BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K18 (920 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 25 1.1 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 2.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.4 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 4.4 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 4.4 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 23 4.4 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +2 Query: 779 PXPQPXPXXPXPPPPTPXXXXXXPXPPPLXXPPPXXTXPPXP 904 P +P P P P P PPL PP P P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFP 190 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 508 FYGSWPFAGLLLTCSFLRYXPDSVDNR 428 FYGSW L+ L Y P V N+ Sbjct: 337 FYGSWINEESKLSLDLLSYVPREVYNK 363 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 154 KKCFICEICDAIALFVTIISCNKQVN 231 K C +C+ + I F+ II C Q N Sbjct: 522 KLCDVCDSVNRIFGFIIIIGCLIQFN 547 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 3.4 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 785 PQPXPXXPXPPP 820 P+P P P PPP Sbjct: 205 PEPVPSTPYPPP 216 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 4.4 Identities = 11/37 (29%), Positives = 11/37 (29%) Frame = +2 Query: 779 PXPQPXPXXPXPPPPTPXXXXXXPXPPPLXXPPPXXT 889 P P P P P P P PL P T Sbjct: 71 PLPSDGTTSPEPDPEIPVAPEPAPLASPLVQEPGSST 107 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 177 NFTNKAFFSLH 145 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 177 NFTNKAFFSLH 145 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,325 Number of Sequences: 336 Number of extensions: 3880 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25754817 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -