BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K16 (962 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 23 3.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 4.7 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 6.2 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 8.2 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 23.0 bits (47), Expect = 3.5 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 384 SLNDLRSYLNSIRHFYIYYVTLCYVVPRLY**YLTYHSHCLSQSDRVHILLY 539 SL +L+ I+ Y ++ ++ L +TY H L VH+ +Y Sbjct: 40 SLQELKYMERCIKEVLRLYPSVPFIARSLGEDIVTYSGHKLKAGSMVHLHIY 91 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 732 PPXXXXPPPPXPPXXP 779 PP PP P PP P Sbjct: 175 PPLPQVPPLPLPPIFP 190 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 829 PPXXXPPXXPPPPXFP 876 PP P P PP FP Sbjct: 175 PPLPQVPPLPLPPIFP 190 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPP 720 PP P PPPPP Sbjct: 202 PPTEDCDVPSTIPPPPP 218 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 685 PPXPXPXPPPPP 720 PP P P P P P Sbjct: 392 PPEPVPTPEPQP 403 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,384 Number of Sequences: 336 Number of extensions: 5610 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27202879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -