGG G Sbjct: 64 GGGGMAGEGMGRGGMAGEGMGGGGMAG 90 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/83 (37%), Positives = 32/83 (38%), Gaps = 2/83 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGX-GGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXX 774 G G G GG G G G G GG GE G GG G G GGG Sbjct: 96 GGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGM----AGEGMGRGGMAGEGMGGGGMAGE 151 Query: 773 XGXGGGVVWXGXXXGGGGXXGGG 705 GGG+ G GGGG G G Sbjct: 152 GMGGGGMA--GEGMGGGGIAGEG 172 Score = 39.1 bits (87), Expect = 0.005 Identities = 34/88 (38%), Positives = 35/88 (39%), Gaps = 6/88 (6%) Frame = -1 Query: 938 GGXGXXG-GXXXGXXXXXGXGGXGXXXGGRXXRXG--GEXGGXGGGXG-GXGGGXXXXXX 771 GG G G G G G GG G G R G GE G GG G G G G Sbjct: 84 GGGGMAGEGMGRGGIAGEGMGGGGMAGEGMS-RGGIAGEGMGRGGMAGEGMGRGGMAGEG 142 Query: 770 GXGGGVVWXGXXXGG--GGXXGGGGRXG 693 GGG+ G GG G GGGG G Sbjct: 143 MGGGGMAGEGMGGGGMAGEGMGGGGIAG 170 Score = 38.3 bits (85), Expect = 0.009 Identities = 32/90 (35%), Positives = 33/90 (36%), Gaps = 2/90 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXXX 771 G GG GG G G G GG GE G GG G G GGG Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGM----AGEGMGRGGMAGEGMGGGGMAGEG 92 Query: 770 GXGGGVVWXGXXXGGGGXXGGG-GRXGXXG 684 GG+ G GGGG G G R G G Sbjct: 93 MGRGGIA--GEGMGGGGMAGEGMSRGGIAG 120 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/69 (42%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = -1 Query: 878 GXGXXXGGRXXRXG--GEXGGXGGGXG-GXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G GGR G GE G GG G G GGG GG+ G GGGG G Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMA--GEGMGGGGMAGE 91 Query: 707 G-GRXGXXG 684 G GR G G Sbjct: 92 GMGRGGIAG 100 Score = 37.1 bits (82), Expect = 0.021 Identities = 33/91 (36%), Positives = 34/91 (37%), Gaps = 3/91 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGX-GGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXX 774 G G G GG G G G G GG GE G GG G G GGG Sbjct: 56 GGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGM----AGEGMGRGGIAGEGMGGGGMAGE 111 Query: 773 XGXGGGVVWXGXXXGGGGXXGGG-GRXGXXG 684 GG+ G G GG G G GR G G Sbjct: 112 GMSRGGIA--GEGMGRGGMAGEGMGRGGMAG 140 Score = 34.7 bits (76), Expect = 0.11 Identities = 29/92 (31%), Positives = 30/92 (32%), Gaps = 2/92 (2%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXG-GXGXXXXGXXEGGGGXGXG-GXXGXXGGGXGGXGGGXXXGXXX 767 G G G GG G G G GGG G G G G G G GG GG G Sbjct: 57 GMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGG-GGMAGEGMSR 115 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 G G GG G + GG Sbjct: 116 GGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGG 147 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G G G G GG GR G GG G G GGG Sbjct: 106 GGMAGEGMSRGGIAGEGM--GRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGM 163 Query: 767 XGGGVVWXGXXXG 729 GGG+ G G Sbjct: 164 GGGGIAGEGISGG 176 Score = 33.1 bits (72), Expect = 0.34 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -1 Query: 938 GGXGXXG-GXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXG-GGXXXXXXGX 765 GG G G G G G G G G G GGG G G GG G Sbjct: 104 GGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGM 163 Query: 764 GGGVVWXGXXXGGGGXXG 711 GGG + G GG G Sbjct: 164 GGGGI-AGEGISGGAIFG 180 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PPP P T PPP P P P P PP +PP P P Sbjct: 516 PAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVP 575 Query: 874 XP 879 P Sbjct: 576 TP 577 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 1/85 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P PPP P T PP P P P P PP +PP P Sbjct: 491 PTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSS 550 Query: 865 XXPXP-PXPXXXXXPXXXPPXXPXP 936 P P P P P P Sbjct: 551 GVPTPVTAPPPAPPPSVFAPSSAVP 575 Score = 33.9 bits (74), Expect = 0.19 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 2/95 (2%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX--PPXPPPXXPXFPPX 842 +PP P PPP PP P PPP P P Sbjct: 345 APPPAVPTPATAPPPVVAPPPS----VFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPP 400 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP P P P P P P P Sbjct: 401 PAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTP 435 Score = 33.1 bits (72), Expect = 0.34 Identities = 22/85 (25%), Positives = 23/85 (27%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P + PPP P P P PPP P PPP S P Sbjct: 339 PPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSG-VPTPVA 397 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 398 APPPAPPPSVFAPSSGVPTPVAAPP 422 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PPP P T PPP P P P P PP PP Sbjct: 538 PPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/86 (26%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPP--XPPXPPPXXPXFPPX 842 +P P PPP P P PPP P P P Sbjct: 485 APSSGVPTPVAAPPPSVFAPSSG------VPTTVTAPPAAPPPSVFAPSSGVPTPVTEPP 538 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPP 920 P PPP P P P P PP Sbjct: 539 PAPPPSVFAPSSGVPTPVTAPPPAPP 564 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P PPP P P PPP PP P + P PP Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPP 582 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/83 (26%), Positives = 22/83 (26%), Gaps = 1/83 (1%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP-PXPPPXPPXSPPXRXXLPPXXX 870 P PPP P P PP P P PPP PP S P Sbjct: 417 PVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPV 476 Query: 871 PXPPXPXXXXXPXXXPPXXPXPP 939 PP P PP Sbjct: 477 AAPPPSVFAPSSGVPTPVAAPPP 499 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/87 (25%), Positives = 22/87 (25%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS--PPXRXXLP 858 P PPP P PPP P PP PP S P Sbjct: 473 PTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPT 532 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P P P P Sbjct: 533 PVTEPPPAPPPSVFAPSSGVPTPVTAP 559 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 9/85 (10%) Frame = +1 Query: 712 PXXPPPPXXXPXHT-TPP---PXPXXXXXXPPPXPPXPP--PXPPXSPPXRXXLPPXXXP 873 P P P T TPP P P PPP P P P P +PP P Sbjct: 316 PETEQPQMVAPSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVP 375 Query: 874 XP---PXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 376 TPVKAPPPSVFASSSGVPTPVAAPP 400 Score = 30.7 bits (66), Expect = 1.8 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 10/120 (8%) Frame = +3 Query: 618 LPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPP 797 +PT S A P P P PPP P P Sbjct: 374 VPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVP 433 Query: 798 XPPXPPPXX----------PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P PPP P P P P P P P Sbjct: 434 TPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTP 493 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/86 (24%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +1 Query: 694 PXLPPPPXXPP----PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PPP PP P P PP P P PP + P Sbjct: 395 PVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPV 454 Query: 862 XXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 455 TAPPPAPPPSVFAPSSGVPTPVAAPP 480 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/86 (24%), Positives = 22/86 (25%), Gaps = 4/86 (4%) Frame = +1 Query: 694 PXLPPPPXXPP----PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PPP PP P P PP P P PP +P Sbjct: 453 PVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTV 512 Query: 862 XXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 513 TAPPAAPPPSVFAPSSGVPTPVTEPP 538 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/98 (25%), Positives = 26/98 (26%), Gaps = 7/98 (7%) Frame = +3 Query: 669 SPPXXTXXPXPP-PPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXP---PPXX---P 827 +PP P P PP P PPP PP P P Sbjct: 496 APPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTP 555 Query: 828 XFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PPP P P P P P P Sbjct: 556 VTAPPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 29.9 bits (64), Expect = 3.1 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 4/89 (4%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPP--XPXXXXXXPPPXPPXPPPXPPXSP-PXRXXL 855 P PP PPP T PPP P P P PP S + Sbjct: 333 PVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGV 392 Query: 856 P-PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P P P P P Sbjct: 393 PTPVAAPPPAPPPSVFAPSSGVPTPVAAP 421 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 5/89 (5%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS--PPXRXXLP 858 P PPP PPP P P P P PP S P Sbjct: 375 PTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 434 Query: 859 PXXXPXP---PXPXXXXXPXXXPPXXPXP 936 P P P P PP P P Sbjct: 435 PVAAPPPSVFASSSGVPTPVTAPPPAPPP 463 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/89 (24%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXX--------PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRX 849 P PPP PPP P PP P P PP PP Sbjct: 353 PATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSS 412 Query: 850 XLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 +P PP P P P Sbjct: 413 GVPTPVAAPPPSVFAPSSGVPTPVAAPPP 441 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS--PPXRXXLP 858 P PPP T PPP P P P P PP S P Sbjct: 433 PTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 492 Query: 859 PXXXPXP 879 P P P Sbjct: 493 PVAAPPP 499 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/78 (25%), Positives = 21/78 (26%), Gaps = 3/78 (3%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP---XPPXSPPXRXXLPPXXXPXPP 882 P PP P P PP P PP PP + P PP PP Sbjct: 306 PVTPPMGAQLPETEQPQMVAPSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPP 365 Query: 883 XPXXXXXPXXXPPXXPXP 936 P P P Sbjct: 366 SVFASSSGVPTPVKAPPP 383 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTT--PPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRXXLPPXXX 870 P P PP P H PP P P PP P PP P PP PP Sbjct: 326 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 385 Query: 871 PXPP-XPXXXXXPXXXPPXXPXPP 939 PP P PP P P Sbjct: 386 GRPPHEPGRPPHELGRPPHEPGRP 409 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 6/91 (6%) Frame = +1 Query: 685 PXXPXLPP-PPXXPPPPXXXPXHTT--PPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRX 849 P P PP P PP P H PP P P PP P PP P PP Sbjct: 340 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHEL 399 Query: 850 XLPPXXXPXPP-XPXXXXXPXXXPPXXPXPP 939 PP PP P PP P Sbjct: 400 GRPPHEPGRPPHEPGRLPHEPGRPPYEQRRP 430 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PP P P PP P P PP P PP P PP PP PP Sbjct: 318 PPHDQGRPPYEPGR--PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Query: 883 -XPXXXXXPXXXPPXXPXPP 939 P PP P P Sbjct: 376 HEPGRPPYEPGRPPHEPGRP 395 Score = 36.3 bits (80), Expect = 0.036 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPP-PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS---PPXRXXLPPXXX 870 P PP PP P PP P PP P PP PP PP Sbjct: 298 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 357 Query: 871 PXPP-XPXXXXXPXXXPPXXPXPP 939 PP P PP P P Sbjct: 358 GRPPHEPGRPPHEPGRPPHEPGRP 381 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 5/71 (7%) Frame = +1 Query: 685 PXXPXLPP-----PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRX 849 P P PP PP P P P P PP P PP P P Sbjct: 361 PHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEP 420 Query: 850 XLPPXXXPXPP 882 PP PP Sbjct: 421 GRPPYEQRRPP 431 Score = 33.1 bits (72), Expect = 0.34 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-PPXPPXPPPXXPXFPPXPX--PPPPS 863 P PP P P P PP P PP P PP PP Sbjct: 298 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 357 Query: 864 XXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P P P Sbjct: 358 GRPPHEPGRPPHEPGRPPHEPGRPPYEP 385 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPX--PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP P PP PP P PP P P P P P Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEP 392 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTP----PPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PP P TTP PP P P PP PPP PP +PP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P P P P TTP P PPP PP PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P P PP P P P PPP PPP PP PPP Sbjct: 340 PTTPQPPT-PTTPKTHPQLGPPPP--------PPPPPPTPPP 372 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 794 PXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P P P P P +P P P PP P P PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PP P P PP P PPPP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 795 PXPPXPPPXXPXF--PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PP P P P PP P+ PP P PP P P Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P P P P P P PPPP P P PP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPP---PPTPP 371 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTT--PPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRXXLPPXXX 870 P P PP P H PP P P PP P PP P PP PP Sbjct: 92 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 151 Query: 871 PXPP-XPXXXXXPXXXPPXXPXPP 939 PP P PP P P Sbjct: 152 GRPPHEPGRPPHELGRPPHEPGRP 175 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 6/91 (6%) Frame = +1 Query: 685 PXXPXLPP-PPXXPPPPXXXPXHTT--PPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRX 849 P P PP P PP P H PP P P PP P PP P PP Sbjct: 106 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHEL 165 Query: 850 XLPPXXXPXPP-XPXXXXXPXXXPPXXPXPP 939 PP PP P PP P Sbjct: 166 GRPPHEPGRPPHEPGRLPHEPGRPPYEQRRP 196 Score = 37.5 bits (83), Expect = 0.016 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PP P P PP P P PP P PP P PP PP PP Sbjct: 84 PPHDQGRPPYEPGR--PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Query: 883 -XPXXXXXPXXXPPXXPXPP 939 P PP P P Sbjct: 142 HEPGRPPYEPGRPPHEPGRP 161 Score = 36.3 bits (80), Expect = 0.036 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 5/84 (5%) Frame = +1 Query: 703 PPPPXXPP-PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS---PPXRXXLPPXXX 870 P PP PP P PP P PP P PP PP PP Sbjct: 64 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 123 Query: 871 PXPP-XPXXXXXPXXXPPXXPXPP 939 PP P PP P P Sbjct: 124 GRPPHEPGRPPHEPGRPPHEPGRP 147 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 5/71 (7%) Frame = +1 Query: 685 PXXPXLPP-----PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRX 849 P P PP PP P P P P PP P PP P P Sbjct: 127 PHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEPGRLPHEP 186 Query: 850 XLPPXXXPXPP 882 PP PP Sbjct: 187 GRPPYEQRRPP 197 Score = 33.1 bits (72), Expect = 0.34 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-PPXPPXPPPXXPXFPPXPX--PPPPS 863 P PP P P P PP P PP P PP PP Sbjct: 64 PGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 123 Query: 864 XXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P P P Sbjct: 124 GRPPHEPGRPPHEPGRPPHEPGRPPYEP 151 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPX--PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP P PP PP P PP P P P P P Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEP 158 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG---XGGG 788 G G GG G GG G G + GGG G G GGG GG GGG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/52 (40%), Positives = 23/52 (44%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG+ G GG GG GG GGG+ G GGGG GG G G Sbjct: 55 GGDDCGDDGGAGGGAGGDDDD----GGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 G GG G GG GG GGG G GGG G GGG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGG 809 G G G G G G G +GGGG G G GGG Sbjct: 56 GDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 917 GXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G G GG G GG GG G G G GG GGG GGG V Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGG-ISGCGDGGGG-GGGAGGDDDDGGGGFV 104 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGG 809 G G GG G G G GGGG G GG GGG Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDG-GGGGGGAGGDDDDGGGG 102 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/88 (34%), Positives = 30/88 (34%), Gaps = 9/88 (10%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGX-----GGXGG----GX 786 GG G G G GG G GG G G G GG GG Sbjct: 164 GGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNG 223 Query: 785 XXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G GGGV G GGGG GGG Sbjct: 224 VPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 6/81 (7%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRX--GGEXGGXGGGXG----GXGGGXXXXXXG 768 G G G G GG GG R G GG GGG G G GGG G Sbjct: 190 GSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSG 249 Query: 767 XGGGVVWXGXXXGGGGXXGGG 705 G G GGGG G Sbjct: 250 GGSGNPHYYACGGGGGSYNSG 270 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G G GG GGG G G G GGG G GGG Sbjct: 201 GPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 32.7 bits (71), Expect = 0.45 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 1/91 (1%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXG-GGXGGXGGGXXXGXXXX 764 G GG G GG G +G G GG G G GG GG G Sbjct: 165 GTGGNGATSTSSSHVGGGGGGFY--TDGSSGSNFGGAYGPGGEGGKAFLNGGV--GGRSV 220 Query: 763 XXXXXXXXXXWXGGXXXGGGGGXGXXVXXGG 671 G GGGGG G GG Sbjct: 221 WNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 32.7 bits (71), Expect = 0.45 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGG--XGGXGGGXXXXX 774 G GG G G G G G GG GG GG GGG GG G Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPG-GFGGGGGVWGNGG--GGGGGGGYSGGGSGNPHYYA 259 Query: 773 XGXGGG 756 G GGG Sbjct: 260 CGGGGG 265 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXG----GXXGXXGGGXGGXGGGXXXG 776 G G GG G GG G GGG G G G G G G GG GGG G Sbjct: 410 GTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 35.9 bits (79), Expect = 0.048 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -1 Query: 857 GRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G G GGG G GGG G G G G G GG GGG G G Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGG-GTGSGSTGNGNA-GNGGAGGGGAGGGSTG 467 Score = 35.1 bits (77), Expect = 0.084 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGX-GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 G GG G G G GG GG G G G G G G GG Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Query: 758 GVVWXGXXXGGGGXXGGGGRXG 693 G GGG GG G Sbjct: 460 G--------AGGGSTGGASSSG 473 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXG----GXXGXXGGGXGGXGGGXXXG 776 GG G G G G G G G G G G G G G G GG G Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G G G G G G G GG G GG GG GG Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGG--GGAGGGSTGG 468 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGG 789 G G G G G G G G G G G GG GGG Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPP 840 PPP PP P TPPP P P PP PP PP +PP Sbjct: 122 PPP--PPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPP-PSXXPXXXXPXPPXXPXXXPPXPXP 932 P PPP PP PPP P P P PP P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP-PXXXPXHTTPPPXPXXXXXXPPPXPP 807 P LPPPP PPP P P TP P P PP PP Sbjct: 125 PPTGTLPPPPVTPPPGPETPPPPDTPAP-PVPPTEAPPTAPP 165 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXX-PXPPXPXXXXXPXXXP 918 PPP P P PP +PP PP P PP P P P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 35.1 bits (77), Expect = 0.084 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 PPP P PP PP P PP +PP P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAP-PTAPPTGGSCVSKPP 175 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP-XXXPPXPXPPXPXP 947 PPP PP PP + P P PP P PP PP P Sbjct: 123 PPPPTGTLPP----PPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +1 Query: 805 PXPPPXPPXSPPXRXXLP-PXXXPXPPXPXXXXXPXXXPPXXP 930 P PPP PP P P P P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPP-XPXPPXP 941 P PPP P PP PP P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +1 Query: 811 PPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PPP P + P PP PP P P P P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/88 (36%), Positives = 33/88 (37%), Gaps = 8/88 (9%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGX---XEGGG-GXGXGGXXG-XXGGGXG---GXGGGXXXG 776 G G GG G GG G G +GGG G G GG G GGG G G G G G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 61 Query: 775 XXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 GG G GGG G Sbjct: 62 GGWGRMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/65 (40%), Positives = 27/65 (41%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G GG + G GG G G GG G G G G W G GGG G Sbjct: 4 GPGGWGRGSGGGWGQ--GPGGGWGRGQGGGMGRGPGGGWGRGSGGGW-GRMQGGGMGRGP 60 Query: 707 GGRXG 693 GG G Sbjct: 61 GGGWG 65 Score = 38.7 bits (86), Expect = 0.007 Identities = 31/81 (38%), Positives = 31/81 (38%), Gaps = 6/81 (7%) Frame = -1 Query: 917 GXXXGXXXXXGXGGXGXXXGGRXXRX--GGEXGGXGGGXG-GXGGG---XXXXXXGXGGG 756 G G GG G GG R GG G GGG G G GGG G G G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 61 Query: 755 VVWXGXXXGGGGXXGGGGRXG 693 W G GGG G GG G Sbjct: 62 GGW-GRMQGGGMGRGPGGGLG 81 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P L PPP P P PPP P P P PP PP LPP P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPP--PPEEVSLPP---P 735 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 736 DESPPSSKHPPTVSPSSSSAPP 757 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 700 LPPPPXXP--PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 LPPPP PPP P + PP PP P PP P Sbjct: 723 LPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP--XPP---XPPPXPP--XSPPXRXXLPP 861 PPPP P P P P PPP PP PP P S P R PP Sbjct: 704 PPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Query: 862 XXXPXPP 882 PP Sbjct: 764 SVSSAPP 770 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 7/67 (10%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTP-------PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 LP PP PPPP +P PP P PP P PP P P Sbjct: 699 LPLPP--PPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAP 756 Query: 859 PXXXPXP 879 P P Sbjct: 757 PRPSTPP 763 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 9/62 (14%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFP------PXPXPPPP---SXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP PPP P P PPPP S P P P P P Sbjct: 698 PLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPP 757 Query: 942 XP 947 P Sbjct: 758 RP 759 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/85 (24%), Positives = 21/85 (24%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP P P P P P P PP PP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPP--PPEEVSLPPPDES 738 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXP 926 PP S P P P P Sbjct: 739 PPSSKHPPTVSPSSSSAPPRPSTPP 763 Score = 28.7 bits (61), Expect = 7.3 Identities = 21/85 (24%), Positives = 22/85 (25%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP T P P PP + P PPP PP P P Sbjct: 687 PPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLP-PPPEEVSLPPPDESPPSSKHP 745 Query: 852 PPPSXXPXXXXPXPPXXPXXXPPXP 926 P S P P P P Sbjct: 746 PTVSPSSSSAPPRPSTPPSVSSAPP 770 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PPPP PP P S P P P P P P Sbjct: 724 PPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPPSVSSAP 769 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPL 862 P PP PPPPP PP PP P PL Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRPL 79 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PP PP PPP PP P PPPPS P Sbjct: 54 PPPPPPPPP-----PPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 748 HTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 H PPP P PPP PP PPP S P Sbjct: 52 HDPPPPPPPP----PPPPPPPPPPSSSPSRP 78 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTP 759 P PPPP PPPP P ++P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXP 771 PPPP PPPP P ++ P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPP 839 P PPP PP PPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXP 744 P P PPPP PPPP P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXP 845 P PPP PP PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPPP PPPP P + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXP 792 PPP PPPP P PPP P P Sbjct: 54 PPPPPPPPPPPPP----PPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPP 732 P P PPPP PPPP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPP 732 P P PPPP PPPP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PPP PP P PPPP P P P Sbjct: 54 PPPP----PPPPPPPPPPPPPPSSSPSRP 78 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 811 PPPXPPXSPPXRXXLPPXXXPXPP 882 PPP PP PP PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXG-GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG G GGR GG G G GGG GG GG G GG G GGGG Sbjct: 197 GGRGGY-GGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSY 255 Query: 704 GRXGXXG 684 G G Sbjct: 256 GSYDGYG 262 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 3/88 (3%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXG---GXGGGXXXG 776 G G GG G GG G G G GGG G G G GGG G G G Sbjct: 204 GRGRGGGGRGGYGGGGGYG-GYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYG 262 Query: 775 XXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 GG GG GG G Sbjct: 263 SMGMYNQSSSGYGKSYGGMSGGGSGGRG 290 Score = 35.5 bits (78), Expect = 0.063 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG 794 G GG G G G GG G GGG G GG GGG GG G Sbjct: 198 GRGGYGGRGRGGGGRGGYGG-------GGGYGGYGGYDQYSGGGYGGYG 239 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -2 Query: 853 GGXGXGGXXGXXGGGXG--GXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGGXG 692 GG G G G GGG G G GGG GGGGG G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYG 252 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Frame = -1 Query: 860 GGRXXRXGGEXG---GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGX 690 GGR G G G G G GG GGG GG + G G GG GGG G Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGD 481 Query: 689 XG 684 G Sbjct: 482 GG 483 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = -1 Query: 905 GXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGG 726 G G G G GG+ GG GGG GG GGG G GG G G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGG-GGDGGG--DGIDGGDGGGDGGGDGGGD 477 Query: 725 GGXXGGG 705 GG GGG Sbjct: 478 GGGDGGG 484 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G G G G +GGG GG G GGG GG GG G Sbjct: 427 GDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G G G G GGG G G G GGG GG GG G Sbjct: 423 GRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGG 479 Score = 35.9 bits (79), Expect = 0.048 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Frame = -1 Query: 920 GGXXXGXXXXXGXG-GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWX 744 GG G G G G GG GG GG GGG G GG G GGG Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGG-GGGDGGGDGIDGGDGGGDGGGDGGG---D 477 Query: 743 GXXXGGG 723 G GGG Sbjct: 478 GGGDGGG 484 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 1/84 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGX-GGGXGGXGGGXXXXXX 771 G G G G G G G + GG GG GGG GG GG Sbjct: 383 GFGGASGLTNGDDSGRRKGFGRGSRTDTLPKSDSKPGGAFGGSSGGGFGGSSGGSFGGSS 442 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGR 699 G G G GGG GGG R Sbjct: 443 GGSFGGSGFGSKSSGGG--GGGSR 464 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 G GG G GG G GG G G GGG GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXP--PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P + PP P PPP P PP P PP P PPP P P P Sbjct: 2588 PIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMML----PPMLPLPPPGLPMQPEAPVQPP 2643 Query: 859 PXXXPXPPXP 888 P P P P Sbjct: 2644 PLPPPGGPFP 2653 Score = 35.5 bits (78), Expect = 0.063 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXPXXXP--PPXPPXPPPXXPXFPPXPXPPPPSXXPX 875 PPP S P P PP PP P P PP P Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPM-LPLPP 2629 Query: 876 XXXPXPPXXPXXXPPXPXPPXPXP 947 P P P PP P P P P Sbjct: 2630 PGLPMQPEAPVQPPPLPPPGGPFP 2653 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PP P PPP P P P PPP P P PP Sbjct: 2622 PPMLPLPPPGLPMQPEAPVQPPP--LPPPGGPFPP 2654 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 789 PPPX---PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP--XPXPP 935 PPP P PP P P P PP P P P P PP P PP Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQ--PEAPVQPPPLPPPGGPFPP 2654 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXP 910 PP P P P PP P P P PP P P Sbjct: 2614 PPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFP 2653 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 GG GG G GG G G GGGG G GG GGG G GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGG---GGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/61 (42%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGG--GXXGGGGRXGXX 687 GG GG GG GGG GG GGG G GGG GGG G GG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGG------GGGGGGGGDDCEDGGGDDGEDGGSDNDGDE 127 Query: 686 G 684 G Sbjct: 128 G 128 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG GG GG GG GGG GG GGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG--XXGGGGRXGXXG 684 + GG G GG GGG G GGGV G GGGG GGG G G Sbjct: 73 DGGGDTDGGGGCGGG-----GGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 +GGG GG G GGG GG GGG G Sbjct: 73 DGGGDTDGGGGCGGGGGGGGGVGGGGGGG 101 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 892 GXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 G G G GGGG G GG G GGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 GG G GGGG G G G GGG GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 GG GG GG G GGG GG GGG G G Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGG 813 G G G GG G G GG G G GG+ G GG Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 919 GGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 GG GG G G GGGG G GG G GGG GG G Sbjct: 74 GGGDTDGGGGCG----GGGGGGGGVGGGGG-GGGGGGDDCEDGGGDDG 116 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGG 788 +GGGG G GG G GGG GG GGG Sbjct: 52 DGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -2 Query: 859 GGGGXGXGGXXGXXGGGXGGXGGG 788 GGGG G GG G GGG GG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 + GGG G GG G GGG GG GGG G Sbjct: 51 DDGGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GGGG G GG G GGG GG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGG 756 + GG GGG GG GGG G GGG Sbjct: 51 DDGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGG 756 + GG GGG GG GGG G GGG Sbjct: 52 DGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG GG GGG GG GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG GGG GG GGG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GGG GG GGG G GGG GGGG GGGG Sbjct: 53 GGGGGGGGGG------GGGGG--------GGGGGGGGGG 77 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GGG G GGGG GGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 764 GGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG G GGGG GGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/90 (33%), Positives = 31/90 (34%), Gaps = 12/90 (13%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXG-------GGXGGXG----- 795 GG G GG G G GG GG GG GG G GG GG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWS 246 Query: 794 GGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG G G G + GG GGG Sbjct: 247 GGYGSYDGGYGNGGDYSNGYSSYGGGYGGG 276 Score = 37.9 bits (84), Expect = 0.012 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 8/73 (10%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGXG-------GGVVWXGXXX 732 G GG G GGR G G G GGG GG GGG G GG Sbjct: 188 GRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSG 247 Query: 731 GGGGXXGGGGRXG 693 G G GG G G Sbjct: 248 GYGSYDGGYGNGG 260 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXG--GGXXXG 776 G G G G GG G GG G GG G GG GG G GG G Sbjct: 185 GAGGRGGRGGRGGGRGAPRG---RGGPRGGGGGSGGYGGGSYGGYGNYGGYSQG 235 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 839 GGEXGGXG-GGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G G GG G G G GG + G GG G GG + G G Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G GG GG GG GGG GG GGG G G GG GG+ Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGGK 83 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 862 EGGGGXGXG-GXXGXXGGGXGGXGGGXXXG 776 +GGGG G G G G GG GG GGG G Sbjct: 24 DGGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 770 GXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GGG + G GGGG GGGG G Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 31.9 bits (69), Expect = 0.78 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = -1 Query: 845 RXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 R GG GG GGG G GGG G GGG GGGG G+ G Sbjct: 23 RDGG--GGHGGGHG-YGGGPNGGGGGGGGG-------GGGGGDEDDSGKNG 63 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 892 GXGXXXXGXXEGGGGXGXGGXXGXXGGGXG 803 G G G GGG G GG G GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PPP P PPP PP P PPPP P Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P P PP PPP P PPP P +PP PP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P PP P P P PPP P PPP PP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P PP P P+ P P PP P PP P PP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAA-PAPPPPPAAAPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXP 917 P PP P P PP P PP P PP P P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 794 PXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P PP P P PP P +P P PP P P PP P Sbjct: 212 PVNPPEPDYLEPTPPP--PAAPAPPPPPAAAPPP--PPPPPPVKKP 253 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 794 PXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P P PP P P P P PP P P PP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P P P P P P PPPP+ P P PP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPA--PPPPPAAAPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 805 PXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P PP P PP P P PP P PP Sbjct: 212 PVNPPEPDYLEPTP---PPPAAPAPPPP-----PAAAPPPPPPPP 248 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/59 (27%), Positives = 22/59 (37%) Frame = +3 Query: 552 KDXGPKAXTSDSKQRSAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPP 728 K P A + +Q++ + P + P A PP P PPPPP P Sbjct: 196 KKTKPSA-AAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPP 762 P P PPPP PPP P P Sbjct: 228 PAAPAPPPPPAAAPPPPPPPPPVKKP 253 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 39.9 bits (89), Expect = 0.003 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 8/89 (8%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXG---GXGXXXGGRXXRXGGEXGGX--GGGXG-GXGGGXXXXX 774 G G GG G G G G G GG R G G GGG G G GGG Sbjct: 253 GRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQ 312 Query: 773 XGXGGGV--VWXGXXXGGGGXXGGGGRXG 693 G G G W G GGG G GG G Sbjct: 313 GGMGRGPGGGW-GRMQGGGMGRGPGGGLG 340 Score = 35.9 bits (79), Expect = 0.048 Identities = 26/76 (34%), Positives = 27/76 (35%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXG 741 G G G G G GG + G GG G G G G G G G W G Sbjct: 237 GSPMWGGGMGQGPRGWGRGSGGGWGQ--GPGGGWGRGQGRGMGRGPGGGWGRGSGGGW-G 293 Query: 740 XXXGGGGXXGGGGRXG 693 GGG G GG G Sbjct: 294 RMQGGGMGRGPGGGWG 309 Score = 34.3 bits (75), Expect = 0.15 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 6/82 (7%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEX--GGXGGGXG-GXGGG---XXXXXXG 768 G G G G GG G GG R G G GGG G G GGG G Sbjct: 243 GGMGQGPRGWGRGSG-GGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Query: 767 XGGGVVWXGXXXGGGGXXGGGG 702 G G W G GG G GGG Sbjct: 302 RGPGGGW-GRMQGGMGRGPGGG 322 Score = 32.3 bits (70), Expect = 0.59 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 4/85 (4%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGG-GXGXGGXXGXX-GGGXG-GXGGG-XXXGXXX 767 GG G G G G G G GGG G G G G GGG G G GGG Sbjct: 243 GGMGQGPRGWGRGSGGGW---GQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGG 299 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXG 692 GG G GGG G Sbjct: 300 MGRGPGGGWGRMQGGMGRGPGGGWG 324 Score = 29.1 bits (62), Expect = 5.5 Identities = 25/88 (28%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = -2 Query: 871 GXXEGGGG--XGXGGXXGXXGGGXGGXGG-GXXXGXXXXXXXXXXXXXXWXGGXXXGGGG 701 G G G G G G G G G GG G G GG G GG Sbjct: 231 GIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGG 290 Query: 700 GXGXXVXXGGEXXRAXAEWAXGYXWVGR 617 G G + GG W +GR Sbjct: 291 GWG-RMQGGGMGRGPGGGWGRMQGGMGR 317 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/93 (27%), Positives = 28/93 (30%), Gaps = 2/93 (2%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P + P PPP PP S P P PP P P PP Sbjct: 906 PPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVN--PPMSSQPQPPPGNQVNPPMSSQPQPP 963 Query: 855 PPSXX--PXXXXPXPPXXPXXXPPXPXPPXPXP 947 P + P P PP PP P P P Sbjct: 964 PGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 Score = 36.7 bits (81), Expect = 0.027 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 2/93 (2%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P + P PPP PP S P P P P P PP Sbjct: 890 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPGNQ--VNPPMSSQPQPP 947 Query: 855 PPSXX--PXXXXPXPPXXPXXXPPXPXPPXPXP 947 P + P P PP PP P P P Sbjct: 948 PGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 980 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/91 (25%), Positives = 24/91 (26%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P + P PPP PP S P P P P P P Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPG 933 Query: 855 PPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P PP PP P P P Sbjct: 934 NQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 964 Score = 33.5 bits (73), Expect = 0.26 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 13/91 (14%) Frame = +1 Query: 703 PPPPXXPPPPXXX----PXHTTPPPXPXXXXXXPPPXPPXPPPX----PPXS-----PPX 843 PP P PP P + P P P P P PPP PP S PP Sbjct: 906 PPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPG 965 Query: 844 RXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PP P P P P P Sbjct: 966 NQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/83 (26%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +1 Query: 703 PPPPXXPPPPXXX----PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXX 870 PP P PP P + P P P P P PPP +PP P Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQ-PQPLP 932 Query: 871 PXPPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 933 GNQVNPPMSSQPQPPPGNQVNPP 955 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/65 (27%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP--XRXXLPPXX 867 P P P P + P P P P P PPP +PP + PP Sbjct: 923 PMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGN 982 Query: 868 XPXPP 882 PP Sbjct: 983 QVNPP 987 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP PP P P PP PP P P PP P PP P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARP-TPPPPPPGKPTKPTKPSLPPVP 826 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP--PXRXXLPP 861 L PP PPPP PP P PP P PPP PP P P + LPP Sbjct: 774 LGAPPP-PPPPTKPATPRVPPNIP----SRPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP--PXSPP 840 P PPPP P P P + PP PPP P P P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXPXXP 940 PP PP P P PP P P P PP P P P P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP PPP P P P P PS P P PP P P P P P Sbjct: 778 PPPPPPTKPATPRVP-PNIPS-RPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 PPP P P PP P PP + P PP P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 777 PXXXPPPXPPXP--PPXXPXFPPXPXPPPPSXXPXXXX-PXPPXXPXXXP 917 P PP P P PP P PP P PP P P P P P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P P P PP P PP P P P P P PP Sbjct: 783 PTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP--PXXXPXP 879 PPP PPPP PP P P P P PP PP + P P P P Sbjct: 777 PPP--PPPPTKPATPRVPPNIPSR------PPGARPTPPPP--PPGKPTKPTKPSLPPVP 826 Query: 880 P 882 P Sbjct: 827 P 827 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 685 PXXPXLPPPPXXPP-----PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P P P P PP PP P T PPP P P P PP PP Sbjct: 780 PPPPTKPATPRVPPNIPSRPPGARP--TPPPPPP---GKPTKPTKPSLPPVPP 827 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 PPP P P H P PP P PP P Sbjct: 695 PPPPRPMAPKDASLHRASSPPGFTHKGSEPPPKPAPPARP 734 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP P P P P P PP P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 PPP PPPP P PPP P PP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PPP PP PPP P P P PPP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P PP PP PPP P FP PPPP P P PP Sbjct: 190 PMAGMPPPPPPPPP--PGFPGGAPPPPP---PPFGAPPPP 224 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 813 PPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P PP P PPPP P P PP P PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFP-GGAPPPPPPPFGAPPPP 224 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 +PPPP PPPP PPP P PPP PP Sbjct: 194 MPPPP--PPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 769 PXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P PPP PP PPP P P PP P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPP-PPFGAPPPP 224 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPP----XPPPXPPXSPP 840 P P P PPP P PPP PP PPP PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 802 PPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 PP PPP PP P PP PP P P Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 685 PXXPXLPPPPXXP---PPPXXXPXHTTPPP 765 P P PPPP P PPP P PPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPPP P PP P PP P PP P Sbjct: 195 PPPPPP--------PPPPGFPGGAPPPPPPPFGAP 221 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 P P PPPP PP PP +P P PP PP Sbjct: 188 PSPMAGMPPPPP-PPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +3 Query: 648 SAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXP 827 SA A P P PPPPP PP P PPP PPP Sbjct: 180 SAMAAANKPSPMAGMPPPPPPP---PP---------PGFPGGAPPPPPPPFGAPPPPALN 227 Query: 828 XFPP 839 PP Sbjct: 228 GGPP 231 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 P PP P PP P PP PPPP+ Sbjct: 199 PPPPPPGFPGGAPPPPP--PPFGAPPPPA 225 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 PPPP P + PPP P PPP P PPP P Sbjct: 511 PPPP---PPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 PPPP PPPP +PPP P PPP P Sbjct: 513 PPPPASPPPPLPAEEDNSPPPLP----AGPPPDEP 543 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +3 Query: 789 PPPXPPXPPPXXPXF-----PPXPXPPPP 860 PPP P PPP P PP P PPP Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPP PP P PP P PP PP Sbjct: 511 PPPPPPASP--PPPLPAEEDNSPPPLPAGPP 539 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PPPP+ P P P PP P P P Sbjct: 511 PPPPPPASPP---PPLPAEEDNSPPPLPAGPPP 540 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG GG GG G G GGG G GG G GGG G GGG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGY--GGGRGGGGYGGGRGGG-GSYGGG 138 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 904 GXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G G GGGG G G G GGG GG G G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYG-GSSRGGYGGGRGGGGYGGGRG 130 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G GG GG G GG GG GG G GGG GGGG GGG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGG-----GGYGGG-------RGGGGSYGGGR 139 Query: 701 R 699 R Sbjct: 140 R 140 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/55 (43%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -1 Query: 854 RXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGG-GXXGGGGRXG 693 R R GG GG G GG GG G GGG + G GGG GGG R G Sbjct: 308 REQRGGGRGGGYRSGGGGGYGG------GRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXG--GXGXXXXGXXEGGGGXGXG-GXXGXXGGGXGGXGG 791 G GG GG G G G G GGGG G G G G GGG GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGG 800 GG GG G GG G G GGG G GG GG G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 33.1 bits (72), Expect = 0.34 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 854 RXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 R R GG G GGG GGG G GG G GGG GGG G Sbjct: 88 RGERGGG--GSQGGGYRSGGGGYGGSSRGGYGG--GRGGGGYGGGRGGGGSYGG 137 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 886 GXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GGG G GG G G GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 824 GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GG G GGG G GG G GG GGGG G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGS-----SRGGYGGGRGGGGYGGGRG 130 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G R GG GG GGG G GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G GG GG GG G G G GGG G G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PPPP P PPP P PPP P PP PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PPP PP P F PPP P PP P P P PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PPPP P PPP P PPP P PP PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXP 851 PP + PPP PP S P P P PPP P P P Sbjct: 269 PPIPSASQNATPPPPPPPP--SNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Query: 852 PPP 860 PPP Sbjct: 327 PPP 329 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP P +T P PPP PP PP P LPP P PP Sbjct: 280 PPPPPPPPSNT--PGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPP--PPPPP 329 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXP----XXXXPXPPXXPXXXPPXPXPPXP 941 PP P PP P PPPPS P PP P P P PP P Sbjct: 269 PPIPSASQNATPPPP-PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = +3 Query: 789 PPPXPPXPPP---XXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PPP PP P F P P PPP P P PP PP P PP Sbjct: 282 PPPPPPSNTPGMFASSGFQP-PPPPPTDFAP---PPPPPEPTSELPPPPPPP 329 Score = 35.5 bits (78), Expect = 0.063 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP---XPPXPXXXXXPXXXPPXXP 930 PP P PP PP PP P PP P PP P PP P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPP--P 326 Query: 931 XPP 939 PP Sbjct: 327 PPP 329 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 5/60 (8%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXP-----PPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PP + TPPP P P P PPP +PP P P PP P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 7/65 (10%) Frame = +1 Query: 748 HTTPPPXPXXXXXXPPPXPPXPPP-------XPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 H P PPP PP P P PP PP P PP P P Sbjct: 268 HPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPP---PPPPEPTSELPP 324 Query: 907 XXXPP 921 PP Sbjct: 325 PPPPP 329 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXP----PXPPPXXPXF 833 P PPPPP P PPP P PPP P F Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPPF 330 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +3 Query: 792 PPXP-----PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PP P P PPP FPP P PPP P P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 703 PPPPXX---PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP 813 PP P PPPP PPP P PP PP P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P F P PPP P PP PP P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPP---PXPPXSPP 840 PP P PPP PP P P PP PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PP P PPP P PP PP +P P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPG-GGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 834 PPXPX----PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P PPPP P PP P P PP P Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = +1 Query: 694 PXLPPP-PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXX 870 P PP P PP P TP P PP P PP P PP PP Sbjct: 170 PSYPPTQPFYPPTQPFYPP--TPSSYPPTQPSYPPTAPSY-PPTPSSYPPIAASYPPTAP 226 Query: 871 P-XPPXPXXXXXPXXXPPXXPXPP 939 P P P PP P P Sbjct: 227 SYNPTAPSYPPTPSSYPPTQPSHP 250 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 5/71 (7%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP--PXXXPXHTTPPPXPXXXXXXPPPXPPXPP---PXPPXSPPXRX 849 P P PP P PP P P + PP P PP P P P PP Sbjct: 181 PTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPS 240 Query: 850 XLPPXXXPXPP 882 PP PP Sbjct: 241 SYPPTQPSHPP 251 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PP P P PPP P PP P P P P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 794 PXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P PP P PP P P P P P PP P P P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQP-YYPPPQPYPPTQPSYPPTPSSYP 551 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 694 PXLPP--PPXXPPPPXXXPXHTT-PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PP P P P P PPP P PP P PP P PP + PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPY------PPTQPSYPPTPSSYPPTQPSYPP 559 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 685 PXXPXLPPPPXX--PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P PP P P P P PP P P PP P PP +P Sbjct: 511 PTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPT-PSSYPPTQPSYPPTAP 562 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 6/53 (11%) Frame = +1 Query: 685 PXXPXLPPPPXXPPP-----PXXXPXHT-TPPPXPXXXXXXPPPXPPXPPPXP 825 P P PP P PP P P + T P P PP P PP P Sbjct: 202 PTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAP 254 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXP-XPPPPSXXPXXXXPXPPXXP 905 P P P PPP P P P PP PS P PP P Sbjct: 520 PSSYLPTQPYYPPP-QPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +1 Query: 748 HTTPPPXPXXXXXXPPPXPPXPPPXPPXS---PPXRXXLPPXXXPXPPXPXXXXXPXXXP 918 H + PP P PP P PP PP PP P P P P Sbjct: 169 HPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYP--PIAASYPPTAP 226 Query: 919 PXXPXPP 939 P P Sbjct: 227 SYNPTAP 233 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 802 PPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P P LP PP P P P PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP 552 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +1 Query: 730 PXXXPXHTTPPPXPXXXXXXPP---PXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P + PP P P P P PP P PP PP PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSY-PPTPSSYPPTQPSYPP 559 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G +GGGG G GG G GGG GG GGG G Sbjct: 304 GDGDGGGG-GDGGGGGGGGGGGGGDGGGDGDG 334 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G+ G GGG GG GGG G GGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGG---DGDGDGDGDGDGDGDGDG 348 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 + G G G GG G GGG GG GGG G Sbjct: 300 DDGDGDGDGGGGGDGGGGGGGGGGGGGDG 328 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G G GG GG GG GGG GG GGG G G G G G G G G Sbjct: 302 GDGDGDGG-----GGGDGGGGGGGGGGGGG---DGGGDGDG---DGDGDGDGDGDGDGDG 350 Query: 698 XGXXG 684 G G Sbjct: 351 DGDDG 355 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P PPPP P P PPP PP PP P + + LPP Sbjct: 526 PVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAPKRALDLKPNLPP 584 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PP P P P PP PP P P P P PP P P Sbjct: 513 PPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAP 572 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 10/61 (16%) Frame = +3 Query: 789 PPPXPPX-----PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXP-----PXPXPPX 938 PPP PP P P PP P P P PP P P P PP Sbjct: 512 PPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPA 571 Query: 939 P 941 P Sbjct: 572 P 572 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/82 (24%), Positives = 21/82 (25%), Gaps = 4/82 (4%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP----PPXPPXSPPXRXXLPPXXXP 873 P PP P + P PPP P P P PP P Sbjct: 505 PSDVAESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERR 564 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 PP P P P P Sbjct: 565 PPPLPPAPKRALDLKPNLPPVP 586 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXX--GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGX 773 G GG GG G GG G G GGG G GG G GG G GG G Sbjct: 105 GTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEG--GGQGGAQAGGSTSGS 162 Query: 772 XXXXXXXXXXXXXWXGGXXXGGGG 701 G GGG Sbjct: 163 SSGGATSGGGGVSGSSGTSIAGGG 186 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G G GGE GG GG G GGG G G G GGGG GG Sbjct: 94 GTAQAGASTSGGTAEGGGEAGGEAGGQAG-GGGQAGGQAGSQAG----GGAAGGGGQEGG 148 Query: 707 G 705 G Sbjct: 149 G 149 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXG--GGXGGXGGGXXXXXXGXG 762 G GG G G G GG+ G G G GG G GGG G Sbjct: 99 GASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGS 158 Query: 761 -GGVVWXGXXXGGGGXXGGGG 702 G G GGGG G G Sbjct: 159 TSGSSSGGATSGGGGVSGSSG 179 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/72 (36%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG-GGVVWXGXXXG---GGG 720 G G G GG+ GG+ GG G G G G G GG G G GG Sbjct: 109 GGGEAGGEAGGQAG-GGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGA 167 Query: 719 XXGGGGRXGXXG 684 GGGG G G Sbjct: 168 TSGGGGVSGSSG 179 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G G GG GG G GG GGG GGGG+ G Sbjct: 99 GASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEG 147 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXX-RXGGEXGGX--GGGXGGXGGGXXXX 777 G GG G GG GG G GG+ + GG G GG G GG Sbjct: 119 GQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSS 178 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGG 705 GG G G G GG Sbjct: 179 GTSIAGGGSSAG--AGAGATSAGG 200 Score = 33.5 bits (73), Expect = 0.26 Identities = 25/82 (30%), Positives = 26/82 (31%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG GG G GG GG + GG GG G G G Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAA-GGGG---QEGGGQGGAQAGGSTSGSSSGGATSG 170 Query: 767 XGGGVVWXGXXXGGGGXXGGGG 702 GG G GGG G G Sbjct: 171 GGGVSGSSGTSIAGGGSSAGAG 192 Score = 33.1 bits (72), Expect = 0.34 Identities = 28/95 (29%), Positives = 30/95 (31%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXX 755 GG GG G G G G + GG G G GGG G GGG Sbjct: 104 GGTAEGGGEAG--GEAGGQAGGGGQAGGQAGSQAGGGAAGGG-GQEGGGQGGAQAGGSTS 160 Query: 754 XXXXXXXWXGGXXXGGGGGXGXXVXXGGEXXRAXA 650 GG G G G + GG A A Sbjct: 161 GSSSGGATSGG--GGVSGSSGTSIAGGGSSAGAGA 193 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGG-XGXGGXXGXXGGGXGGXGGG 788 G G G G GG G G G GGGG G G GG G G G Sbjct: 142 GGGQEGGGQGGAQAG-GSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAG 194 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PPP PP PPP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 P P P PPP P PP P PPPP+ Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPA 886 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP 860 P P P PPP P PP P PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 P PPP PP PPP PP P PPP S Sbjct: 864 PRRPPPPPPPPPPP-----PPPPPPPPAS 887 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXP 917 P PP PPP P PP P PPPP P P P Sbjct: 864 PRRPPPPPPPPP--PPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS 834 P PPP P PPP PP PPP PP S Sbjct: 862 PRPRRPPPPPP-----PPPPPPPPPPPPPAS 887 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 730 PXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS 834 P P PPP P PPP PP PPP P S Sbjct: 860 PRPRPRRPPPPPPP------PPPPPPPPPPPPASS 888 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P PPPP PPP P PPP PP PP S P +P Sbjct: 862 PRPRRPPPPP-------PPPPP------PPPPPPPPPASSTGSTPGGDKVP 899 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXP 889 PP PPPPP PP PP S P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSP 859 P PP PPPPP PP P +P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXP 872 P P P P PP P PPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 P P PPPP PPPP PPP P P P P Sbjct: 864 PRRPPPPPPPPPPPPP-------PPPPPPASSTGSTPGGDKVPSVGP 903 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P P P PPP PP PP PP P PP P Sbjct: 860 PRPRPRRPPPPPP--PP-----PPPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 660 RXXSPPXXTXXPXPPPPPXXXPPXXS 737 R PP P PPPPP PP S Sbjct: 863 RPRRPPPPPPPPPPPPPPPPPPPASS 888 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP P PP P PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 813 PPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P PP P PPPP P P PP Sbjct: 860 PRPRPRRPPPPPPPPP--PPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 858 PSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P PP P PP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 891 PPXXPXXXPPXPXPPXPXP 947 PP P PP P PP P P Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 LPPPP P PP P H P P P P SPP R Sbjct: 1454 LPPPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQR 1502 Score = 36.3 bits (80), Expect = 0.036 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 13/88 (14%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPX-------------F 833 P PPPP PP P P P PP P Sbjct: 1456 PPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHVHTIVHHHVH 1515 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXP 917 PP P PPPP P P P P Sbjct: 1516 PPPPAPPPPVCMPMCAVAAPAPCPAACP 1543 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP FPP P P P PP P PP P P Sbjct: 1423 PAPPPPMA-FPPMPPAPGQVITHLQHIVHHKILPPPPPP-PAPPCPPP 1468 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 PP PP PPP P PP P PP P+ Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTPN 1331 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXP 845 P PPP PP PPP P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 PP PPPP PPP P PPP PP PP Sbjct: 1307 PPESPPPP--------PPPPP------PPPPPPLPP 1328 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXP 813 P + PPP P PPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXP 850 P PPPPP PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXP 744 P P PPPP PPPP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLP 1327 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTP 759 PPPP PPPP P TP Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 769 PXXXXXXPPPXPPXPPPXP-PXSP 837 P PPP PP PPP P P +P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PXXXXPXPPXXPXXXPPXPXPPXP 941 P P PP P PP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXP 893 P PP P PPPP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPP PPPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPP 1325 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 891 PPXXPXXXPPXPXPPXPXP 947 PP P PP P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPP 1325 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 38.3 bits (85), Expect = 0.009 Identities = 28/85 (32%), Positives = 29/85 (34%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G G GG G GG G GGG G GG Sbjct: 443 GGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGA-NGMAGGMNGMGGGMDDMAGGMGG 501 Query: 758 GVVWXGXXXGGGGXXGGGGRXGXXG 684 G+ G G GGG G G Sbjct: 502 GM----NGMGAGMNAMGGGLNGIGG 522 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/84 (29%), Positives = 26/84 (30%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G G G GG G GG GG GG G GGG Sbjct: 457 GFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGG 516 Query: 755 VVWXGXXXGGGGXXGGGGRXGXXG 684 + G G G G G G G Sbjct: 517 LNGIGGMNGMRGIGGMNGMDGMRG 540 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G G G G G G GG G GGG G G GGG G GG Sbjct: 473 GMGGGANGMAGGMNGMGGGMDDMAGGM--GGGMNGMGAGMNAMGGGLNGIGG 522 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G G G G G G G GG GG G GGG Sbjct: 439 GMGMGGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGG 491 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = -1 Query: 872 GXXXGGRXXRXGG--EXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G GGR R GG G GG GG G G G + G GGG G Sbjct: 439 GMGMGGRGMRGGGMPNMDGFGGMEGGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGG 498 Query: 698 XG 693 G Sbjct: 499 MG 500 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G GG G GGGG GG G G GG GG G Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 Score = 37.1 bits (82), Expect = 0.021 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -1 Query: 881 GGXGXXXGG-RXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 G G GG GG G GG GG GGG GGG G G GGG Sbjct: 201 GWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGG 260 Query: 704 G 702 G Sbjct: 261 G 261 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G GG G GG G GGGG GGG G G G G Sbjct: 201 GWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSG 255 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG G G G GG G GGG G G G G GGG Sbjct: 205 GRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 32.3 bits (70), Expect = 0.59 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXG 741 G G G GG G GG GGG G GG G Sbjct: 196 GSIEKGWVGGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSG 255 Query: 740 XXXGGGGXXGGG 705 GGGG GG Sbjct: 256 QAGGGGGSYCGG 267 Score = 29.5 bits (63), Expect = 4.2 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 5/90 (5%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGX-----GGXGGGXXXXX 774 GG G G G G R G E G GG GG GG Sbjct: 155 GGTGGNPGECNSAGSSYHGGVGAGWDGTGCTRLGPEHGERGGSIEKGWVGGRAGGMNSGY 214 Query: 773 XGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GGGG G G G Sbjct: 215 NGGPAPGAVGGFGGGGGGSEDNGASGGGGG 244 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P PP P P P H P P PPP P P PP R LP Sbjct: 64 PPVASTPPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPPQR--LPLQ 121 Query: 865 XXPXPPXPXXXXXPXXXP 918 P P P P Sbjct: 122 GFPSGPGQAQPLMPQQQP 139 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G G G G GG G GG G GGG G G G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GGG GG GG G G G G GG GG G G Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQG 379 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GGG G GG G G G G GG G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRG 365 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GGR R G G G GG G G G G G Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAG 376 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG GGR R GG G G G GGG G G Sbjct: 338 GGGRGGRGGRPGR-GGRGGRGASGGRGRGGGRGGFGGGAG 376 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPX--HTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P P P P P H PP P PP P P P PP P PP Sbjct: 174 PGQPSPEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPP 231 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 3/69 (4%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP---PXXXPXPPXPXXXXXPXX 912 P P P P P PP P PP R P P P P P Sbjct: 177 PSPEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRPEY 236 Query: 913 XPPXXPXPP 939 P P PP Sbjct: 237 AHPFLPLPP 245 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPX-HTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P L P P PP H PP P PP P P PP P Sbjct: 186 PPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRP 234 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P P P P P PP P PP P P P PP Sbjct: 177 PSPEYPHPYPPLRPEYAHPYPPRR-PEYAHLYPPRRPEY--PHPYPP 220 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P P PP H PP P PP P P P P +P Sbjct: 195 PYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRPEYAHPFLPLPPEYAHLIP 252 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G G G GG GG GG G G G G+ W GGG G Sbjct: 338 GNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG 397 Query: 707 GGRXGXXG 684 G G Sbjct: 398 SSCKGVTG 405 Score = 36.3 bits (80), Expect = 0.036 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G G G G G GG G GGG G G G G GGG Sbjct: 335 GRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSY 394 Query: 749 WXGXXXGGGGXXGGGGRXG 693 G G G GR G Sbjct: 395 CAGSSC-KGVTGGNSGREG 412 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G GG G GGGG GG G GG GG G Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG 397 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G G GG G GGGG GGG G G G Sbjct: 331 GWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSG 381 Score = 31.5 bits (68), Expect = 1.0 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 1/79 (1%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXXXGXGG 759 G G G G G G R G G GG G GG G GG Sbjct: 306 GAGWNGAGCNRTQNMHGEAGGARAQGWVGGRAGNMNSGYNGGPSPGAVGGF-----GGGG 360 Query: 758 GVVWXGXXXGGGGXXGGGG 702 G GGGG GGG Sbjct: 361 GGSEDNGASGGGGGYSGGG 379 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G G GG G G GG G G G G G Sbjct: 263 GVDGQATENGAASKGRLSYSRAGGSNGNPGVCNRAGGNYHGGVGAGWNGAGCNRTQNMHG 322 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 GG G G G G G Sbjct: 323 EAGGARAQGWVGGRAGNMNSGYNGG 347 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/70 (37%), Positives = 27/70 (38%), Gaps = 8/70 (11%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGX---GGXGG-----GXXXXXXGXGGGVVWXGXXX 732 G GG G G+ R G GG GG GG GG G GG G Sbjct: 216 GGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGA 275 Query: 731 GGGGXXGGGG 702 GGGG GGG Sbjct: 276 GGGGGYSGGG 285 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 GG G G GG G GG G GG G GGG G GGG G Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGG-AGGGGGYSGG 284 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G G GG GGG G G G GG GG GG Sbjct: 234 GSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGG 284 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXG-----GEXGGXGGGXGGXGGGXX 783 G GG G G GG GG R G GG GG G GGG Sbjct: 217 GGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAG 276 Query: 782 XXXXGXGGGV 753 GGG+ Sbjct: 277 GGGGYSGGGL 286 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 37.9 bits (84), Expect = 0.012 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 15/94 (15%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTT-----PP-PXPXXXXXXPPPXP-PXPPPXPPXS--------P 837 PPPP PPPP T PP P PP P P PPP S Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWT 743 Query: 838 PXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P PP P PP P PP Sbjct: 744 PLTNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPP 857 P PPPPP PPP PP P PP P PPP Sbjct: 723 PAPPPPPLGRDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 Score = 36.3 bits (80), Expect = 0.036 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 4/101 (3%) Frame = +3 Query: 657 ARXXSPPXXTXXPXPPPPP-XXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXF 833 AR SP P PPPPP P PPP P PPP Sbjct: 675 ARKSSPSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDS 734 Query: 834 PP---XPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P + P PP P PP P P Sbjct: 735 AAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPP 775 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GGGG G GG G GGG G GGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 845 RXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 R G GG GGG GG GGG G GGG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG G GG GG GG GGG GG GGG G G Sbjct: 337 GGSGRGGGG----GGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 853 GGXGXGGXXGXXGGGXGGXGGGXXXG 776 GG G GG G GGG GG GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGG 362 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G G G R GG G G GG GGG G GGG GGGG GGGG Sbjct: 319 GRDGHEFDGYRIRVEFPRGGSGRGGGGGGGG------GGGGG--------GGGGGRGGGG 364 Query: 701 RXGXXG 684 G Sbjct: 365 GFSSRG 370 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 859 GGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 GG G G GG G GGG GG GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 895 GGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 GG G G GGGG G GG GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXH------TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 P LP PP P P T PPP P P P PPP PP P R Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPPR 168 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P P +TP P P P PPP PP S P + P P PP P Sbjct: 112 PTLPTPPFSTPRPRPKAKRIRRL-LPTPPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +3 Query: 789 PPPXPPXPPPXXPXF------PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 PP P P P PP P PP + P P PP PP P PP Sbjct: 117 PPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPP----PKPPTPRPP 167 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P P PP P P P P PP PP P PP P P P Sbjct: 112 PTLPTPPFSTPR---PRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPP-PXPPXPPPXP-PXSPPXRXXLPPXXXPXPP--XPXXXXXPX 909 P ++TP P P PP P P P + R LP P PP P Sbjct: 96 PPNSTPSTAQAVANNDPTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLP 155 Query: 910 XXPPXXPXP 936 PP P P Sbjct: 156 TPPPKPPTP 164 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP-PXRXXLPPXXXPXPP 882 P P P P T PP P P P P P +P P R P P P Sbjct: 20 PRPHRPIAPSPLGPTTPSPPSHHGPISLRPHRPTIPSPHDPITPRPHRPTAPRPHDPIAP 79 Query: 883 XPXXXXXPXXXPPXXPXPP 939 P P P P P Sbjct: 80 RPRSPHGPVAPRPHRPISP 98 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 PP PPP P PP PP P + L P P PP Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPP 466 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PPP PPPP P PPP P P P SPP Sbjct: 424 PPP--PPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPP 466 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P PPP PPPP P TT P P PP P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXP 871 P PP P PPP PP P PL P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPP 857 P PPP P PPP P P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP 860 PPP PP P P P PP P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALP 448 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PP P PPP PP P P P Sbjct: 411 PTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PPPP PPP P PPP P P P P + P P Sbjct: 424 PPPP--------PPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 P P P PP PPPP P P PP P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPPDQP 469 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXP 926 PPPP P P PP P P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDP 450 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 PPPP PPPP P TPPP PP P P P P Sbjct: 95 PPPPATPPPPTMPP---TPPPPQTPA----PPGPDTPAPPAP 129 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PP P PPP P PP P PP P P PP Sbjct: 95 PPPPATPPP--PTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPP 892 PP PPPP PP PP P +P P PP Sbjct: 96 PPPATPPPPTMPPTPP--PPQTPAPPGPDTPAPP 127 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP PPPP+ P P P P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPG--PDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP 813 P P PPPP PP P P T PP P P PP P Sbjct: 95 PPPPATPPPPTMPPTP--PPPQTPAPPGP------DTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXP 889 P PP PPPP P PP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 PPP P P P PPP P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 796 PXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 P PP PP PP PP PP P PP P P Sbjct: 95 PPPPATPP-PPTMPPTP---PPPQTPAPPGPDTPAPP 127 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P PPP P P PP P P P P P P Sbjct: 95 PPPPATPPPPTMP----PTPP--PPQTPAPPGPDTPAP 126 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 PPP P PP P PP P P PP PP P Sbjct: 95 PPP--PATPPPPTMPP--TPPPPQTPAPPGPDTPAPPAP 129 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPP 860 P PP PP P P P P PP P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL 855 P P +PP P P P T PP P P PP + P + L Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPHTRIVGGTKAPPGAWPWQAML 157 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 777 PXXXPPPXP-PXPPPXXPXFPPXPXPPPP 860 P PPP P PPP PP P P P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPP 728 +PP T P PPPP PP Sbjct: 100 TPPPPTMPPTPPPPQTPAPP 119 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/88 (32%), Positives = 30/88 (34%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG GG G G GG + G GG G G G GG G Sbjct: 236 GGQGGTSSGGGGYGGETYACLSSTYGK--GGDRNQPGNAGGGAGEGSTGGPGGINA---G 290 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG G GG GGG G G Sbjct: 291 GGGGDSTTDSDDGAGGGGGGGHFSGGAG 318 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXX--GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXX 774 G G GG G G GG G G + GG GGG GG G Sbjct: 355 GNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGR 414 Query: 773 XGXGGGVV 750 G GGG+V Sbjct: 415 GGHGGGLV 422 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G G GGGG G GG GG GG GGG Sbjct: 368 GGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGGHGGG 420 Score = 33.9 bits (74), Expect = 0.19 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G G GG GG G GG GG G Sbjct: 273 GGGAGEGSTGGP--GGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYG 330 Query: 767 XGGGVV--WXGXXXGGGG 720 GG+ G GGGG Sbjct: 331 GSGGIASSTIGACAGGGG 348 Score = 32.7 bits (71), Expect = 0.45 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 4/91 (4%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXX 752 G GG G GG G G GGG G GGG GG G G Sbjct: 270 GNAGGGAGEGSTGGPGGINAGG--GGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTN 327 Query: 751 XXXXXXWXG----GXXXGGGGGXGXXVXXGG 671 G GGGG GG Sbjct: 328 QYGGSGGIASSTIGACAGGGGSSNCQAGNGG 358 Score = 32.3 bits (70), Expect = 0.59 Identities = 26/84 (30%), Positives = 29/84 (34%), Gaps = 2/84 (2%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G G G GG GG + GG G GG GGG + Sbjct: 341 GACAGGGGSSNCQAGNGGNSCQRGG---QSGGAAG--TASMGGGGGGLQFGNQDYTSRLS 395 Query: 749 WXGXXXGGGGXXGG--GGRXGXXG 684 + G GGGG G GGR G G Sbjct: 396 YGGGGGGGGGSAFGIEGGRGGHGG 419 Score = 31.1 bits (67), Expect = 1.4 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 1/86 (1%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGXG 762 GG G G G GG G G G GG GG G GGG Sbjct: 244 GGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAG-GGGGDSTTDSDD 302 Query: 761 GGVVWXGXXXGGGGXXGGGGRXGXXG 684 G G GGG GG G G Sbjct: 303 GA----GGGGGGGHFSGGAGGAAATG 324 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 1/77 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXG-GGXXXXXX 771 G GG G G G G G G GG G G GG Sbjct: 305 GGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRG 364 Query: 770 GXGGGVVWXGXXXGGGG 720 G GG GGGG Sbjct: 365 GQSGGAAGTASMGGGGG 381 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PP PP P T P P P P P PP PP P P Sbjct: 615 PPSRVPPQP-----ETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPK 669 Query: 886 PXXXXXPXXXPPXXP 930 P P PP P Sbjct: 670 PHIPPAPSRPPPQLP 684 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP--PPXPPXSPPXRXXLPP 861 P + PP P P P T PP P P P PP P PP LPP Sbjct: 631 PNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPP---QLPP 685 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/78 (29%), Positives = 24/78 (30%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 P P PP P P P P PP P P +PP PP P PP Sbjct: 608 PKHESPSPPSRVPPQPETAPKPF-----PNITPPEVRPSLPGTPPETKTKPP-LAPYPPK 661 Query: 886 PXXXXXPXXXPPXXPXPP 939 P P P P Sbjct: 662 TSPKTTPKPHIPPAPSRP 679 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PP PP P T+P P P PP P PP PP Sbjct: 640 PSLPGTPPETKTKPPLAPYPPKTSPKTTPK------PHIPPAPSRPPPQLPP 685 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXP-----PPXPPXPPPXPPXSPPXRXXLPPX 864 +PP P P P P T P P P PP P PP P + P + +PP Sbjct: 619 VPPQPETAPKPF--PNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTP-KPHIPPA 675 Query: 865 XXPXPP 882 PP Sbjct: 676 PSRPPP 681 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P P P PPS P P P PP P P Sbjct: 597 PPEPFELRKALPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLP 643 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP-XPPXP 941 P P P P PP P P PP + P PP P P PP P Sbjct: 623 PETAPKPFPNITPPEVR--PSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAP 676 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 1/66 (1%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXP-PPXPPXPPPXXPXFPPXPXPPPPSXXPX 875 P P P PP P P PP P PP P PPP P Sbjct: 627 PKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPPE 686 Query: 876 XXXPXP 893 P Sbjct: 687 ASKAVP 692 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPP-SXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P PP P P PP PP + P P P P PP P Sbjct: 627 PKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLP 684 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +3 Query: 777 PXXXPP---PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PP P P PP PP PP + P P P PP P Sbjct: 631 PNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/80 (22%), Positives = 19/80 (23%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXX 881 P PP PP P PP P P P P + Sbjct: 613 PSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHI 672 Query: 882 XPXPPXXPXXXPPXPXPPXP 941 P P P PP P Sbjct: 673 PPAPSRPPPQLPPEASKAVP 692 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 37.1 bits (82), Expect = 0.021 Identities = 32/92 (34%), Positives = 33/92 (35%), Gaps = 8/92 (8%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRX-GGEXGGXGGGX-----GGXGG--GXXX 780 G G G G GG G GR + GG G G G GG GG Sbjct: 406 GGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQND 465 Query: 779 XXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GGG G GGGG GGG G G Sbjct: 466 VEGGFGGGGGPNGAGGGGGG--GGGYSGGASG 495 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXG-XGGXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GGGG G GG G GG GG G Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G G EGG G G G GGG GG G G Sbjct: 439 GGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G GG GG GG GG GG G G Sbjct: 445 GGEGGKSFLAGGAGGRSNQNDVEG-GFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG 503 Query: 767 XGGGVVWXGXXXGGGGXXGGGG 702 GG G G G Sbjct: 504 GGGSYNAGSDKSQQAGANNGAG 525 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 6/80 (7%) Frame = -1 Query: 905 GXXXXXGXGGXGXXXGGRXXRX------GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWX 744 G G GG GG R GG GG G G GGG G G Sbjct: 440 GSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSN 499 Query: 743 GXXXGGGGXXGGGGRXGXXG 684 GGG G + G Sbjct: 500 SCGGGGGSYNAGSDKSQQAG 519 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP--XPPPXPPXSPPXRXXLPPXXXP 873 L PPP P P H P P PPP PP PP PP R P Sbjct: 23 LRPPPPPPTRPFERNIH--PRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPP 80 Query: 874 XPP 882 PP Sbjct: 81 PPP 83 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 PPP PPPP PPP P P PP PP Sbjct: 50 PPP--PPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 8/59 (13%) Frame = +3 Query: 789 PPPXPPXPP---PXXPXFPPX-----PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP PP P P P P PPPP P PP P PP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPP 83 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 PP PPP P PPPP P PP P Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 703 PPPPXXP---PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 PPPP PPP PPP P PP PP PP Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP-------PXPPPXPP 828 P PPPP PPP PPP P P PPP PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PP P PPP P P PP P P PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 35.5 bits (78), Expect = 0.063 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P PPP P PPP P PP PP +P P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPP-PPPLPAGVPAPPPPPPP 321 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP PPP P P P+ P P P P PP P P P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPP-PLPAGVPAPPPPPPPPMLGGP 327 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +3 Query: 777 PXXXPPPXPPXP----PPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 P PPP PP PP P PPPP P PP P P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP-PXPPPXPPXSPP 840 P PPPP PPP PPP P P P PP PP Sbjct: 276 PTSQPPPPP-PLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 790 PPPXPPXPPPXPPXS-PPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 P PP PPP PP P P PP P P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 P + PPP P P PPP P PPP PP Sbjct: 285 PLTGGMLPPPFGGHPAAAPP----PPPLPAGVPAPPPPPPP 321 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 36.7 bits (81), Expect = 0.027 Identities = 25/81 (30%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = +1 Query: 685 PXXPXLPP--PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P +PP PP PP H P P PP P PP P R +P Sbjct: 218 PGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPI-PVHHGMPPQYGPGRRDMP 276 Query: 859 PXXXPXPPXPXXXXXPXXXPP 921 P P P P PP Sbjct: 277 PPGAPPGMLP-PGMPPHGMPP 296 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 15/72 (20%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPP---------------PPSXXPXXXXPXPPXXPXX 911 P PPP PP P PP PP PP P PP P Sbjct: 224 PPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGRRDMPPPGAPPG 283 Query: 912 XPPXPXPPXPXP 947 P PP P Sbjct: 284 MLPPGMPPHGMP 295 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 6/57 (10%) Frame = +1 Query: 769 PXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP------XPPXPXXXXXPXXXPP 921 P P P PPP PP S P PP P PP P P P Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGP 270 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PP P PPP PP P PPP P PP + P Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRP 257 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P L PPP PPP P PP PPP P PPP Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQG----LPFPPPGPIPPPP 250 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 PP PP P PP P PP P P PP P PP Sbjct: 208 PPNAPPGLMPPPGMLPP-PGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP PP PP PPP P PP PP P PP P Sbjct: 208 PPNAPPGLMP-PPGMLPPPGGMPPGR---MPPQGLPFPPPGPIPPPP 250 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P PP P P PP P PP PP P PP P Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPG-PIPPPP 250 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 PP PP P P PP +PP P P P PP Sbjct: 208 PPNAPPGLMPPPGMLPPP-GGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXP 893 P P P P P P PP P P PP+ P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PP PP P P PP P P PP+ P Sbjct: 1360 PRPPTPPRPPTPRPR----PPTPRPGPPTPRP 1387 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 861 SXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 S P P PP P P P PP P P Sbjct: 1352 SPIPSTPRPRPPTPPRPPTPRPRPPTPRP 1380 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPPP PP P +T P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRP 1598 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 T+P P PP PP P P PP P Sbjct: 1351 TSPIPSTPRPRPPTPPRPPTPRPRPPTPRP 1380 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 P P P TPP P P P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXP--PXPPPXPPXSPP 840 P +TP P P P P P P P P PP P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 P P P P P PP P P P PP Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 P PP P P PP +PP P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P + P P P P PP P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P P P P P PP P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPPXXP 905 P PP P P PP P P P P Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPPRPETP 1601 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P P PP PPP P TP P Sbjct: 1580 PPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 27.9 bits (59), Expect(2) = 0.55 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 789 PPPXPPXPPPXXPXF--PPXPXPPPP 860 PPP P PP P PP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 23.0 bits (47), Expect(2) = 0.55 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 684 TXXPXPPPPPXXXPP 728 T P PPPP PP Sbjct: 1572 TTLPITPPPPTPSPP 1586 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 P P H TP P PP P P P P +PP + P P P P Sbjct: 125 PHSTTPQHPTPQHSP-PIRKQTPPSKPHPSPTPAQAPPHSRPV-AAKRPMPSTPDQNPCP 182 Query: 907 XXXPPXXP 930 PP P Sbjct: 183 SEAPPRLP 190 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P P P P H+ P P P P PP PP LPP Sbjct: 147 PSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNP-CPSEAPPRLPPANKLLPP 198 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXP-PXPXPPXPXP 947 PP PP P P P PP P P P P P PP P Sbjct: 139 PPIRKQTPPSKPHPSPTPAQAPPHSRPVAAKRPMPSTPDQNPCPSEAPPRLPP 191 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 839 GGEXGGXGGGX-GGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG+ GG G GG G G GGG G GGGG GGG Sbjct: 253 GGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G GG G G GG GGG G G G Sbjct: 250 GWVGGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -1 Query: 881 GGXGXXXGG-RXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 G G GG GG G GG GG GGG GGG G GG G Sbjct: 250 GWVGGKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGG----GYSGGGSG 300 Score = 29.1 bits (62), Expect = 5.5 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 11/93 (11%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGX-----GGXGGGXXXXX 774 GG G G G G R G + G GG GG GG Sbjct: 204 GGTGGNPGECNSAGSSYHGGVGAGWNGAGCARLGSQHGERGGSITEGWVGGKAGGMNSGY 263 Query: 773 XG------XGGGVVWXGXXXGGGGXXGGGGRXG 693 G GG W G G GGGG G Sbjct: 264 NGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSG 296 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PPPPP PP P P P P P +P P PP P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGP 1721 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PPP P P P P P P P P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 34.3 bits (75), Expect = 0.15 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP--PXPPXSP--PXRXXLPP--X 864 P PP PPP P P P P PP PP P P P P PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRD 1719 Query: 865 XXPXPPXPXXXXXP 906 PP P P Sbjct: 1720 GPMGPPGPSGGQGP 1733 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P PP PPP P P PP P P P P P P P P Sbjct: 1660 PAPPPPPP------PAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXP-PPXPPXPP-----PXPPXSPPXRXXL 855 P PPPP PP P P P P PP P P P P PP R Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDG- 1720 Query: 856 PPXXXPXP 879 P P P Sbjct: 1721 -PMGPPGP 1727 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 6/66 (9%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP----PXXXPXPPXPXXXXXPXXXP--P 921 P P PPP PP P P PP P LP P PP P P P P Sbjct: 1652 PWYPVFHYPAPPPPPP-PAPGPP-GPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYP 1709 Query: 922 XXPXPP 939 P P Sbjct: 1710 GAPAGP 1715 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +3 Query: 777 PXXXPPPXP-PXPP-PXXPXFPPXPXPPPPSXXPXXXXPXPP--XXPXXXPPXPXPPXPX 944 P PPP P P PP P P P P P P P PP P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGP----PGPPGLPGPQGIPGYPGAPAGP 1715 Query: 945 P 947 P Sbjct: 1716 P 1716 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/82 (26%), Positives = 23/82 (28%), Gaps = 3/82 (3%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP---XPPXSPPXRXXLPPXXXP 873 PP P P P PP P P P PP PP P + P Sbjct: 1784 PPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVP 1843 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 PP P P PP Sbjct: 1844 GPPGPPGAYGWKGYPGNPAGPP 1865 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 36.7 bits (81), Expect = 0.027 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 7/83 (8%) Frame = +1 Query: 712 PXXPPPPXXXPX--HTTPPPXPXXXXXXP---PPXPPXPPPXPPXSPPXRXX--LPPXXX 870 P PP P P TPP P PP PP PPP PP LP Sbjct: 602 PTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTL 661 Query: 871 PXPPXPXXXXXPXXXPPXXPXPP 939 P PP P PP Sbjct: 662 PLPPPTVRHPQATPLPRLATHPP 684 Score = 31.5 bits (68), Expect = 1.0 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 7/66 (10%) Frame = +1 Query: 703 PPPPXXPP-PPXXXPXHTTPPP------XPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P PP PP P +TPPP P PPP P P P PP Sbjct: 628 PRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPPPTVRHPQATP--LPRLATHPPP 685 Query: 862 XXXPXP 879 P P Sbjct: 686 LSTPQP 691 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 36.7 bits (81), Expect = 0.027 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP-P 861 P P PP P PP P P P P PP P +PP LP P Sbjct: 101 PPMPLAPPVPLAPPMPLAPPVQQAPCGAGPMQAPCAGQQMPLAPPM-PLAPPVPLALPMP 159 Query: 862 XXXPXPPXPXXXXXPXXXPP 921 P P P P P Sbjct: 160 LAPPMPLAPPVQQAPCGAGP 179 Score = 28.7 bits (61), Expect = 7.3 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 2/87 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXP--PPXPPXPPPXPPXSPPXRXXLP 858 P P PP P PP P P P PP P PP P +PP P Sbjct: 64 PLMPLAPPMP-LAPPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPP--VPLAPPMPLAPP 120 Query: 859 PXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P P Sbjct: 121 VQQAPCGAGPMQAPCAGQQMPLAPPMP 147 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 P PP PP P PPP P PPP PP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 35.5 bits (78), Expect = 0.063 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PP P PPP P PPP PP PP +PP Sbjct: 174 PGILAPPPAPPGVLAPPPAP-PGVLPPPPAPPGALIPPPPAPP 215 Score = 35.1 bits (77), Expect = 0.084 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P PPP P PPP PP P PP +PP PP P PP Sbjct: 174 PGILAPPPAPPGVLA-PPPAPPGVLP-PPPAPPGALIPPP---PAPP 215 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 789 PPPXPPX---PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 PPP PP PPP PP PPPP+ P P PP P Sbjct: 179 PPPAPPGVLAPPPA----PPGVLPPPPA-PPGALIPPPPAPP 215 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 790 PPPXPPX---PPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PP PPP PP P P P PP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 811 PPPXPP--XSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PPP PP +PP PP P PP P P PP P PP Sbjct: 179 PPPAPPGVLAPP---PAPPGVLPPPPAPPGALIP---PP--PAPP 215 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 837 PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PPP+ P PP P PP P PP Sbjct: 174 PGILAPPPA--PPGVLAPPPAPPGVLPPPPAPP 204 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -1 Query: 857 GRXXRXGGEXGGXG--GGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G G E GG G GG GG GG G G G G GG GGR G Sbjct: 484 GMGPAPGQEKGGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRGG 540 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = -1 Query: 827 GGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G G GG G G ++ G G G GG G G Sbjct: 88 GGSGAGHATLGGNGESLEGGLEYGSIYEPILAGAHGGSGPGGSGGRGG 135 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPP 860 PP PP PPP F P PPPP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPP 27 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 +PPPP PPPP T PP PP PP P P P Sbjct: 4 VPPPP--PPPPPIAAEFTAPP---------APPPPPNPAPDVP 35 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PPPP PPP P PP PP PP P P P P Sbjct: 5 PPPP--------PPPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNSQAAP 49 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 PP P PPPP P PP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 811 PPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PP P P P PP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/77 (29%), Positives = 25/77 (32%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P P P P +T PP PP PP P S P +P P P P Sbjct: 895 PSSMPAPVPLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQP--VPVPSMYQPQP--P 950 Query: 889 XXXXXPXXXPPXXPXPP 939 P PP P P Sbjct: 951 GIMQPPTSIPPSQPMAP 967 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 PP PP P + P P P PP P PP P PP Sbjct: 922 PPTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFPP 972 Score = 30.3 bits (65), Expect = 2.4 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 7/88 (7%) Frame = +1 Query: 694 PXLPP-----PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P LPP P P P PP PP P PP PP S P Sbjct: 923 PTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFPPSS---MGGFP 979 Query: 859 PXXXP--XPPXPXXXXXPXXXPPXXPXP 936 P P P P P P P Sbjct: 980 PSSQPSMYNPGQVQPGYPGAMTPGAPSP 1007 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/66 (25%), Positives = 18/66 (27%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P P P P P P P P P P PP +PP Sbjct: 903 PLQPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQPVPVPSMYQPQPPGIMQPPTSIPPS 962 Query: 865 XXPXPP 882 PP Sbjct: 963 QPMAPP 968 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G GG G G GGG G GG GGG GG GG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGG-RGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -1 Query: 824 GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G GGG GG GG G GGG + GG G GGGR Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGG--FKSPRGGGRGGGRGGGR 82 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGG-EXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G GR GG GG GGG GG GG G GGG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGG 77 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G G G GG G GG G GGGG G GGG GG G Sbjct: 36 GFSPRGAGRGGGRGGPRGGG----RGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG 804 GG G GG G G + R GG GG GGG G Sbjct: 45 GGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G R GG GG GGG G G GGG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G G G G G + GGG GG G G G GGG G Sbjct: 331 GDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGG 387 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG GG G G G G + GGG GG G G G GGG G Sbjct: 337 GGDPGGGDPGGGDPGG-GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 35.9 bits (79), Expect = 0.048 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG GG G G G GGG G G G GG G GGG G Sbjct: 342 GGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGG-GDHGGGDHGG 397 Score = 35.1 bits (77), Expect = 0.084 Identities = 26/91 (28%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXX---RXGGEXGGXGGGXGGXGGGXXXX 777 G GG GG G G G G GG GG+ GG G G GGG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGD 402 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G + G GG G G Sbjct: 403 GDHGDGDLFNGDRDHGDGGDRHHGDHSDGDG 433 Score = 34.3 bits (75), Expect = 0.15 Identities = 31/88 (35%), Positives = 32/88 (36%), Gaps = 3/88 (3%) Frame = -1 Query: 938 GGXGXXG-GXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGX--GGGXGGXGGGXXXXXXG 768 GG G G G G G G G GG GG+ GG GGG G G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPG--GGDPGGGDHGGGDHGGG----DHGDG 378 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G GGG GG G G Sbjct: 379 DHGGGDHGGGDHGGGDHGGGDYGDGDHG 406 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 GG G G G G G + GGG GG G G G GGG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = -2 Query: 919 GGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXX 740 GG G G G + GGG GG G G G GGG G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGG--GDHGDGDHGG 382 Query: 739 XXWXGGXXXGGGGGXG 692 GG GG G G Sbjct: 383 GDHGGGDHGGGDHGGG 398 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +3 Query: 789 PPPXPPXPPPXX--PXFPPXPXPPP-PSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP P PPP PP P P P P P P PP PP P Sbjct: 24 PPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP-PXPPPXPPXSPPXRXXLPPXXX 870 P PPP PPP PP P P P P P P P S P PP Sbjct: 21 PGAPPPMPQQPPPLG--FDAMGPPQP---GGMPMPMPGPYPSSGYPTSVP--GAAPPYGG 73 Query: 871 PXPP 882 P PP Sbjct: 74 PPPP 77 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 35.9 bits (79), Expect = 0.048 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G G G GG G GG GG+ G GG GG G GG Sbjct: 575 GGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGD-GDYNGGDDDYNGGDGDSNGGDGG 633 Query: 758 GVVWXGXXXGGGGXXGG 708 G G G GG Sbjct: 634 D---NGTGDGDGDYNGG 647 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G G GG G G +G GG G GG G GG Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGG 609 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GGG G GG G GGG G G GGGG Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGG 595 Score = 30.7 bits (66), Expect = 1.8 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGX---GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXX 777 G GG GG G G GG G G GG G GG G GG Sbjct: 556 GGGGGGDYNGGD--GDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDY 613 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGGG 702 G G GG G G G Sbjct: 614 NGGDDDYNGGDGDSNGGDGGDNGTG 638 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXE----GGGGXGX-GGXXGXXGGGXGGXGGG 788 G G G G G GG G + GGGG G G G GG G GG Sbjct: 559 GGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGG 616 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G GG G G GG G G GG G GG G G Sbjct: 568 GDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDGDS 627 Query: 755 VVWXGXXXGGGGXXG 711 G G G G Sbjct: 628 NGGDGGDNGTGDGDG 642 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 35.9 bits (79), Expect = 0.048 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGG--GXXGGGGRXGXXG 684 GGG GG GG GGG V G GGG G GGGG G G Sbjct: 83 GGGSGGCEGGGGCVGCEGGGGCV--GCEGGGGCVGCEGGGGCVGCEG 127 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGG----XGXGGXXGXXGG 812 G G GG GG G GG G EGGGG G GG G GG Sbjct: 83 GGGSGGCEGGGGCVGCEGGGGCVGC---EGGGGCVGCEGGGGCVGCEGG 128 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 812 GXGGXGGGXXXXXXGXGGGVVWXGXXXGGG--GXXGGGGRXGXXG 684 G GG GG GGG V G GGG G GGGG G G Sbjct: 76 GCGGCEGGGGSGGCEGGGGCV--GCEGGGGCVGCEGGGGCVGCEG 118 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 839 GGEXGGXGGGXG--GXGGGXXXXXXGXGGGVVWXGXXXGGG--GXXGG 708 GG GG GG G G GG GGG V G GGG G GG Sbjct: 83 GGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCV--GCEGGGGCVGCEGG 128 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 35.9 bits (79), Expect = 0.048 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G R R G G GG G GGG G GGG GGGG G GG G Sbjct: 391 GMRRGRGGYRGRGGRGGYRGRGGGRGYYRGGRGGG-------RGGGGRGGRGGLRG 439 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 905 GXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGG 789 G G GG GGR GG GG GGG G GG Sbjct: 398 GYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGG 436 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = -1 Query: 836 GEXGGXGG--GXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG-GGRXGXXG 684 G G GG G GG GG G GGG + GGG GG GGR G G Sbjct: 391 GMRRGRGGYRGRGGRGG-----YRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 +GGGG G GG GGG GG GG G Sbjct: 4 DGGGGDGDGGDGDGGGGGDGGGDGGDCDG 32 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G GG G G G G + GG G G GG G GG Sbjct: 15 GDGGGG-GDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGDGDVDGG 66 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG GG+ G GGG GG GG G GG G GG G GG Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGG---DCDGDGGDC--DGGDDDGGDDGGDGG 52 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 827 GGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G GGG G GG G GGG G G GG GG G Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGD--GGDCDGDGGDCDGGDDDG 44 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 35.5 bits (78), Expect = 0.063 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPP 861 PPP PP P PP PP R +PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPP 218 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P + PPP P PPP PP PP P Sbjct: 185 PTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPP 798 PPPP P PPP P PPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +3 Query: 789 PPPXPPXP---PPXXPXFPPXPXPPPP 860 PPP PP P PP P PPPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPPXP 926 PPPP P P PP PP P Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 +P P PPP H P PP PPP P + PP P Sbjct: 696 VPLPYKQVPPPYKQVPHPYKQ-VPATYKQVSPPFKQVPPPYKQVPHPYKQVPPPYKQVPP 754 Query: 880 P 882 P Sbjct: 755 P 755 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PP PPPP P PPP P PPP P PP + P Sbjct: 212 PPTAAPPPP---PTTGAPPPTP-VTNKPPPPRPATTQAPPPTAAP 252 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P PP P PP PPP+ P P PP P P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPT--PVTNKPPPPRPATTQAPPP 248 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 PPPP PP + PPP P PP P Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXP--XPPPPSXXPXXXXPXPPXXP 905 PP P PPP PP P PPP P P P Sbjct: 212 PPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP 798 PPPP P P PPP PPP Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PP P PP PP +PP PP PP P Sbjct: 227 PPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXP 910 P PP PP P PP P +P P P PP P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVP-PTNPPVPPTNPPAPPTNPPKP 259 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXP---PPXPPXSPP 840 LP P P TPP PP PP P PP PP +PP Sbjct: 208 LPGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P PP PP P T PP P PP PP PP P P Sbjct: 219 PRPPTTQTPPTKAP---TDPPVPPTNPPVPPTNPPAPPT-NPPKP 259 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 P PP P PP PP PP PP PP P P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPP-VPPTNPPAPPTNPPKP 259 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 PP PP P PP P PP P P P PP P Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPP------VPPTNPPAPPTNPPKP 259 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 35.5 bits (78), Expect = 0.063 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = -1 Query: 929 GXXGGXXXGXXXXXGXGGXGXXXGGRXXRX--GGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G G GG GG R GG GGG G GGG G G Sbjct: 451 GSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSG 510 Query: 755 VVWXGXXXGGGGXXGGGG 702 G GGGG Sbjct: 511 GACGDFTSGLSPTCGGGG 528 Score = 35.5 bits (78), Expect = 0.063 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G GG G G GG GGG G G G GGG G GG Sbjct: 462 GPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 32.3 bits (70), Expect = 0.59 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 9/70 (12%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGX-----GGXGG----GXXXXXXGXGGGVVWXGXX 735 G GG G GG G G G GG GG G GGG G Sbjct: 442 GGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGG 501 Query: 734 XGGGGXXGGG 705 GGGG GG Sbjct: 502 GGGGGGFSGG 511 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXG-GGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GG G GG G G GG G GG +W GG G GG G G Sbjct: 444 GGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIW-NVVPGGFGGGGGASGGGGGG 502 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 35.5 bits (78), Expect = 0.063 Identities = 23/66 (34%), Positives = 26/66 (39%), Gaps = 3/66 (4%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP-- 873 LP P PP P HT+ PP P PP P P P +P +PP P Sbjct: 235 LPLIPNTSIPPTPTP-HTSIPPTPTPHTSIPP--TPTPHTSIPPTPTPHTSIPPTPTPHT 291 Query: 874 -XPPXP 888 PP P Sbjct: 292 SIPPTP 297 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P PP P P P P + P P P P PP P P Sbjct: 247 PTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHP 299 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPP---PPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PP P P PP P P PP+ P P P PP P P P Sbjct: 244 PPTPTPHTS-IPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIP 294 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P P + P P P P PP P P Sbjct: 239 PNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 289 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +1 Query: 802 PPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PP PPP PP +PP LPP P PP P Sbjct: 431 PPTPPPTPPPTPPP-TTLPPTTQP-PPQP 457 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXP 771 P PP P PPP P T PPP P Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 789 PPPXPPXPPPXXP--XFPPXPXPPP 857 PP PP PPP P PP PPP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXP 804 PPP PP P P TT PP PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPP-----TTQPPPQP 457 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PPP P PP P PPP + P P P Sbjct: 430 PPPTPPPTPP-PTPPPTTLPPTTQPPPQP 457 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPP--XPPXSPP 840 TPPP P PP PP PPP PP + P Sbjct: 429 TPPPTP------PPTPPPTPPPTTLPPTTQP 453 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXP 872 PP PPP P PP PP + P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPP 454 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 35.5 bits (78), Expect = 0.063 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G GG GG G GGG GG G GGG G GGG Sbjct: 1080 GGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGG---MGGGMGMQGGGMGMQGGG 1129 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRX-GGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG GG G GG G G GG G GGG G GGG G G Sbjct: 1081 GGGAAMGGG--GQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMG 1138 Query: 761 GG 756 G Sbjct: 1139 MG 1140 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 GGG GGG GG + G GGG G G + G G Sbjct: 1080 GGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMG 1124 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G EGGG G G G GGG GG GGG G Sbjct: 9 GDGEGGGDGGDSG-GGSDGGGDGGDGGGGSDG 39 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G+ G GGG GG GG GGG GGGG GG G G Sbjct: 7 GDGDGEGGGDGGDSGG-----GSDGGG----DGGDGGGGSDGGDGEGDDDG 48 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -2 Query: 892 GXGXXXXGXXEGGGGXGXGGXXGXXGGG-XGGXGGGXXXG 776 G G + GGG GG G GGG GG G G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDG 48 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 P P P P +TP PPP PP PPP P S P + Sbjct: 357 PPSTPAPTPAPLSSTP-----CAPFAPPPPPPPPPPPAPGSTPVK 396 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 PP P P P P S P PP P PP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 843 PXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P+ P P P P PP P PP P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P P P P P PP P PPPP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXP 916 PP P P P P +P P P PP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P P P P S P PP P PP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPP 732 P P PPPP PPPP Sbjct: 372 PCAPFAPPPPPPPPPP 387 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 +TP P P P PPP PP PP P Sbjct: 359 STPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPL 862 P P PPPPP PP PP +P+ Sbjct: 372 PCAPFAPPPPP--PPPPPPAPGSTPV 395 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 34.7 bits (76), Expect = 0.11 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 2/84 (2%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G GG G GG G G GGG G GG GG Sbjct: 421 GGRGGPGGGYEGR----GRGGRGGPRGGGPRGYDGGYG-QGGGYEGYSGGYRDDYGYGGG 475 Query: 758 GVVWXGXXXGGG--GXXGGGGRXG 693 GGG GGG G Sbjct: 476 SYDHYDSYYGGGYDDYYGGGPPRG 499 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GG GG GGG G GG G GG GGG G G Sbjct: 414 GSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSG 464 Score = 33.9 bits (74), Expect = 0.19 Identities = 29/85 (34%), Positives = 29/85 (34%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G GG G GG GG R GG GG GG GG G G Sbjct: 465 GYRDDYGYGGGSYDHYDSYYG-GGYDDYYGGGPPR-GGPRGGRGGSRGGPPRGAPRGRSG 522 Query: 767 XGGGVVWXGXXXGGGGXXGGGGRXG 693 G GGG G GGR G Sbjct: 523 PPRG-------RGGGDFGGRGGRGG 540 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G R GG GG GGG G G G G GG + G GGG G G Sbjct: 414 GSLNSRRGGR-GGPGGGYEGRGRGGRGGPRG-GGPRGYDGGYGQGGGYEGYSG 464 Score = 29.5 bits (63), Expect = 4.2 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXX 767 G G G G GG GGG G GG GG GG G Sbjct: 456 GGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDYYGGGPPRGGPRGGRGGS-RGGPPR 514 Query: 766 XXXXXXXXXXXWXGGXXXGGGGGXG 692 GG GG GG G Sbjct: 515 GAPRGRSGPPRGRGGGDFGGRGGRG 539 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/84 (28%), Positives = 25/84 (29%), Gaps = 6/84 (7%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX 885 PPP PPPP PPP P P P PP + P P P Sbjct: 784 PPPEYPPPPPGLARPNPPPPNP-PLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPAPAP 842 Query: 886 PXXXXXP------XXXPPXXPXPP 939 P PP P PP Sbjct: 843 PITPDDTITRSAVHNLPPCPPDPP 866 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 7/59 (11%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP-------XPPXPXP 947 PP PP PP P P PS P P PP P P PP P P Sbjct: 859 PPCPPDPPQRLPLVEACPG--SPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPPDP 915 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PP P PP P P P P P PPP P S L P PP P Sbjct: 859 PPCPPDPPQRLPLVEACPGSP---SVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPPDP 915 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPP 854 P PP PP PP PP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 PPP PP P P PP P P P P PP P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRP--LPPKSDTPPPPPRP 892 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 P P PPP PP P P + PP P P P PPP P Sbjct: 850 PLSPSAPPP--LPPRPVGAP--PSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P P P PP P PPS P P PP P P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 816 PXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P PP P PP P P P P P PP P P Sbjct: 850 PLSPSAPP-PLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 751 TTPPPXPXXXXXXPP--PXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 TT P PP P P PP P P R LPP PP P Sbjct: 844 TTKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTR-PLPPKSDTPPPPP 890 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P P PPP P PP P P P PP PP Sbjct: 850 PLSPSAPPPLPPRPVGA-PPSLPPRPRTRPLPPKSDTPPPPP 890 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 PP P PP P P P PPP P P P PP R LP Sbjct: 1329 PPWELPLPPSGLPLPL--PRLPLPPLRLPPPHSRLPLPPPKLPPPSRIPLP 1377 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 PP P PP P P P PL P P P PP P Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIP 1375 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 742 PXHTTPP---PXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 P + PP P P P P P PP P P R LPP P P Sbjct: 1324 PANYVPPWELPLPPSGLPLPLPRLPLPPLRLP-PPHSRLPLPPPKLPPP 1371 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P PPP P P P PP+ P P P P PP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPT--PLVQHPEPEAPPQLPPPPP 88 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPPP P H+ P P P PP PP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 PPPP P P P P PP P PPP Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPX-PXXXXXPXXXP 918 P + PPP P P P P P P PP P PP P P Sbjct: 45 PHYHQPPPPPTRPSHSCGPHPVPPTPLVQHPEPEA---PPQLPPPPPFIVDDTESPQEQP 101 Query: 919 PXXPXPP 939 P P P Sbjct: 102 PTTPVSP 108 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPS 863 PPPP P P PP P PPP P PP+ Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPT 103 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/63 (36%), Positives = 25/63 (39%) Frame = -1 Query: 881 GGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G R R GG GG GGG G GG + G GG G G GG Sbjct: 1249 GGGGGAFSSRDYRQ--HRGGSSGGGMHGGGGGYGNYGGYGG---YGGNPQGGYGFAGYGG 1303 Query: 701 RXG 693 + G Sbjct: 1304 QYG 1306 Score = 32.3 bits (70), Expect = 0.59 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGG--XGGGXXXXXXGXGGGVVWXGXXXGGGGXX 714 G GG R R G GG GG GG GG GG + G GG Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPR 1309 Query: 713 GGG 705 GGG Sbjct: 1310 GGG 1312 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -2 Query: 931 GXGXGGXXXGXXGGXGXXXXGXXEGG---GGXGXGGXXGXXGGGXGGXGG 791 G GG G GG G GG GG G G G GG GG G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 G GG GG G GG GG GG G G + G GG G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGG-YGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 34.3 bits (75), Expect = 0.15 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXG--GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGX 765 GG GG G G G G GG GG G G G G Sbjct: 143 GGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGGGA 202 Query: 764 GGG-VVWXGXXXGGGGXXGGGGRXG 693 GGG V G G GGG G Sbjct: 203 GGGSVTGVGTPDDGANTDGGGAAGG 227 Score = 33.1 bits (72), Expect = 0.34 Identities = 25/83 (30%), Positives = 25/83 (30%), Gaps = 1/83 (1%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXG-GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 GG GG G G G GG E G GG GGG G Sbjct: 101 GGANTDGGGAGGSTSVGGAETDGGGADGGAATGTVLEVGTAVGGANTNGGGADNVAATGG 160 Query: 761 GGVVWXGXXXGGGGXXGGGGRXG 693 G V G G GGG G Sbjct: 161 GAVAGVGTADDGANTDGGGAGGG 183 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -1 Query: 878 GXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGR 699 G G G GG GG G G G G GG V G GGG Sbjct: 187 GVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGA 246 Query: 698 XG 693 G Sbjct: 247 AG 248 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 6/83 (7%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGX------GGGXXXXX 774 G G G G G G G G G GG GG GGG Sbjct: 107 GGGAGGSTSVGGAETDGGGADGGAATGTVLEVGTAVGGANTNGGGADNVAATGGGAVAGV 166 Query: 773 XGXGGGVVWXGXXXGGGGXXGGG 705 G G GGG G G Sbjct: 167 GTADDGANTDGGGAGGGAVTGVG 189 Score = 28.7 bits (61), Expect = 7.3 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = -1 Query: 935 GXGXXGGXXX--GXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 G G GG G G GG G G GG GGG Sbjct: 243 GGGAAGGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAGGGAVTVVGSPD 302 Query: 761 GGVVWXGXXXGGGGXXGGG 705 G G GGG G G Sbjct: 303 DGANTDGGGAGGGAVTGVG 321 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P P P PPPP PPP P PPP PP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 777 PXXXPPPXPPXPP-PXXPXFPPXPXPPPPSXXPXXXXPXPPXXP 905 P P P P PP PP P PPP PP P Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPP 233 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 730 PXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P T PPP PPP PPP S LPP P PP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPP---PPPPPEDDSIHNHEDLPP---PPPP 234 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXX---PPPXPPXPPPXPPXSPPXRXXLPPXXX 870 + PPP PP P PPP PPP PPP PP PP Sbjct: 290 IQPPPVDIQPP---PVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDI 346 Query: 871 PXPP 882 PP Sbjct: 347 QQPP 350 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP-SXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PPP PPP PP PP P PP PP P P Sbjct: 292 PPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPPP 343 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 P PPP PPP PPP PP PP PP PP Sbjct: 287 PVDIQPPPVDIQ----PPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPP 342 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 34.3 bits (75), Expect = 0.15 Identities = 26/83 (31%), Positives = 29/83 (34%), Gaps = 2/83 (2%) Frame = -1 Query: 935 GXGXXGGXXX-GXXXXXGXGGXGXXXG-GRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXG 762 G G GG G G G G G+ G+ GG G GGG G G Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQG 555 Query: 761 GGVVWXGXXXGGGGXXGGGGRXG 693 G G GGG G G+ G Sbjct: 556 WGQPPPGAGQGGGPPPPGAGQGG 578 Score = 33.5 bits (73), Expect = 0.26 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 PPPP PPPP PPP PPP P PP + P Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAG 595 Query: 868 XPXPPXPXXXXXPXXXPP 921 P P PP Sbjct: 596 QGGGPPPPGAGQGWGLPP 613 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 G G+ G+ GG G GGG G G G G GGG G G+ G Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGG 545 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = -1 Query: 935 GXGXXGGXXX-GXXXXXGXGGXGXXXGGRXXRXG-GEXGGXGGGXGGXGGGXXXXXXGXG 762 G G GG G G G GG G G+ GG G G G G G Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG 566 Query: 761 GGVVWXGXXXGGGGXXGGG 705 GG G GG G G Sbjct: 567 GGPPPPGAGQGGPPPPGAG 585 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 10/89 (11%) Frame = +1 Query: 703 PPPPXX-----PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP-- 861 PPPP PPPP PPP PPP PP PP Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPG 562 Query: 862 ---XXXPXPPXPXXXXXPXXXPPXXPXPP 939 P PP P PP Sbjct: 563 AGQGGGPPPPGAGQGGPPPPGAGQEGPPP 591 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +1 Query: 703 PPPPXX----PPPPXXXPXHTTPPPXPXXXXXXPPP 798 PPPP PPPP PPP PPP Sbjct: 579 PPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 925 GXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G GG G GGGG GG G G G GG G Sbjct: 213 GKGGWENGGFGGGGSAM-AHPGGGGGYSGGGIEGSETTGSAGGGGSFNSG 261 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPL 862 PP PPPPP PP P P P+ Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDPV 102 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PPP PP P PPPP P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PPP PPP P PP P PPP + P Sbjct: 73 PPPLCAPPPPPPP--PPPPPPPPGAKKP 98 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPP 819 TPPP PPP PP PPP Sbjct: 72 TPPPLCAPPPPPPPPPPPPPPP 93 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PPP PP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXP 850 PP PPPP PP PP P Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXP 771 PPPP PPPP P P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PPP PP PP PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPP----PPPGAKKPDDP 101 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPP 765 PPP PPPP P PPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPP 860 P PP PP PPP P P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P PPP P PPP PP P P P Sbjct: 73 PPPLCAPP---PPPPP------PPPPPPPPGAKKPDDP 101 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPP 728 +PP P PPPPP PP Sbjct: 72 TPPPLCAPPPPPPPPPPPPP 91 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 74 PPLCAPPPPPPPPPPPPPP 92 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 825 PXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P P PP P P P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRP 75 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P P P PP PP P+ P P P P P P P Sbjct: 35 PPIPHGPRP----LPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 760 PPXPXXXXXXPP-PXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PP P PP PP P P PP + P LP P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRP 75 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 +PP P P P TP P P P P P P P S P Sbjct: 34 VPPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPP 860 P PP P PPP P P P P P Sbjct: 46 PLREPPTPAPTPPPALPSTPTLPLAPRP 73 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 796 PXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P PP PP +PP PP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXP 872 P P PP P PP P PPP P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTP 252 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 P P PP P +T PPP PPP P PP Sbjct: 227 PASPKPPTAPP-NTPPPPVTP-----PPPNTPGPP 255 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 685 PXXPXLPP-PPXXPPPPXXXPXHTTPPP 765 P P P PP PPPP P TP P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPP 861 PP PP PP P PP PP Sbjct: 232 PPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP 860 PP PP PP P PP P P P Sbjct: 232 PPTAPPNTPP-PPVTPPPPNTPGP 254 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGG 720 GG GG GGG GG GGG G G + G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFGSAYAAVPVSGTG 3737 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 EGGG G GG G GGG G GG G Sbjct: 3697 EGGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGG 759 E GG GGG GG GGG G GG Sbjct: 3697 EGGGYGGGGGGYGGGGGGYGDGTGG 3721 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPL 862 PP PPPPP PP P P P+ Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDPV 303 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPP 896 PPP PP P PPPP P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 PPP PPP P PP P PPP + P Sbjct: 274 PPPLCAPPPPPPP--PPPPPPPPGAKKP 299 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPP 819 TPPP PPP PP PPP Sbjct: 273 TPPPLCAPPPPPPPPPPPPPPP 294 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 763 PXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P PPP PP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXP 850 PP PPPP PP PP P Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXP 771 PPPP PPPP P P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP PPP PP PP PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPP----PPPGAKKPDDP 302 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPP 765 PPP PPPP P PPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPP 860 P PP PP PPP P P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P PPP P PPP PP P P P Sbjct: 274 PPPLCAPP---PPPPP------PPPPPPPPGAKKPDDP 302 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPP 728 +PP P PPPPP PP Sbjct: 273 TPPPLCAPPPPPPPPPPPPP 292 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 275 PPLCAPPPPPPPPPPPPPP 293 >SB_11360| Best HMM Match : PDZ (HMM E-Value=0) Length = 625 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 9/61 (14%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXP---------PXPPPXPPXSPPXRXXLPPXXXPX 876 P P P T PPP P P P P P P PP SP LP Sbjct: 114 PSPPTLPKQTPPPPTPEVIETAPSPSPGENGEVNHVPPESPVPPASPQSTNSLPKKTPAV 173 Query: 877 P 879 P Sbjct: 174 P 174 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP 825 P P LP PP P +P P PP P PP P Sbjct: 114 PSPPTLPKQTPPPPTPEVIETAPSPSPGENGEVNHVPPESPVPPASP 160 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 856 GGGXGXGGXXGXXGGGXGGXGGG 788 GGG G GG G GGG GG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG G GG G G R G G G Sbjct: 455 GGGGGGGGGSGGSSPSHRSSGSSSSSSSRRSSPSGSPAIPTPSGSSSGSSIVRRPRRRRG 514 Query: 758 GVVWXGXXXGGGGXXGGGGRXG 693 G G GGGG GGGGR G Sbjct: 515 G----GGGGGGGGGGGGGGRGG 532 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G R G GGG GG GGG G G G Sbjct: 498 GSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGGRGRG 536 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGG--GGXXGGGGRXG 693 G GG GG G GG G GGG G GG GG GG G Sbjct: 156 GHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDG 205 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PP PP PPP P P PPPP P Sbjct: 77 PAAVIPPPPPPPPPASNV--PAPPPPPPVMPP 106 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P PPPP PPP P PPP PP PP Sbjct: 77 PAAVIPPPP--------PPPPPASNVPAPPPPPPVMPP 106 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXP----PXPPPXPPXSPPXR 846 TT P PPP P P PPP PP PP + Sbjct: 73 TTDGPAAVIPPPPPPPPPASNVPAPPPPPPVMPPQK 108 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPP 765 +PPPP PPP P PPP Sbjct: 81 IPPPPPPPPPASNVPAPPPPPP 102 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 804 PXPPPXXPXFPPX-PXPPPPSXXPXXXXPXPP--XXPXXXPPXPXPP 935 P PPP P PPPP P PP PP P PP Sbjct: 568 PLPPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPP 614 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P PPPP +T+ PP P P P PPP Sbjct: 582 PIPPPPPQMN--NTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXP 905 PP P PPPP+ P PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P PPP P P PP PPP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 849 PPPPSXXPXXXXPXPPXXPXXXPP 920 PPPP P P PP P PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP + P PPPPP PP Sbjct: 88 PPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 P L PPPP + PPP PP P PP Sbjct: 572 PEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXP 905 PP P PPP S P P P P Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 839 GGEXG-GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G + G G GGG GG GGG G V G GGGG GG G Sbjct: 236 GSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLG--SGGGGSWGGAG 280 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 839 GGEXGGXGGGXGG--XGGGXXXXXXGXGGGVVWXGXXXGGG 723 GG GG GGG GG G G GGG W G GGG Sbjct: 244 GGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGG--AGGG 282 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGG 789 G G G G GG G G + G GG GG GGG Sbjct: 234 GAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGG 282 >SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 +PP PPP P P P P P PP P P L P P P Sbjct: 1 MPPATDPIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPEVDPIL-PEIDPIP 59 Query: 880 P 882 P Sbjct: 60 P 60 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP--PXRXXLP 858 P +PPP P PP P PP P P P P P P +P Sbjct: 3 PATDPIPPPKLEPIPPEIDP---IPPEVDTISPEIDPIPPDINPILPEVDPILPEIDPIP 59 Query: 859 PXXXPXPPXP 888 P P P P Sbjct: 60 PDITPIDPTP 69 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +1 Query: 685 PXXPXLPP--PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P + P P P PP P TPP P PP P P P +P Sbjct: 43 PILPEVDPILPEIDPIPPDITPIDPTPP-CADPIPAVADPIPPNMEPIPDSIPKGTNPIP 101 Query: 859 PXXXP 873 P Sbjct: 102 LRSDP 106 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = +3 Query: 693 PXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXP 872 P PPP PP PP P P P P P PP P Sbjct: 7 PIPPPKLEPIPPEIDPIPPEVDTISPEIDPI-PPDINPILPEVDPILPEI-DPIPPDITP 64 Query: 873 XXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P Sbjct: 65 IDPTP-PCADPIPAVADPIPPNMEP 88 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXP 744 P P LPPPP PPPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPP 81 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXP 850 P PP PPPPP PP P P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 PP PP PPP P P PPPPS Sbjct: 64 PPTLPPPPPPPPPPLP----PPPPS 84 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P +P PP PPPP P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P PPP PP PPP PP P Sbjct: 59 PTVPIPPTLPPPPPPP-PPPLPPPPP 83 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPPXP 825 T P P PPP PP PPP P Sbjct: 60 TVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 816 PXXPXFPPXPXPPPPSXXP 872 P P PP P PPPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPP 80 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPP 732 P P PPPP PPPP Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 64 PPTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXP 744 P P LPPPP PPPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPP 305 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXP 850 P PP PPPPP PP P P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 PP PP PPP P P PPPPS Sbjct: 288 PPTLPPPPPPPPPPLP----PPPPS 308 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P +P PP PPPP P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P PPP PP PPP PP P Sbjct: 283 PTVPIPPTLPPPPPPP-PPPLPPPPP 307 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPPXP 825 T P P PPP PP PPP P Sbjct: 284 TVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 816 PXXPXFPPXPXPPPPSXXP 872 P P PP P PPPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPP 304 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPP 732 P P PPPP PPPP Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 672 PPXXTXXPXPPPPPXXXPP 728 PP P PPPPP PP Sbjct: 288 PPTLPPPPPPPPPPLPPPP 306 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGG 800 +GGGG G GG G GGG GG Sbjct: 319 DGGGGGGGGGGGGGGGGGGGG 339 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG GG GGG GG GGG G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNG 364 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 862 EGGGGXGXGGXXGXXGGGXGG 800 + GGG G GG G GGG GG Sbjct: 318 DDGGGGGGGGGGGGGGGGGGG 338 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGG 756 + GG GGG GG GGG G GGG Sbjct: 318 DDGGGGGGGGGGGGG----GGGGGGG 339 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 859 GGGGXGXGGXXGXXGGGXGGXGGG 788 GGGG G GG G GGG G Sbjct: 323 GGGGGGGGGGGGGGGGGDXXXXNG 346 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 33.5 bits (73), Expect = 0.26 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP--PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P P + P PP P H PP P PP P PP P R +P Sbjct: 335 PIMPLMQAPQVGPPGNMSMPNHRPQGLPPGMPPMALSLPGMPP-PGLLPPPGMPPRLPIP 393 Query: 859 PXXXPXPPXPXXXXXP 906 P P P P Sbjct: 394 GLGLPGMPLPGMPGMP 409 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/81 (25%), Positives = 21/81 (25%), Gaps = 3/81 (3%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP---PXSPPXRXXLPPXXXPX 876 P P P PP P PP PP P PP PP P Sbjct: 330 PGQQKPIMPLMQAPQVGPPGNMSMPNHRPQGLPPGMPPMALSLPGMPPPGLLPPPGMPPR 389 Query: 877 PPXPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 390 LPIPGLGLPGMPLPGMPGMPP 410 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVV 750 G GG G GG GG+ GG G G G GGG+V Sbjct: 126 GDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGGMV 171 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXGXXXXXXXXXXXXXXWXGGXXXGGGGG 698 G +GGG G GGG G GG G GG GGG G Sbjct: 93 GDDDGGGNNDDDGVDDGVGGGGGDDSGGDDDGGGVGDDDDDDDDDDDGGGGDHGGGDG 150 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G G +G G GG GG GGG G Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDG 58 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGG 809 G G G GG GG G GGG GG GGG Sbjct: 9 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGG 54 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G G G GG GG GGG Sbjct: 4 GDDGGGGGGGNDDDGGND--NDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANN 61 Query: 767 XGG-GVVWXGXXXGGGGXXGGGG 702 GG G GGG GG Sbjct: 62 DGGYDDDGDGNDDDGGGNADRGG 84 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G + GG GGG GG G G GGGG GG G Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGA---NGDDGGGGNDDDGGNDDDDG 52 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 P P PP PP P PP PPPS Sbjct: 707 PSPSPPGPPRNAPYGPPRGRSPPPS 731 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTP 759 PPPP PPP P H P Sbjct: 881 PPPPMAPPPRSASPNHRPP 899 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXP 872 P PPP P PP P PPPP+ P Sbjct: 461 PIPPPP-PMSPPPPTPPPPATSP 482 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTP 759 P PPPP PPPP P T+P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXP 744 P P + PPP PPPP P Sbjct: 463 PPPPPMSPPPPTPPPPATSP 482 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPL 862 P PP P PP P PP P + L Sbjct: 461 PIPPPPPMSPPPPTPPPPATSPVTKL 486 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPP 762 +PPPP PPP P T P Sbjct: 462 IPPPPPMSPPPPTPPPPATSP 482 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G G +G G GG GG GGG G Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDG 98 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGG 809 G G G GG GG G GGG GG GGG Sbjct: 49 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGG 94 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G G G GG GG GGG Sbjct: 44 GDDGGGGGGGNDDDGGND--NDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGGKDDGANN 101 Query: 767 XGG-GVVWXGXXXGGGGXXGGGG 702 GG G GGG GG Sbjct: 102 DGGYDDDGDGNDDDGGGNADRGG 124 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G + GG GGG GG G G GGGG GG G Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGA---NGDDGGGGNDDDGGNDDDDG 92 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 751 TTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 T P P P P P PP PPP P PP L P P P P Sbjct: 163 TKPTPAPHSS---PSPTPP-PPPIIPPCPPVINLLIPTARPCMPPP 204 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXPXSPLXXPXXXP 883 P PPPPP PP PP P P P Sbjct: 173 PSPTPPPPPIIPPCPPVINLLIPTARPCMPP 203 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P P P H++P P P PP PP PP P R +PP Sbjct: 155 PTTTKKPTTKPTPAP---HSSPSPTP----PPPPIIPPCPPVINLLIPTARPCMPP 203 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXP-PXPXPPXP 941 P P P P P PPPP P P PP P P P P Sbjct: 161 PTTKPTPAPHSSPSPTPPPPPIIP----PCPPVINLLIPTARPCMPPP 204 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P P P P P PP P P P PPP Sbjct: 167 PAPHSSPSPTPPPPPIIPPCPPVINLLIPTARPCMPPP 204 >SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 169 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTT----PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P P P P P +T PP P PP P P SP PP Sbjct: 21 PTPRPKPRPPAKPLILPKSSTISTKPPIKPKPAVRRVPPPAPKKAPEDATSPKRNEAAPP 80 Query: 862 XXXPXPP 882 PP Sbjct: 81 PVNEVPP 87 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPP 807 PPP PPP P PPP P P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 PP P P P PP P PP P PP P P PP Sbjct: 189 PPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 810 PPPXXPXF--PPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P PP PPP P P PP P P PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/70 (25%), Positives = 19/70 (27%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 PP PP P P P PPP + PP P P P Sbjct: 102 PPLQQRQQHPPPGHPPMGGGYPGQQPGGPPPSYDSTMQQGGSYPPGQQPYPGQQAYPGQP 161 Query: 907 XXXPPXXPXP 936 P P P Sbjct: 162 GASPQGQPYP 171 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P PP H+ P P PP P P PP P P P P Sbjct: 181 PYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYP 240 Query: 883 XP 888 P Sbjct: 241 PP 242 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P P P P P P T PP P PP P P P P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETV----PPQPGSEEPEPVSQAP-EPPKPKTSAP 197 Query: 874 XPPXP 888 PP P Sbjct: 198 EPPKP 202 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 PP P PP PP P P P P PP P P P Sbjct: 158 PPQPETVPPQPETVPPQPGSEEPE--PVSQAPEPPKPKTSAPEPPKP 202 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXP--XPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P PP PP P PP P P P P PP P Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXH-TTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 P P P PP P P T PP P P P PP +P Sbjct: 146 PNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAP 197 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPX--PPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P PP P PP P P P P P P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAP 197 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 2/79 (2%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-PXPPXSPPXRXXLP-PXXXPXPP 882 PP P P P P PP P P P SPP +P P P P Sbjct: 423 PPRVEHVPFPVPVEGPPRIHPVIVPFHTPPRVEHVPFPIPVHSPPQIEKVPIPFPYPVPS 482 Query: 883 XPXXXXXPXXXPPXXPXPP 939 P P P PP Sbjct: 483 PPQIKPMPYPVPVPVRQPP 501 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFP---PXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 P P P PP P P P P PP P P P P PP Sbjct: 458 PFPIPVHSPPQIEKVPIPFPYPVPSPPQIKP---MPYPVPVPVRQPP 501 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 886 GXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G EGG G GG G GG GG GG Sbjct: 293 GITAGGTAEGGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG GG GG GG G GG V G GG Sbjct: 298 GTAEGGNAGGNGGNAGGNGGMTGGGAGGEVELGFMLDTSTSLGG 341 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G GG G G G +GG G G G G G G GG G G Sbjct: 30 GDGQAGQGGNGQGGDGQAG-------QGGNGQGGDGQAGQGGNGQGGDGPAGQGG 77 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 33.1 bits (72), Expect = 0.34 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 11/91 (12%) Frame = +3 Query: 702 PPPPXXXPPXXSXXXXXXXXXXXXXP------XXXPPPXPPXPPPXXPXFPPXPXPP--- 854 PPPP PP P PPP PP PP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGG 215 Query: 855 --PPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 PP P P PP PP P P Sbjct: 216 GIPPQNHPLTNYPAPPPQGYAPPPGGYPGAP 246 Score = 32.7 bits (71), Expect = 0.45 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 10/83 (12%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXP-----PPXP-PXPPP----XPPXSPPXRXX 852 PPP PP P + PPP P PP PPP PP P Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGG 216 Query: 853 LPPXXXPXPPXPXXXXXPXXXPP 921 +PP P P PP Sbjct: 217 IPPQNHPLTNYPAPPPQGYAPPP 239 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P PPP PP P +P PP P PP P Sbjct: 228 PAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.1 bits (72), Expect = 0.34 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPP 838 PP PPPPP PP PP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 754 TPPPXPXXXXXXPPPXPPXPPP 819 +PPP P PPP PP PPP Sbjct: 161 SPPPQP-----PPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 801 PPXPPPXXPXFPPXPXPPPP 860 PP PPP PP P PPPP Sbjct: 163 PPQPPP-----PPLPPPPPP 177 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 32.7 bits (71), Expect = 0.45 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPP 840 PPP PP P P PP PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPP 839 PPP PP P P P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXP 744 P PPPP PPPP P Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSP 859 PPPPP P PP P P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPP 838 P PP PPPP PP P Sbjct: 144 PPPPPPSPPPPCHPPALP 161 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP---PXPPXSPPXRXXLPPXXXPXPP 882 P PP P PP P PPP P P P P + P PP PP Sbjct: 270 PFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPP 329 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 777 PXXXPPPXPPXP--PPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PP P P PP FPP PPP P P PP PP Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNF-NDPAFQGRPPPFVRPP 328 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +1 Query: 703 PP--PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPX 876 PP PP PPP P + PP PPP PPP P + PP P Sbjct: 275 PPGFPPRWGPPPHMPPDYRGFPP-----PNFPPPDFSRPPPN-FNDPAFQGRPPPFVRPP 328 Query: 877 P 879 P Sbjct: 329 P 329 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/77 (28%), Positives = 24/77 (31%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 GG GG G GG GG+ + GG G GGG G Sbjct: 349 GGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQ 408 Query: 758 GVVWXGXXXGGGGXXGG 708 G G GG G G Sbjct: 409 GFPSLGGGGGGAGMMAG 425 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = -1 Query: 839 GGEXGGXGGGXG----GXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG G GG G G GGG G GGGV G G GGG Sbjct: 339 GGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGG 388 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 32.7 bits (71), Expect = 0.45 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP-----PXPPXSPPXRX 849 P P P PPP P P P P P PP P PP SP Sbjct: 138 PTSATTPIPQIPPPPTYLHPSQYPPSPPPWELPRVPSANATLPPHLQYGPPPPTSPGLCN 197 Query: 850 XLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P PP Sbjct: 198 QGYNLHQRSQPVHSMEPFPDQPPGPPPGPP 227 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 PPP P + P P PP PPP PP P R Sbjct: 187 PPPPTSPGLCNQGYNLHQRSQPVHSMEPFPDQPPGPPPGPPPLPDFR 233 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/104 (22%), Positives = 24/104 (23%) Frame = +3 Query: 621 PTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX 800 PT P + SP T P P P P P P Sbjct: 44 PTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPT 103 Query: 801 PPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P P P P P P P P P P P Sbjct: 104 KPTPTAHTPTTPTPTAHTPTKPTPKTPTPTTPTPTAHTPTTPTP 147 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/83 (24%), Positives = 22/83 (26%), Gaps = 2/83 (2%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP--XSPPXRXXLPPXX 867 P P P P P P +P P P P P P +P P Sbjct: 20 PQTTPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTP 79 Query: 868 XPXPPXPXXXXXPXXXPPXXPXP 936 P P P P P P Sbjct: 80 TPKTPTPTTSTLTKPTPATTPTP 102 Score = 29.9 bits (64), Expect = 3.1 Identities = 26/110 (23%), Positives = 29/110 (26%), Gaps = 1/110 (0%) Frame = +3 Query: 621 PTHX*PXAHSAXARXXSPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPX 800 PT P H+ + P T P P P + P P P Sbjct: 26 PTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSP--TAPTQTTPTPATPTPTT-PTPK 82 Query: 801 PPXPPPXXPXFP-PXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P P P P P P P P P P P P P P Sbjct: 83 TPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPKTPTP 132 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PPP P T PP PP PP P PP P P Sbjct: 32 PPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVP 91 Query: 874 XP 879 P Sbjct: 92 PP 93 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/79 (29%), Positives = 24/79 (30%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P + P PPP TT PP P PP P PP P Sbjct: 66 PPPPVVTEAPTTVPPPVVTDAPTTVPP-PVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPT 124 Query: 865 XXPXPPXPXXXXXPXXXPP 921 P P P P PP Sbjct: 125 TVPPPVQP--TEPPSTRPP 141 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXP 906 PP TT PP P P P PP +PP + P PP P P Sbjct: 21 PPVLTEAATTQPPAP----PPEPTQAPVADTDPPTNPPSVVEVTTTQAP-PPPPVVTEAP 75 Query: 907 XXXPP 921 PP Sbjct: 76 TTVPP 80 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTT--PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P + P PPP TT PP PPP P P PP + PP Sbjct: 81 PVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVP--PPVQPTEPPST 138 Query: 868 XPXP 879 P P Sbjct: 139 RPPP 142 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXP-XXXPPXPXPP 935 PP PP P P P PPS PP P P PP Sbjct: 32 PPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPP 80 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 709 PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PP PP PPP P PP P PP P P P Sbjct: 49 PPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPP 105 >SB_27662| Best HMM Match : Pentapeptide_2 (HMM E-Value=6.4) Length = 241 Score = 32.7 bits (71), Expect = 0.45 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 3/88 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXG---GXGGGXXXX 777 G GG G G G G G G G G GG G GG Sbjct: 149 GDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVDKGDDGGGSVD 208 Query: 776 XXGXGGGVVWXGXXXGGGGXXGGGGRXG 693 GGG V G GG G G G Sbjct: 209 KGDDGGGSVDKGDDGGGSVDKGDDGDSG 236 Score = 30.3 bits (65), Expect = 2.4 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 6/87 (6%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXG---GEXGGXGGGXGGXGGGXXXX 777 G GG G G G G G G G+ G G G GG Sbjct: 139 GDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGGGSVDKGDDGDSGSVAKGDDGGGSVD 198 Query: 776 XXGXGGGVVWXGXXXGGG---GXXGGG 705 GGG V G GG G GGG Sbjct: 199 KGDDGGGSVDKGDDGGGSVDKGDDGGG 225 Score = 29.5 bits (63), Expect = 4.2 Identities = 24/81 (29%), Positives = 26/81 (32%) Frame = -1 Query: 935 GXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G G G GG + G+ GG G GGG GGG Sbjct: 108 GDDGGGSVDKGDDGDSGSVAKGDDGGGSVDK--GDDGGGSVDKGDDGGGSVDKGDD-GGG 164 Query: 755 VVWXGXXXGGGGXXGGGGRXG 693 V G GG G G G Sbjct: 165 SVDKGDDGGGSVDKGDDGDSG 185 Score = 28.3 bits (60), Expect = 9.6 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G GG G G G G GG + G+ G G G GG Sbjct: 88 GDDGGGSVDKGDDGGGSVDKGDDG-----GGSVDK--GDDGDSGSVAKGDDGGGSVDKGD 140 Query: 767 XGGGVVWXGXXXGGG---GXXGGG 705 GGG V G GG G GGG Sbjct: 141 DGGGSVDKGDDGGGSVDKGDDGGG 164 >SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1239 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGG 708 G GG G G + G GGG G G G GGG G GGG G Sbjct: 16 GSGGDGDGDGDDNDNDNDDVDGDGGGDDGDVDGDDDDGDGDGGGDDGDG---DGGGDDGD 72 Query: 707 G 705 G Sbjct: 73 G 73 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = +1 Query: 703 PPPPXXPPPPXXX---PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 PP P PPP P TT PP P PP PP PP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQYP 198 Query: 874 XP 879 P Sbjct: 199 PP 200 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PPP P PPP P P P P P PP P PP P Sbjct: 138 PPPGPQAPPPGSTVH--YPPPQTTMGYPSAQPGFAP--PGNYPPPPAPPPAYP 186 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/79 (26%), Positives = 22/79 (27%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 +P T PPP PP S P P PP P P PP Sbjct: 127 TPSFATTTINYPPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPA-PPPAY 185 Query: 849 PPPPSXXPXXXXPXPPXXP 905 PP P P P Sbjct: 186 PPVTQGYNMSQYPPPDVAP 204 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/66 (25%), Positives = 18/66 (27%) Frame = +1 Query: 742 PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPP 921 P PPP P P P +PP PP P P PP Sbjct: 140 PGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQYPP 199 Query: 922 XXPXPP 939 PP Sbjct: 200 PDVAPP 205 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 P P PPP PP P P P P P P PP P Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAP-PGNYPPPPAPPPAYP 186 >SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) Length = 355 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXP 879 PP P PPP P TT P P P PP P P +P L P P Sbjct: 253 PPAPVFTPPP---PYRTTAKPFPKMSLTPTPKKPPV-PKKPVLTPAQLEGLLKSPSPLP 307 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPPXXXP 931 PPP P P PP P P P P P P P Sbjct: 252 PPPAPVFTPPPPYRTTAKPFPKMSLTP-TPKKPPVPKKPVLTP 293 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P LPPPP PPP TT PP Sbjct: 183 PTLPPPPTTTPPPTTTQATTTNPP 206 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPP 798 PPP PPPP TTPPP PP Sbjct: 181 PPPTLPPPPT-----TTPPPTTTQATTTNPP 206 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPPP PPPP TP P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAP 324 Score = 29.5 bits (63), Expect(2) = 0.45 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPP 854 PPP PPP P P P PP Sbjct: 304 PPPPQTPPPPQTPAPPQTPAPP 325 Score = 21.8 bits (44), Expect(2) = 0.45 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 693 PXPPPPPXXXPP 728 P PPPP PP Sbjct: 301 PQTPPPPQTPPP 312 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 29.9 bits (64), Expect(2) = 0.57 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPS 863 P PP PPP P PPPP+ Sbjct: 1048 PFPPPPPPYQTGSPIRAFPPPPA 1070 Score = 21.0 bits (42), Expect(2) = 0.57 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = +3 Query: 546 SPKDXGPKAXTSDSKQRSAMIGDHLPTHX*PXAHSAXARXXSPPXXTXXPXPPPPP 713 SP G A +S S ++ A L + P ++ + P PPPPP Sbjct: 1001 SPSSDGHLADSSSSIEQMASTRGSLFSL--PRSNGMLHHNIAHEPIMEEPFPPPPP 1054 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 833 EXGGXGGGXGGXGGGXXXXXXGXGGG 756 E GG GGG GG GG G GGG Sbjct: 367 EGGGRGGGRGGGRGGFRGGRGGRGGG 392 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 860 GGRXXRXGGEXGGXGGGXGGXGGG 789 GGR GG GG GG GG GGG Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGG 392 >SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 961 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR---XXLPPXXXPXPP 882 P P H PPP P PP P PP R PP P PP Sbjct: 815 PVSEPPTHKPPPPQYSAKRGCPGSEPPPHKPLPPHFSAKRGCPVSYPPTHKPSPP 869 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 32.3 bits (70), Expect = 0.59 Identities = 22/85 (25%), Positives = 23/85 (27%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGG 759 G G GG G GG+ G G G GG G G Sbjct: 471 GAIGCDGGGGANVGGDIGGNNGAIGGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNG 530 Query: 758 GVVWXGXXXGGGGXXGGGGRXGXXG 684 G G G GGG G G Sbjct: 531 GGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 1/69 (1%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXG-GXGGGXXXXXXGXGGGVVWXGXXXGGGGXXG 711 G G GG GG G G G G GGG G G G G Sbjct: 436 GIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIG 495 Query: 710 GGGRXGXXG 684 G G G Sbjct: 496 GDNDDGAIG 504 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G G G G G G G GG G G G G G GGG G Sbjct: 501 GAIGGDDGATVDGDDGAIGGGAIGD---GGDNGGGDDGGDDGAGNSDGGGGNDNG 552 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTP-PPXPXXXXXXPPPXPPXPPP 819 P P PPP PPP P P P PP PPP Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 P PPP P PPP P P P PP P P Sbjct: 944 PPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSP 991 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P P PP PP PP P P P PP P P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 804 PXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PPP P P P PPP S P P PP P P Sbjct: 942 PTPPPSPP--PKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/74 (29%), Positives = 24/74 (32%), Gaps = 5/74 (6%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP-----PXRXXLPPX 864 +P P P TPPP PPP P PPP SP P + Sbjct: 925 IPSPEPLPEVDIMRSPTPTPPPS-------PPPKEPTPPPSSKPSPVKEIKPKKPIEKFI 977 Query: 865 XXPXPPXPXXXXXP 906 P PP P P Sbjct: 978 SRPKPPTPPPVVSP 991 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/82 (24%), Positives = 20/82 (24%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P T P PPP PP P PP PPP P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSPH-KQTRPI 998 Query: 855 PPSXXPXXXXPXPPXXPXXXPP 920 P P P P P Sbjct: 999 SPVGASNLYKPLTPTSPSTLQP 1020 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXX-----GXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G GG G GG G GG G +GG G GG GG GGG Sbjct: 641 GIGGGGMGGGFSGQGGGFPTSQAQADGFGTSQGGFGASQGGFGASQGGFGAKMGGG 696 Score = 30.3 bits (65), Expect = 2.4 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = -1 Query: 938 GGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGG-XGGGXXXXXXGXG 762 G G GG G GG+ G G G GG GGG G G Sbjct: 596 GVSGSGGGSQWGSFGQAAPTSQSSGFGGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQG 655 Query: 761 GGVVWXGXXXGGGGXXGGG 705 GG G G GG Sbjct: 656 GGFPTSQAQADGFGTSQGG 674 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG G GG GG GG G GG + G GG GGG Sbjct: 1197 GGYDGSDDGGDGGYGGSDGGGDGGYGG-IDSGGDGGCDGGIDGGG 1240 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGG 726 G G GG G GGG GG GG G GG+ G GG Sbjct: 1197 GGYDGSDDGGDGGYGGSDGGGDGGYGGIDSGGDGGCDGGI--DGGGDGG 1243 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS 863 PPP PP PP P P PPPPS Sbjct: 583 PPPHPP-PPAHHVNKPGVPPPPPPS 606 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 792 PPXPPXPPP--XXPXFPPXPXPPP 857 PP PP PPP P PP P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 834 PPXPXPPPPSXXPXXXXPXPPXXP 905 PP P PPP P P PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXP 883 PPPPP P PP P P+ P P Sbjct: 81 PPPPPIYMPPPPVYMPPPPVYMPPPMP 107 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P P P PPP P PP +PP PP Sbjct: 63 PSYQPSCCQQQQPMMMPFPPPPPIYMPPPPVYMPPPPVYMPP 104 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPP 920 P P PPP PP PPPP P PP P P Sbjct: 75 PMMMPFPPP-----PPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P P P P P PPPP P PP PP P P Sbjct: 59 PSCAPSYQPSCCQQQQPMMMPFP-PPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PPPP P PPP PPP PPP P P Sbjct: 79 PFPPPPPIYMP----PPP-----VYMPPPPVYMPPPMPMGDVP 112 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPL 862 P P PPPP PP P P P+ Sbjct: 83 PPPIYMPPPPVYMPPPPVYMPPPMPM 108 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 694 PXLPPPPXX-PPPPXXXPXHTT--PPPXP 771 P PPPP PPPP P PPP P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G G GG GG G G G G +G GG G G GGG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHG-GDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 G G G GGR G GG GG G GG G GG Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGG 82 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -1 Query: 839 GGEXGGXGGGXG-GXGGGXXXXXXGXGGGVVWXGXXXGGG-GXXGGGG 702 GG GG GGG G G G G G G G G G G GGGG Sbjct: 40 GGHGGGHGGGRGRGRGHGHGGDVGGDDGD---GGNCDGDGYGDVGGGG 84 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 839 GGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 GG GG G G G GG G GG G GGG G Sbjct: 44 GGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGGDDDDG 89 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 818 GGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG-GRXGXXG 684 GGG GG GG G G G G GG G G G G G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGG 84 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 934 GGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G GG G GG G GGG G G G G GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGS---NGGGGDDDGSNGGGGDDDGSNGGG 143 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G GG G G GGG GGG G GGG G G Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDD-DGSNGGGGDDDGSNG 141 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 31.9 bits (69), Expect = 0.78 Identities = 25/87 (28%), Positives = 26/87 (29%), Gaps = 5/87 (5%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXX---PXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXL 855 P PP P PP P PPP P PPP PP P + Sbjct: 32 PAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPP--PSGQYGA 89 Query: 856 PPXXXP--XPPXPXXXXXPXXXPPXXP 930 PP P PP PP P Sbjct: 90 PPTSQPYGAPPTSGYPGYQQHPPPPQP 116 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPS----XXPXXXXPXPPXXPXXXPPXP 926 PP P PP +PP P PPS P P P PP P Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPP 72 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P PP PP +PP PPP P P P P P Sbjct: 34 PGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPP 83 Score = 28.3 bits (60), Expect = 9.6 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +1 Query: 685 PXXPXLPP--PPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXP--PXSPPXRXX 852 P PP P PP P P P P PP PPP P PP Sbjct: 17 PYMGGYPPAAPGGYPPAPGGYP--PAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGI 74 Query: 853 LPPXXXPXPPXPXXXXXPXXXPPXXP 930 P P PP P P P Sbjct: 75 APGIGGP-PPSGQYGAPPTSQPYGAP 99 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 757 PPPXPXXXXXXP-PPXPPX---PPPXPPXSPPXRXXLPPXXXP 873 PPP P PP P PPP PP PP + +P P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPPQQFIPSPQFP 474 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 PPP PP PPP P PPP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPP 464 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPP 857 PP P PP P PP P PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 801 PPXPPPXXPXFP-PXPXPPPP 860 PP PP P P P P PPPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPP 49 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXP 835 P PP P PPP PP P Sbjct: 34 PLPPFAPLPPPVPPPPP 50 >SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) Length = 277 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +1 Query: 721 PPPPXXXPXHTTPPPXPXXXXXX--PPPXPPXPPPXPPXS-PPXRXXLPPXXXPXPPXPX 891 P P P H +P P PP P P P P S PP R PP P P Sbjct: 149 PIHPSPFPLHPSPLPATSIPPSRYIHPPFPLHPSPLPATSIPPSRYIHPPFPLHPSPLPA 208 Query: 892 XXXXP 906 P Sbjct: 209 TSIPP 213 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +1 Query: 700 LPPPPXXPPPPXXXPXHTTPPPXPXXXXXX--PPPXPPXPPPXPPXS-PPXRXXLPP 861 +PP PP P H +P P PP P P P P S PP R PP Sbjct: 167 IPPSRYIHPP---FPLHPSPLPATSIPPSRYIHPPFPLHPSPLPATSIPPSRYIHPP 220 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 PPP P + P P P P PP P P P LP PP P Sbjct: 37 PPPSSVPV-SYPGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPPP 90 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 777 PXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P P P PPP P P PP P P P P PP Sbjct: 38 PPSSVPVSYPGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPPP 90 >SB_59527| Best HMM Match : DUF382 (HMM E-Value=4.1e-26) Length = 800 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P PPP PP + PP P P P P P P Sbjct: 200 PPIQP-PPPTPPMDHTQKVDSPPAKLQVEPAPQEPQEPQYLIPKEPQEP 247 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P P P PP P TT P PP P P PP PP Sbjct: 678 PQTTVSPGTPVPPTDDPDCTTETP-DTQPPTQPPVTQPPDTPVPPTQPP 725 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/68 (29%), Positives = 23/68 (33%) Frame = +3 Query: 669 SPPXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPX 848 +PP T P P PP P + P PP PP P P P P Sbjct: 676 APPQTTVSPGTPVPPTDDPDCTT-----------ETPDTQPPTQPPVTQP--PDTPVPPT 722 Query: 849 PPPPSXXP 872 PP + P Sbjct: 723 QPPVTDAP 730 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPP-PXPPXSPPXRXXLPPXXXPXPP 882 P P P P PP PP P P +PP R PP P P Sbjct: 511 PTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRS--PPAAAPCNP 551 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXP 871 P PP PP P P PP P +P P Sbjct: 527 PSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXP 918 P P P PPP P PP PP + P + P P P P Sbjct: 522 PAPQPPSPPA-PPPKPAPPPRSPPAAAPCNPAMAPQGCNSMQQPGMYQQPSYIP 574 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/82 (25%), Positives = 22/82 (26%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXP 873 P PPPP PPPP P P P P + P P Sbjct: 454 PQGPPPP--PPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAP 511 Query: 874 XPPXPXXXXXPXXXPPXXPXPP 939 P PP P PP Sbjct: 512 TYSPSCCGSYPAPQPPSPPAPP 533 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/91 (24%), Positives = 22/91 (24%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P P PPPP P P P P Sbjct: 454 PQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTY 513 Query: 855 PPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 PS P PP P PP P PP P Sbjct: 514 SPSCCGSYPAPQPPSPP-APPPKPAPPPRSP 543 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPP 819 P +P PP PPP PP P PP PP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 789 PPPXPPXPPP-XXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P P PPP PP P PPP S P P P P P Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQP-PLSPPVGKPVVP 299 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 P P P P T PPP PP PP PP PP P P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLS---PPVGKPVVP 299 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/59 (28%), Positives = 20/59 (33%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P P + P PPP P + P P PP PP SPP + P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPP---PLPPPDSSEAQAQQPPLSPPVGKPVVP 299 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXP 941 P P PPP P PPP P P PP P P Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/57 (36%), Positives = 24/57 (42%) Frame = +3 Query: 237 QMGGGKVFGTLGQNDDGLFGKAGYNREIFNDDRGKLTGQAYGTRVLGPGGDSTNYGG 407 Q G G FGT GLFG AG N G +TG +G ST +GG Sbjct: 48 QTGFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFGQPA---SAASTGFGG 101 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLP 858 PPP PP PPP PP R P Sbjct: 211 PPPPPPPPPPPPPPMLARRWYYP 233 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 6/52 (11%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTP-----PPXPXXXXXXPPPXPPXPPPXP-PXSPP 840 P PP PPPP HT P PP P P P P P PP Sbjct: 362 PRPPMGPPPPPGFNLHTGPRLHMGPPPSGFHAQRGPQPEMGPTPQPHPYVPP 413 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXP-----PPPSXXPXXXXPXPPXXPXXXPPXPXPP 935 P PP PP P F P PPPS P P P P PP Sbjct: 362 PRPPMGPPPPPGFNLHTGPRLHMGPPPSGFHAQRGPQPEMGPTPQPHPYVPP 413 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 25.8 bits (54), Expect(2) = 0.82 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 789 PPPXPPXPPP 818 PPP PP PPP Sbjct: 252 PPPPPPPPPP 261 Score = 24.6 bits (51), Expect(2) = 0.82 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 834 PPXPXPPPPS 863 PP P PPPPS Sbjct: 253 PPPPPPPPPS 262 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 9.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 790 PPPXPPXPPPXP 825 PPP PP PPP P Sbjct: 794 PPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 9.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 793 PPXPPXPPPXPP 828 PP PP PPP PP Sbjct: 794 PPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 9.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 803 PPPPPXXPPXPP 838 PPPPP PP PP Sbjct: 794 PPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect(2) = 0.95 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXP 845 PPP PP PPP P P Sbjct: 795 PPPPPPPPPPPEDLIIPLP 813 Score = 21.8 bits (44), Expect(2) = 0.95 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 684 TXXPXPPPPP 713 T P PPPPP Sbjct: 793 TPPPPPPPPP 802 >SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 25.0 bits (52), Expect(2) = 0.96 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP 765 P PPPP PP T PP Sbjct: 1003 PSSPPPPELPPKEKKVAEDTNCPP 1026 Score = 25.0 bits (52), Expect(2) = 0.96 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPP 840 P PP PP PP PP Sbjct: 1057 PVVKPPSYPPPPPPKPP 1073 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 791 PPXXPPPPPXXPPXPPXXXP 850 PP PPP P PP PP P Sbjct: 147 PPRTPPPEPTPPPTPPPLRP 166 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 793 PPXPPXPPPXPPXSPPXRXXL 855 PP P PPP PP P R L Sbjct: 151 PPPEPTPPPTPPPLRPLRHNL 171 >SB_8210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1935 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 760 PPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPP 882 PP PP P PP SP + +PP P PP Sbjct: 1622 PPWTRCQSKKPPWTAPDPPVDSARSPRGQSQIPPWTEPDPP 1662 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 795 PXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXP 932 P PPP P P P P + P P P P PP P P Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVT--PQTPSPASPGLPFMPPPPPPP 94 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS 834 P P + PP PP P P P P P PPP PP S Sbjct: 48 PGWPQMGMPP--PPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPPS 95 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 P PPPP P P P P P P P PP PP Sbjct: 51 PQMGMPPPPG--PGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPP 93 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 803 PPPPPXXPPXPPXXXPXSPLXXPXXXPXPPXXXPXPXPP 919 PPPP P P +P P P P P PP Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPP 860 P P P P P P P PPPP Sbjct: 70 PQVTPQTPSPASPGLPFMPPPPPP 93 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 856 GGGXGXGGXXGXXGGGXGGXGG 791 GGG G GG G GG GG GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 743 GXXXGGGGXXGGGGRXGXXG 684 G GGGG GGGGR G G Sbjct: 1004 GGGGGGGGGGGGGGRRGGRG 1023 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 824 GXGGGXGGXGGGXXXXXXGXGG 759 G GGG GG GGG G GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 871 GXXEGGGGXGXGGXXGXXGGGXG 803 G GGGG G GG G GG G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 827 GGXGGGXGGXGGGXXXXXXGXGGG 756 GG GGG GG GGG G G Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARG 1027 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P P P P PP P PPP P P Sbjct: 79 PPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 123 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P P P PPP P P PPP P PP P PP P Sbjct: 69 PTQGFRPYPGPPPALSPQVYRGYPFQY-------PGTPPPPMYPAFPPSFPSSPPPEYPG 121 Query: 855 PPSXXPXXXXPXP 893 P P P Sbjct: 122 LPVSSPGRVCTRP 134 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P PPP P P PP P PP P PP LP Sbjct: 75 PYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 123 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXP 871 P PP P PP P PP P P+ P Sbjct: 99 PPPPMYPAFPPSFPSSPPPEYPGLPVSSP 127 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 724 PPPXXXPXHTTPPPXPXXXXXXPPPXP-PXPPPXPPXSP 837 PP P H P P P PP P P P PP P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 706 PPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPP 816 PPP PPP P TTP P P PP PP Sbjct: 432 PPPLPQPPPSIIPPPTTPLPQTV-------PTPPRPP 461 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 790 PPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXP 888 P PP P P P PP L P P PP P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPL-PQTVPTPPRP 460 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 810 PPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXP 926 P P PP PPPS P P P P PP P Sbjct: 424 PGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVP--TPPRP 460 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 757 PPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXXXPPXXPXP 936 PPP P P PP P P P R P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEP--EPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEP 288 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 1/66 (1%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPX-HTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPP 861 P PP P P P P P P P P P P P P P Sbjct: 235 PQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 Query: 862 XXXPXP 879 P P Sbjct: 295 VHVPEP 300 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 789 PPPXPPXPPPXXPXFPPXPXPPPPSXXPXXXXPXPPXXPXXXPPXPXPPXPXP 947 P PP P P P P P P P P P P P P Sbjct: 242 PAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 4/86 (4%) Frame = +1 Query: 694 PXLPPP--PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPX--PPXSPPXRXXLPP 861 P PP P P P P P P PP P PP P PP R +PP Sbjct: 556 PGAPPTSQPGFPSPQMQEPMQL-PTSQPGGF---PPQQRPGAPPTSQPGGFPPQRPGMPP 611 Query: 862 XXXPXPPXPXXXXXPXXXPPXXPXPP 939 P P P P P Sbjct: 612 MSQPSSMHMQPSGQPQSTAPQQPSQP 637 Score = 29.1 bits (62), Expect = 5.5 Identities = 21/79 (26%), Positives = 22/79 (27%), Gaps = 3/79 (3%) Frame = +1 Query: 694 PXLPPPPXXPPP--PXXXPXHTTPPPXPXXXXXXPPPX-PPXPPPXPPXSPPXRXXLPPX 864 P P P P P P P P P PP P PP S P + P Sbjct: 564 PGFPSPQMQEPMQLPTSQPGGFPPQQRPGAPPTSQPGGFPPQRPGMPPMSQPSSMHMQPS 623 Query: 865 XXPXPPXPXXXXXPXXXPP 921 P P P P Sbjct: 624 GQPQSTAPQQPSQPLRPHP 642 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 887 GXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGG 789 G GG G GG GG G G G G G G Sbjct: 1130 GDGGNGDGDGGNGDGDGGNGDGDGDGGNGDGDG 1162 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 836 GEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGGRXGXXG 684 G GG G GG GGG GGG G GGG GG G Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGG----GGYSGGGLASSGGSTLSSEG 374 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 920 GGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGG 756 GG G GG G R GG G GGG GG G GG Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRP---GGGGGYSGGGLASSGGSTLSSEGGVAGG 379 Score = 28.7 bits (61), Expect = 7.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 6/63 (9%) Frame = -2 Query: 946 GXGXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXG------GGXGGXGGGX 785 G G G GG GG G GGGG GG G GG G GG Sbjct: 329 GSGGSGTSEGG-----FGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSY 383 Query: 784 XXG 776 G Sbjct: 384 NNG 386 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = -1 Query: 872 GXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXG--GGGR 699 G G R GG G G G GG G GG G GGGG G GGG+ Sbjct: 420 GSNDGFTQMRGGGRGGFRGNRGGFRGGNERGQRRGGRGG---HGPPRGGGGFSGPRGGGQ 476 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 918 GGXGXGXXXGGXGXXXGXXRGEXGXXXGGXGGXXGGGG--GXXGG 790 GG G G G RG+ GG G GGGG G GG Sbjct: 430 GGGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGG 474 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR--XXLPP 861 P PP P PP P HT P P P P P +PP PP Sbjct: 387 PSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTPSHTPP 446 Query: 862 XXXP--XPPXPXXXXXPXXXPPXXPXP 936 P PP P P P Sbjct: 447 VSTPSHTPPVSTPSHTPPVSTPSHTPP 473 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR--XXLPP 861 P PP P PP P HT P P P P P +PP PP Sbjct: 405 PSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPP 464 Query: 862 XXXP--XPPXPXXXXXPXXXPPXXPXP 936 P PP P P P Sbjct: 465 VSTPSHTPPVSTPSHTPPVSTPSNTPP 491 Score = 30.3 bits (65), Expect = 2.4 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 4/80 (5%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR--XXLPP 861 P PP P PP P HT P P P P P +PP PP Sbjct: 423 PSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPP 482 Query: 862 XXXPXPPXPXXXXXPXXXPP 921 P P P PP Sbjct: 483 VSTPSNTPP--VFTPSHTPP 500 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 4/74 (5%) Frame = +1 Query: 727 PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR--XXLPPXXXP--XPPXPXX 894 PP P HT P P P P P +PP PP P PP Sbjct: 382 PPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSNTPPVSTP 441 Query: 895 XXXPXXXPPXXPXP 936 P P P Sbjct: 442 SHTPPVSTPSHTPP 455 Score = 29.1 bits (62), Expect = 5.5 Identities = 32/123 (26%), Positives = 34/123 (27%), Gaps = 6/123 (4%) Frame = +1 Query: 571 PXXRTPSRDPP*LVITSXXXXXXXXXXXXXXXXXXXXXPXXPXLPPPPXXPP--PPXXXP 744 P TPS PP ++ P PP P PP P Sbjct: 418 PPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTP 477 Query: 745 XHTTP--PPXPXXXXXXPPPXPP--XPPPXPPXSPPXRXXLPPXXXPXPPXPXXXXXPXX 912 HT P P P PP P PP S P PP P P P Sbjct: 478 SHTPPVSTPSNTPPVFTPSHTPPVFTPSHTPPVSTPSNS--PPVSTPSNTLP--VFTPSH 533 Query: 913 XPP 921 PP Sbjct: 534 TPP 536 Score = 28.3 bits (60), Expect = 9.6 Identities = 23/85 (27%), Positives = 25/85 (29%), Gaps = 4/85 (4%) Frame = +1 Query: 694 PXLPPPPXXPP--PPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P + P PP P P +TP P P P PP S P PP Sbjct: 418 PPVSTPSHTPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSH--TPPVS 475 Query: 868 XP--XPPXPXXXXXPXXXPPXXPXP 936 P PP P P P Sbjct: 476 TPSHTPPVSTPSNTPPVFTPSHTPP 500 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 685 PXXPXLPPPPXXPP-PPXXXPXHTTPPPXPXXXXXXPPPXPP 807 P P PP P PP P P H PP P PP P Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 PP P PP P P PP PP P P P P P R Sbjct: 405 PPRPMGPPGPHGPPFGPRGPP----PHGGPPRGPMGPGPGMPPMRPGR 448 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +3 Query: 699 PPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPPPPSXXPXX 878 P PP PP P P P PP P PP P PP Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPP-PHGGPPRGPMGP 437 Query: 879 XXPXPPXXP 905 PP P Sbjct: 438 GPGMPPMRP 446 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 792 PPXPPXPPPXXPXFPPXPXPPPPS 863 PP PP PP PP P P P S Sbjct: 791 PPTPPPPPRVMNGLPPSPPPSPVS 814 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +3 Query: 675 PXXTXXPXPPPPPXXXPPXXSXXXXXXXXXXXXXPXXXPPPXPPXPPPXXPXFPPXPXPP 854 P P P PPP P P PPP P PP P PP P Sbjct: 159 PTQGFRPFPGPPPVLSPQVYRGYPFQY-------PGTPPPPMYPAFPPSFPSSPPPEYPG 211 Query: 855 PPSXXPXXXXPXP 893 P P P Sbjct: 212 LPVSSPGRVSTRP 224 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 712 PXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLP 858 P PPP P P PP P PP P PP LP Sbjct: 165 PFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 213 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSP 837 PPP P P P P PP P PPP P P Sbjct: 169 PPPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPPEYPGLP 213 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 785 PXPPXXPPPPPXXPPXPPXXXPXSPLXXP 871 P PP P PP P PP P P+ P Sbjct: 189 PPPPMYPAFPPSFPSSPPPEYPGLPVSSP 217 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -1 Query: 860 GGRXXRXGGEXG-GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGG 705 GG GGE G G G GG GGG G ++ G GGGG GGG Sbjct: 241 GGSAYVNGGEGGLGTTGSEGGFGGG--------GAAFLYAG---GGGGYSGGG 282 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGG 788 G G G GG G EGG G G G GGG G GGG Sbjct: 233 GASGVNATGGSAYVNGGEGGLGTTGSEGGFG-GGGAAFLYAGGGGGYSGGG 282 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGGGXXXG 776 G GG G G G GG GGGG GG G GG G Sbjct: 249 GEGGLGTTGSEGGFGGGGAAFLYAG--GGGGYSGGGVTRATRYSKSGGGGSYNAG 301 Score = 28.7 bits (61), Expect = 7.3 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 947 GXXGGXGXXGGXXXGXXXXXGXGGXGXXXGGRXXRXGGEXGGXGGGXGGXGGGXXXXXXG 768 G G G GG G GG G GG R GGG G G G Sbjct: 251 GGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAGSGQEGEVRG 310 Query: 767 XGG 759 G Sbjct: 311 QKG 313 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPX 864 P P P P P P P P P P P P P PP P Sbjct: 68 PLEPHRPLEPHRPLEPHR-PQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPH 126 Query: 865 XXPXPPXPXXXXXPXXXPPXXPXPP 939 PP P P P P P Sbjct: 127 RPLEPPRPQEQHRP--QEPHRPLEP 149 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXS 834 P P PP P P P P PP P P P P P S Sbjct: 107 PHRPQEPPRPQEPHRPQE-PHRPLEPPRPQEQHRPQEPHRPLEPTRPQES 155 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 824 GXGGGXGGXGGGXXXXXXGXGGGVVWXGXXXGGGGXXGGGG 702 G GGG G G G G G G G GG GGGG Sbjct: 239 GDGGGDGDGDGDGDGDGDGDGDG---DGDGDGDGGVGGGGG 276 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 685 PXXPXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPPXR 846 P P LP PP PPP + PPP PPP PP R Sbjct: 102 PRGPPLPGPPRRGPPPDRDSGY----GGYGDRYDRPPPDRRPPPPDRSGYPPPR 151 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 940 GXGGXGXGGXXXGXXGGXGXXXXGXXEGGGGXGXGGXXGXXGGGXGGXGG 791 G GG G G G G GG G GG G GGG G GG Sbjct: 1121 GMGGMGMGRMRMRPMGMMNQMNGGMMGNGGMMGNGGMMGN-GGGMMGNGG 1169 >SB_16788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1468 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPP--XPXXXXXXPPPXPPXPPPXPPXSPPXRXXLPPXX 867 P PP P P P TTP P P P P P P PP R P Sbjct: 1089 PTTEPP-RTTPEPTTEPPRTTPEPTTEPSRTKPEPTTEPSRTKPEPTTEPP-RTTSEPTT 1146 Query: 868 XPXPPXPXXXXXP 906 P P P Sbjct: 1147 EPLRTTPEPTTEP 1159 >SB_30346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 703 PPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPPXSPP 840 PP P PPP P T P P P PP +PP Sbjct: 18 PPEPQTPPPLSHQPYMTYQTPSRYPYTAYTPGGASSSPYPPPGAPP 63 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 694 PXLPPPPXXPPPPXXXPXHTTPPPXPXXXXXXPPPXPPXPPPXPP 828 P PPPP P +T P P P P PP PP Sbjct: 1122 PLPPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPPITINVPP 1166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,403,768 Number of Sequences: 59808 Number of extensions: 817668 Number of successful extensions: 25211 Number of sequences better than 10.0: 345 Number of HSP's better than 10.0 without gapping: 2177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9127 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -