BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K16 (962 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 80 2e-15 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 77 2e-14 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 73 2e-13 At1g61080.1 68414.m06877 proline-rich family protein 72 5e-13 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 69 5e-12 At5g46730.1 68418.m05757 glycine-rich protein 69 6e-12 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 68 8e-12 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 67 2e-11 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 64 1e-10 At4g01985.1 68417.m00265 expressed protein 64 2e-10 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 63 2e-10 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 63 2e-10 At1g27710.1 68414.m03387 glycine-rich protein 62 4e-10 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 62 5e-10 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 62 7e-10 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 61 9e-10 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 61 1e-09 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 60 3e-09 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 59 4e-09 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 59 4e-09 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 59 5e-09 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 59 5e-09 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 58 9e-09 At2g05440.2 68415.m00575 glycine-rich protein 58 1e-08 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 57 2e-08 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 57 2e-08 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 57 2e-08 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 57 2e-08 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 56 3e-08 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 56 5e-08 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 56 5e-08 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 55 6e-08 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 55 6e-08 At1g26150.1 68414.m03192 protein kinase family protein similar t... 54 1e-07 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 54 1e-07 At1g04660.1 68414.m00463 glycine-rich protein 54 2e-07 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 53 3e-07 At2g30560.1 68415.m03722 glycine-rich protein 53 3e-07 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 52 4e-07 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 52 6e-07 At1g62240.1 68414.m07021 expressed protein 52 6e-07 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 52 6e-07 At5g38560.1 68418.m04662 protein kinase family protein contains ... 52 8e-07 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 52 8e-07 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 51 1e-06 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 51 1e-06 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 51 1e-06 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 51 1e-06 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 51 1e-06 At1g04800.1 68414.m00476 glycine-rich protein 51 1e-06 At4g30460.1 68417.m04325 glycine-rich protein 50 2e-06 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 50 2e-06 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 50 2e-06 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 50 2e-06 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 50 2e-06 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 50 2e-06 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 50 2e-06 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 50 3e-06 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 50 3e-06 At2g05440.1 68415.m00574 glycine-rich protein 49 4e-06 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 49 4e-06 At1g15840.1 68414.m01901 expressed protein 49 4e-06 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 49 5e-06 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 49 5e-06 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 48 7e-06 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 48 7e-06 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 48 7e-06 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 48 7e-06 At1g02710.1 68414.m00222 glycine-rich protein 48 7e-06 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 48 9e-06 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 47 2e-05 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 47 2e-05 At1g11850.2 68414.m01364 expressed protein 47 2e-05 At2g05510.1 68415.m00583 glycine-rich protein 47 2e-05 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 47 2e-05 At1g15830.1 68414.m01900 expressed protein 47 2e-05 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 46 3e-05 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 46 4e-05 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 46 4e-05 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 46 4e-05 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 46 4e-05 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 46 4e-05 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 45 7e-05 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 45 9e-05 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 45 9e-05 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 45 9e-05 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 44 1e-04 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 44 1e-04 At1g10620.1 68414.m01204 protein kinase family protein contains ... 44 1e-04 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 44 2e-04 At4g16240.1 68417.m02464 hypothetical protein 44 2e-04 At1g75550.1 68414.m08780 glycine-rich protein 44 2e-04 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 44 2e-04 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 44 2e-04 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 44 2e-04 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 44 2e-04 At5g61660.1 68418.m07736 glycine-rich protein 43 3e-04 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 43 3e-04 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 43 3e-04 At3g15400.1 68416.m01954 anther development protein, putative si... 43 3e-04 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 43 3e-04 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 42 5e-04 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 42 5e-04 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 42 5e-04 At1g23540.1 68414.m02960 protein kinase family protein contains ... 42 5e-04 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 42 6e-04 At3g24550.1 68416.m03083 protein kinase family protein contains ... 42 6e-04 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 42 8e-04 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 42 8e-04 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 42 8e-04 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 42 8e-04 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 42 8e-04 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 42 8e-04 At4g18570.1 68417.m02749 proline-rich family protein common fami... 41 0.001 At3g51290.1 68416.m05614 proline-rich family protein 41 0.001 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 41 0.001 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 41 0.001 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 41 0.001 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 41 0.001 At1g29380.1 68414.m03592 hypothetical protein 41 0.001 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 41 0.001 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 41 0.001 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 40 0.002 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 40 0.002 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 40 0.002 At4g33660.1 68417.m04781 expressed protein 40 0.002 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 40 0.003 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 40 0.003 At3g50180.1 68416.m05486 hypothetical protein 40 0.003 At1g76010.1 68414.m08825 expressed protein 40 0.003 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 40 0.003 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 39 0.004 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 39 0.004 At4g34440.1 68417.m04894 protein kinase family protein contains ... 39 0.004 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 39 0.004 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 39 0.004 At1g70990.1 68414.m08190 proline-rich family protein 39 0.004 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 39 0.004 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 39 0.004 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 39 0.004 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 39 0.006 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 39 0.006 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 38 0.008 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 38 0.008 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 38 0.008 At2g11005.1 68415.m01177 glycine-rich protein 38 0.008 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 38 0.008 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 38 0.010 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 38 0.013 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 38 0.013 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.013 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.013 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 38 0.013 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 38 0.013 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 38 0.013 At1g53625.1 68414.m06096 expressed protein 38 0.013 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 38 0.013 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 37 0.017 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 37 0.017 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.017 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 37 0.017 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 37 0.017 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 37 0.017 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 37 0.017 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 37 0.017 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 37 0.017 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 37 0.017 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 37 0.017 At1g65440.1 68414.m07424 glycine-rich protein 37 0.017 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 37 0.023 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 37 0.023 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 37 0.023 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 37 0.023 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 37 0.023 At1g49270.1 68414.m05524 protein kinase family protein contains ... 37 0.023 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 36 0.030 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 36 0.030 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 36 0.030 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 36 0.030 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 36 0.030 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 36 0.030 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 36 0.030 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 36 0.030 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 36 0.030 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 36 0.030 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 36 0.030 At1g07135.1 68414.m00759 glycine-rich protein 36 0.030 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 36 0.040 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 36 0.040 At4g15460.1 68417.m02363 glycine-rich protein 36 0.040 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 36 0.040 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 36 0.040 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 36 0.040 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 36 0.040 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 36 0.040 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 36 0.040 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 36 0.040 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 36 0.053 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 36 0.053 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 36 0.053 At2g30505.1 68415.m03716 Expressed protein 28 0.064 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 35 0.070 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 35 0.070 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 35 0.070 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 35 0.070 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 35 0.070 At1g77030.1 68414.m08970 glycine-rich protein 35 0.070 At1g35617.1 68414.m04424 hypothetical protein 35 0.070 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 35 0.093 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 35 0.093 At3g43583.1 68416.m04636 hypothetical protein 35 0.093 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 35 0.093 At3g24540.1 68416.m03082 protein kinase family protein contains ... 35 0.093 At3g08640.1 68416.m01003 alphavirus core protein family contains... 35 0.093 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 35 0.093 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 35 0.093 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 34 0.12 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 34 0.12 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 34 0.12 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 34 0.12 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 34 0.16 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 34 0.16 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 34 0.16 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 34 0.16 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 34 0.16 At3g08630.1 68416.m01002 expressed protein 34 0.16 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 34 0.16 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 34 0.16 At1g53620.1 68414.m06094 glycine-rich protein 34 0.16 At5g28480.1 68418.m03462 hypothetical protein 33 0.21 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 33 0.21 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 33 0.21 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 33 0.21 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 33 0.21 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 33 0.21 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 33 0.21 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 33 0.21 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 33 0.21 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 33 0.21 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 33 0.21 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.21 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 33 0.21 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 33 0.28 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 33 0.28 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 33 0.28 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 33 0.28 At1g76965.1 68414.m08961 glycine-rich protein 33 0.28 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 33 0.28 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 33 0.28 At1g30780.1 68414.m03763 F-box family protein 33 0.28 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 33 0.37 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 33 0.37 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 33 0.37 At4g08230.1 68417.m01358 glycine-rich protein 33 0.37 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 33 0.37 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 33 0.37 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 33 0.37 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 33 0.37 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 33 0.37 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 33 0.37 At2g18470.1 68415.m02151 protein kinase family protein contains ... 33 0.37 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 33 0.37 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 33 0.37 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 31 0.38 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 0.42 At2g05530.1 68415.m00585 glycine-rich protein 31 0.45 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 32 0.49 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 32 0.49 At5g11550.1 68418.m01347 expressed protein 32 0.49 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 32 0.49 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 32 0.49 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 32 0.49 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 32 0.49 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 32 0.49 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 32 0.49 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 32 0.49 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 32 0.49 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 32 0.49 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 32 0.49 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 32 0.49 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 32 0.49 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 32 0.49 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 32 0.49 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.49 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 32 0.49 At1g11850.1 68414.m01363 expressed protein 32 0.49 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.65 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 32 0.65 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 32 0.65 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 32 0.65 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 32 0.65 At1g80130.1 68414.m09379 expressed protein 32 0.65 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 31 0.86 At5g62440.1 68418.m07837 expressed protein 31 0.86 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 0.86 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 0.86 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 0.86 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 31 0.86 At4g32340.1 68417.m04603 expressed protein 31 0.86 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 31 0.86 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 31 0.86 At3g07195.1 68416.m00858 proline-rich family protein 31 0.86 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 31 0.86 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 31 0.86 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 31 0.86 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 31 1.1 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 31 1.1 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 31 1.1 At5g51680.1 68418.m06407 hydroxyproline-rich glycoprotein family... 31 1.1 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 31 1.1 At3g44950.1 68416.m04843 glycine-rich protein 31 1.1 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 31 1.1 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 31 1.1 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 31 1.1 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 31 1.1 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 31 1.5 At4g21720.1 68417.m03145 expressed protein 31 1.5 At4g15150.1 68417.m02326 glycine-rich protein 31 1.5 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 31 1.5 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.5 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 31 1.5 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 31 1.5 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 1.5 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 31 1.5 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 31 1.5 At1g26110.1 68414.m03186 expressed protein 31 1.5 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 31 1.5 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 31 1.5 At5g56140.1 68418.m07003 KH domain-containing protein 30 2.0 At5g55390.1 68418.m06901 hydroxyproline-rich glycoprotein family... 30 2.0 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 30 2.0 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 30 2.0 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 30 2.0 At3g24250.1 68416.m03044 glycine-rich protein 30 2.0 At3g14350.3 68416.m01816 leucine-rich repeat transmembrane prote... 30 2.0 At3g14350.2 68416.m01814 leucine-rich repeat transmembrane prote... 30 2.0 At3g14350.1 68416.m01815 leucine-rich repeat transmembrane prote... 30 2.0 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 30 2.0 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 30 2.0 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 30 2.0 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 30 2.0 At1g64450.1 68414.m07306 proline-rich family protein contains pr... 30 2.0 At1g53560.1 68414.m06078 expressed protein 30 2.0 At5g58540.1 68418.m07330 protein kinase family protein contains ... 30 2.6 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 30 2.6 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 30 2.6 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 30 2.6 At3g55950.1 68416.m06217 protein kinase family protein contains ... 30 2.6 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 30 2.6 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 30 2.6 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 30 2.6 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 30 2.6 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 30 2.6 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 30 2.6 At2g22510.1 68415.m02670 hydroxyproline-rich glycoprotein family... 30 2.6 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 30 2.6 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 30 2.6 At1g45688.1 68414.m05202 expressed protein 30 2.6 At1g27090.1 68414.m03302 glycine-rich protein 30 2.6 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 30 2.6 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 25 3.1 At5g10380.1 68418.m01204 zinc finger (C3HC4-type RING finger) fa... 29 3.5 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 3.5 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 29 3.5 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 29 3.5 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 29 3.5 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 3.5 At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid t... 29 3.5 At1g51580.1 68414.m05806 KH domain-containing protein 29 3.5 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 25 3.9 At5g60050.1 68418.m07530 PRLI-interacting factor-related contain... 26 4.1 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 24 4.3 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 4.6 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 4.6 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 29 4.6 At4g00890.1 68417.m00120 proline-rich family protein contains pr... 29 4.6 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 4.6 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 4.6 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 29 4.6 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 29 4.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 4.6 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 4.6 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 29 4.6 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 29 4.6 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 28 5.2 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 28 5.2 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 29 6.1 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 29 6.1 At5g08330.1 68418.m00980 TCP family transcription factor, putati... 29 6.1 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 29 6.1 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 6.1 At3g28790.1 68416.m03593 expressed protein 29 6.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 6.1 At2g32080.2 68415.m03921 PUR alpha-1 protein identical to PUR al... 29 6.1 At2g32080.1 68415.m03920 PUR alpha-1 protein identical to PUR al... 29 6.1 At1g77970.1 68414.m09086 hydroxyproline-rich glycoprotein family... 29 6.1 At1g36675.1 68414.m04563 glycine-rich protein 29 6.1 At1g35880.1 68414.m04457 hypothetical protein 29 6.1 At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family... 29 6.1 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 25 7.4 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 25 7.4 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.0 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 28 8.0 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 28 8.0 At4g17940.1 68417.m02672 expressed protein 28 8.0 At4g11470.1 68417.m01845 protein kinase family protein contains ... 28 8.0 At3g60270.1 68416.m06737 uclacyanin, putative similar to uclacya... 28 8.0 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 8.0 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 28 8.0 At3g47620.1 68416.m05184 TCP family transcription factor, putati... 28 8.0 At3g46240.1 68416.m05005 protein kinase-related similar to light... 28 8.0 At3g23750.1 68416.m02986 leucine-rich repeat family protein / pr... 28 8.0 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 28 8.0 At2g18910.1 68415.m02206 hydroxyproline-rich glycoprotein family... 28 8.0 At1g73840.1 68414.m08549 hydroxyproline-rich glycoprotein family... 28 8.0 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 28 8.0 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 8.0 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 28 8.0 At3g51710.1 68416.m05670 curculin-like (mannose-binding) lectin ... 25 8.9 At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) fa... 23 9.2 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 80.2 bits (189), Expect = 2e-15 Identities = 42/111 (37%), Positives = 43/111 (38%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP-XXRGXXPPXXXXPXXGP 822 P PPPPP PP PP P P PPPPP P P P PP P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Query: 823 XPPPXXXPP----XXPPPPXFPXXXPXP-PXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPPP + P P P P PP PPP Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 77.4 bits (182), Expect = 1e-14 Identities = 43/123 (34%), Positives = 45/123 (36%), Gaps = 13/123 (10%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 ++ P PPPPP PP P P P PPPPP P P P PP PP P Sbjct: 463 VYSPPPPPPPPPPPPPVYSPPP-PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Query: 811 XXGPXPPPXXX--------PPXXPPPPXFPXXXPXP-----PXPXXXXGAGXXXPPRRXX 951 P P P PP PPPP F P P P P PP Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP 581 Query: 952 PPP 960 PPP Sbjct: 582 PPP 584 Score = 76.2 bits (179), Expect = 3e-14 Identities = 41/104 (39%), Positives = 41/104 (39%), Gaps = 2/104 (1%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP PP PP P PPPPP P P P PP PP P P PP Sbjct: 426 PPPPSPP---PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP---PPPPV 479 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGA--GXXXPPRRXXPPP 960 PP PPPP P P PP P PP PPP Sbjct: 480 YSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 74.1 bits (174), Expect = 1e-13 Identities = 39/92 (42%), Positives = 39/92 (42%), Gaps = 6/92 (6%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPP---XPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PPPP P PP PP P P PPPPP P P P PP PP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP---- 484 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PPP PP PPPP P PP P Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/110 (32%), Positives = 39/110 (35%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 ++ P PPPPP PP PP P PPP P RP PP PP P Sbjct: 494 VYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPP 553 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPP P PP P + P PPP Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 71.7 bits (168), Expect = 7e-13 Identities = 36/90 (40%), Positives = 36/90 (40%), Gaps = 6/90 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP PP P PP P P PP PPP P P PP PP P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Query: 817 GPXPPP---XXXPPXXPPPPXFPXXXPXPP 897 P PPP PP PPPP P P PP Sbjct: 486 SPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/102 (34%), Positives = 37/102 (36%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PPP P P P PPPP P P P PP PP P P Sbjct: 408 PSPPPPAPIFSTP-PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PPPP + P PP P + PP PP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 65.7 bits (153), Expect = 4e-11 Identities = 40/122 (32%), Positives = 43/122 (35%), Gaps = 12/122 (9%) Frame = +1 Query: 631 IFXXXPXPPPP--PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPR-PXPPXXRGXXP 792 ++ P PPPP P PP PP P P PPPP P P PP P Sbjct: 532 VYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSP 591 Query: 793 PXXXXPXXGPXPPPXXXPP------XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXP 954 P P P P P PP PPPP P PP P + P P Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSP 651 Query: 955 PP 960 PP Sbjct: 652 PP 653 Score = 63.3 bits (147), Expect = 2e-10 Identities = 39/105 (37%), Positives = 39/105 (37%), Gaps = 2/105 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP-PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 P PP P PP P PPPP P P P PP PP P P P Sbjct: 394 PRPPVVTPL--PPPSLPSPPPPAPIFSTPPTLTSPPPPSPP------PPVYSPPPPPPPP 445 Query: 829 PP-XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP PPPP P P PP P PP PPP Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 60.5 bits (140), Expect = 2e-09 Identities = 35/103 (33%), Positives = 36/103 (34%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPP PP P P PPPPP P P PP PP P PP Sbjct: 575 PPPPHSPPP--PIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPPP P PP P + PP PP Sbjct: 633 PPVVHYSSPPPP--PVYYSSPPPPPVYYSSPPPPPPVHYSSPP 673 Score = 60.1 bits (139), Expect = 2e-09 Identities = 40/115 (34%), Positives = 41/115 (35%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPPPPX---PPXXXPPXPXPX----PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPPP PP P P P PPPPP P P P P PP P Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPPP-PHSPPPPQFSPPPPEPYYYSSPPPPHSSP 570 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP-----XPXXXXGAGXXXPPRRXXPPP 960 PP PP PPPP +P P PP P PP PPP Sbjct: 571 -----PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPP 620 Score = 57.2 bits (132), Expect = 2e-08 Identities = 34/101 (33%), Positives = 35/101 (34%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP PP PP PPPP PP P P P P Sbjct: 438 PPPPPPPP--PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP---PPVYSPPPPSPPPP-- 490 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP PP P PP P P+ AP P Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Score = 55.6 bits (128), Expect = 5e-08 Identities = 35/109 (32%), Positives = 36/109 (33%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPP----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP P P P PP P P PPP P P P PP PP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP---PCIEYSPPPPPPVVHYSSPPPPPVYY 648 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP P PP P + P PPP Sbjct: 649 SSPPPPPVYYSSPPPPP---PVHYSSPPPPEVHYHSPPPSPVHYSSPPP 694 Score = 50.8 bits (116), Expect = 1e-06 Identities = 36/112 (32%), Positives = 36/112 (32%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP-----XPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 PPPPP PP P P PPPPP P P P PP PP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEV 677 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPPP P PP P P PPP Sbjct: 678 HYHSPPPSPVHYSSP--PPPPSAPCEESPPPAPVVHH--SPPPPMVHHSPPP 725 Score = 49.6 bits (113), Expect = 3e-06 Identities = 36/118 (30%), Positives = 36/118 (30%), Gaps = 13/118 (11%) Frame = +1 Query: 646 PXPPPPPX----PPXXXP--PXPXPXPPPPPXP----XXXXXXXXXPRPXPPXXRGXXPP 795 P P P P PP P P P PPPP P P PP PP Sbjct: 525 PSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPP 584 Query: 796 XXXXPXXGPXPPPXXXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P PPP P P PP P P PP Sbjct: 585 IYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPP 642 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP P P P P P P P PP PP GP PP Sbjct: 692 PPPPPSAPCEESPPPAPVVHHSPPPPMVHHS-----PPPPVIH-QSPPPPSPEYEGPLPP 745 Query: 832 PXXXPPXXPPPPXF 873 PPPP F Sbjct: 746 VIGVSYASPPPPPF 759 Score = 40.7 bits (91), Expect = 0.001 Identities = 36/116 (31%), Positives = 36/116 (31%), Gaps = 13/116 (11%) Frame = +1 Query: 652 PPPPPX---PPXXXPPXPXPXPPPPPX----PXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPPP P PP PPPP P P P P PP Sbjct: 651 PPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVV 710 Query: 811 XXGPXPPPXXXPPXXP-----PPPXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P PPP P P PP G PP PPP Sbjct: 711 HHSPPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPP----VIGVSYASPP----PPP 758 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/105 (29%), Positives = 33/105 (31%), Gaps = 14/105 (13%) Frame = +1 Query: 631 IFXXXPXPPPP-----PXPP----XXXPPXPXPXPPPPPXPXXXXXXXXXPRP-----XP 768 ++ P PPPP P PP PP P PPP P P P P Sbjct: 656 VYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPP 715 Query: 769 PXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P PPP P PP PP P Sbjct: 716 PPMVHHSPP---PPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPP 757 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/84 (28%), Positives = 25/84 (29%), Gaps = 3/84 (3%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPX---PPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 P P P P P P PP PP + PP P P P Sbjct: 397 PVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP---PPPPVYSPPP 453 Query: 818 XPXXXXXXPXXXXPXPPXSPPPXP 889 P P P PP PPP P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPP 477 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 77.0 bits (181), Expect = 2e-14 Identities = 38/86 (44%), Positives = 39/86 (45%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP PP PP P P PPPPP P P P PP PP P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP-----SPPPYVYP---PP 428 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP PP PP +P P PP P Sbjct: 429 PPPYVYPPPPSPPYVYP---PPPPSP 451 Score = 75.4 bits (177), Expect = 5e-14 Identities = 35/84 (41%), Positives = 35/84 (41%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP PP PP P P PPPPP P P P P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP PP PPP P P PP Sbjct: 439 SPPYVYPP--PPPSPQPYMYPSPP 460 Score = 69.7 bits (163), Expect = 3e-12 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 2/92 (2%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 F P PPPP PP PP P P PPPPP P P PP PP P Sbjct: 372 FGCSPPSPPPPPPP---PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Query: 814 XGP--XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP P PPPP P P P Sbjct: 429 PPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/92 (36%), Positives = 34/92 (36%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 PP P P PPPPP P P P PP PP P P PPP PP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP------PPPYVYP--SPPPPPPSPPPYVYPP 427 Query: 865 PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P P Sbjct: 428 PPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 3/76 (3%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXX---PPPPXPPXXPGXXPXXXXPXPXRXXX 827 PP P P PP PP PP PPPP PP P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP--PYVYP---PPPPPYVYP 435 Query: 828 XXXPXPXXXPPXPPFP 875 P PP PP P Sbjct: 436 PPPSPPYVYPPPPPSP 451 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXP--XPPPPPXPXXXXXXXXXPRP 762 ++ P PPP P PP PP P P PPPP P P+P Sbjct: 409 VYPSPPPPPPSP-PPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 652 PPPPPX--PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP 768 PPPPP PP PP P PPP P P P P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 Score = 36.7 bits (81), Expect = 0.023 Identities = 21/81 (25%), Positives = 22/81 (27%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P PP P P P P P P PP PP P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P PP + P P Sbjct: 447 PPPSPQPYMYPSPPCNDLPTP 467 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +3 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 G P P P P P PP PP P P P P PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/89 (40%), Positives = 37/89 (41%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 +F P PPPPP PP PP P P PPPPP P P PP P P Sbjct: 37 LFPQSPPPPPPPPPP---PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPP 93 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PP PP P P PP Sbjct: 94 ---PQPPPRSQPPPKPPQKNLPRRHPPPP 119 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP PP PPPPP P P P R P P Sbjct: 55 PPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP---------PK 105 Query: 826 PPPXXXPPXXPPPPXFP 876 PP P PPPP P Sbjct: 106 PPQKNLPRRHPPPPRSP 122 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/91 (30%), Positives = 28/91 (30%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P PPPP P P P PP P P P PPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Query: 868 XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PRR PPP Sbjct: 95 QPPPRSQPPPKPP------QKNLPRRHPPPP 119 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +1 Query: 652 PPPPPXPPXXXP--PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 PPPPP P P P PPP P PR PP R P Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGA--XXXPXXXXP 811 Q P P P P P P PP P PP PP P P Sbjct: 33 QDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPP 92 Query: 812 XPXPXXXXXXPXXXXP--XPPXSPPP 883 P P P P PPP Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPPP 118 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP PP P PPPP P PR PP PP P P PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPP---------PRSQPP----PKPPQKNLPRRHPPPPRS 121 Query: 838 XXPP 849 P Sbjct: 122 PEKP 125 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 72.1 bits (169), Expect = 5e-13 Identities = 40/109 (36%), Positives = 41/109 (37%), Gaps = 7/109 (6%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP PP P PPPPP P P P PP PP P PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Query: 835 XXXP------PXXPPPPXFPXXXP-XPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPPP P PP P G+G PP PPP Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP----PPP 596 Score = 70.5 bits (165), Expect = 2e-12 Identities = 38/110 (34%), Positives = 40/110 (36%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXX--PRPXPPXXRGXXPPXXXXPXXG 819 P PPPPP PP P PPPPP P P P PP + P Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 P P PP PPPP P PP P A PP + PPP Sbjct: 515 PLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 68.1 bits (159), Expect = 8e-12 Identities = 42/121 (34%), Positives = 43/121 (35%), Gaps = 16/121 (13%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP------PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PPPPP P P P P PP PPP P P P PP + PP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Query: 808 P--XXGPXPPP--------XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PPP PP PP P P PP P G PP PP Sbjct: 569 PMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPP---PPP 625 Query: 958 P 960 P Sbjct: 626 P 626 Score = 66.1 bits (154), Expect = 3e-11 Identities = 40/112 (35%), Positives = 40/112 (35%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX--PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P PPP PP P P PPPPP P P P PP P P Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPP-- 493 Query: 820 PXPPPXXXP-----PXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P PPPP P PP P A PP PPP Sbjct: 494 PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPP--PPPPP 543 Score = 58.4 bits (135), Expect = 7e-09 Identities = 36/107 (33%), Positives = 37/107 (34%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPPPXPP--XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPPPP PP P P PPP P P P PP PP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPP---PPPPAVMPLKHF 472 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP P F P PP G+ PP PPP Sbjct: 473 APPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPP----PPP 515 Score = 55.6 bits (128), Expect = 5e-08 Identities = 38/114 (33%), Positives = 38/114 (33%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPX------PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PPPPP PP P P PPPPP P P P G PP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP- 595 Query: 808 PXXGPXPPPXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPPP P PP P G PP PPP Sbjct: 596 ----PMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP----PPP 641 Score = 37.1 bits (82), Expect = 0.017 Identities = 29/120 (24%), Positives = 31/120 (25%), Gaps = 3/120 (2%) Frame = +3 Query: 609 KSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPX-PPXXPGX 785 K + + F PP P PP PP PPPP PP P Sbjct: 407 KYENSSQLFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAV 466 Query: 786 XP--XXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P PP P P P A PPP Sbjct: 467 MPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPP 526 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP 792 PPP PP PPPPP P P P R P Sbjct: 605 PPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAARSLRP 649 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 68.9 bits (161), Expect = 5e-12 Identities = 40/107 (37%), Positives = 41/107 (38%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPP--PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPPP P PP PP P P PPP P +P PP PP P Sbjct: 74 PCPPPPYTPKPPTVKPP-PPPYVKPPPPPTVKPPPPPYVKPPPPPT--VKPPPPPTPYTP 130 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PP P P PP P A PP PPP Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPE--APCPPPPPTPYPPP 175 Score = 62.5 bits (145), Expect = 4e-10 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 5/91 (5%) Frame = +1 Query: 646 PXPPP---PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP PP PP PP P P PPP P P PP PP P Sbjct: 89 PPPPPYVKPPPPPTVKPP-PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Query: 817 GP--XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP P P PP P P PP P Sbjct: 148 PPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 60.1 bits (139), Expect = 2e-09 Identities = 35/108 (32%), Positives = 36/108 (33%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP---RPXPPXXRGXXPPXXXXPXX 816 P PP PP P P PPPP P P +P PP PP P Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPP 107 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPPP P P PP P PP PP Sbjct: 108 PPYVKPPPPPTVKPPPPPTP-YTPPPPTPYTPPPPTVKPPPPPVVTPP 154 Score = 58.4 bits (135), Expect = 7e-09 Identities = 32/86 (37%), Positives = 33/86 (38%), Gaps = 5/86 (5%) Frame = +1 Query: 646 PXPPP---PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP PP PP PP P PPPP P PP + PP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Query: 817 GPXP-PPXXXPPXXP-PPPXFPXXXP 888 P P P PP P PPP P P Sbjct: 157 TPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 53.6 bits (123), Expect = 2e-07 Identities = 36/110 (32%), Positives = 37/110 (33%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP--RPXPPXXRGXXPPXXXXPXX-GPX 825 PP P P PP PP PP P +P PP PP P P Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPP 90 Query: 826 PPPXXXPPXXP--PPPXFPXXXPXPP---XPXXXXGAGXXXPPRRXXPPP 960 PPP PP P PP P P PP P PP PPP Sbjct: 91 PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPP---XPPXXPGXXPXXXXPXPX 815 T PP P P PP P PP PPP PP P P P P Sbjct: 102 TVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPE 161 Query: 816 RXXXXXXPXPXXXPPXP 866 P P PP P Sbjct: 162 APCPPPPPTPYPPPPKP 178 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 4/95 (4%) Frame = +3 Query: 630 YFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPX 809 Y K PP P P PP PP PPP P P P Sbjct: 80 YTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Query: 810 PXRXXXXXXPXPXXXPPXP----PFPXXPPXXXXP 902 P P PP P P P PP P Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXP 791 T PP P P PP P P P P PP P P Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 68.5 bits (160), Expect = 6e-12 Identities = 41/106 (38%), Positives = 41/106 (38%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXGGXX 783 G G GG G GG G G GG G GG G GG G G GG Sbjct: 154 GAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G G GG GG GGGGG G Sbjct: 214 GGGSGGGG-AYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 Score = 64.9 bits (151), Expect = 8e-11 Identities = 39/106 (36%), Positives = 39/106 (36%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXG-GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG G A G G G G GGG GG GGG G GG Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSG 188 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GGGGG G G GG GG GGG G Sbjct: 189 YGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYG 234 Score = 64.5 bits (150), Expect = 1e-10 Identities = 39/107 (36%), Positives = 40/107 (37%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG + GG G G GG GG G G G G G Sbjct: 174 GGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGY 233 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXG--XGGXXXGGXGGGGGXG 645 GG G G G GGGGG G G GG GG GGG G G Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGG 280 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/105 (38%), Positives = 40/105 (38%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G G G G GGGG GG GG G G GG Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG---AGGYGGGGGGGSGGGGA- 222 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G GG GG GGGG G Sbjct: 223 -YGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Score = 61.3 bits (142), Expect = 9e-10 Identities = 38/105 (36%), Positives = 38/105 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G GG G G GG GG GGG G G Sbjct: 91 GGGAASSGGYASGA-----GEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGY 145 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GGGGG G G GG GG GG G G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYG 190 Score = 61.3 bits (142), Expect = 9e-10 Identities = 39/108 (36%), Positives = 40/108 (37%), Gaps = 1/108 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG A G G G G GGGG GG G G G G GG Sbjct: 146 GNGAGEGGGAG--ASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSH 203 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG-GXXXGGXGGGGGXGXF 639 GG G G GGGG G G G G GG GGG G + Sbjct: 204 GGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGY 251 Score = 60.1 bits (139), Expect = 2e-09 Identities = 37/98 (37%), Positives = 37/98 (37%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXG 759 GG GG G G GGGG GG GGG G GG GG Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGG-GGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAA 248 Query: 758 RGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGGG G GG GG GGGGG G Sbjct: 249 GG--YGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 59.7 bits (138), Expect = 3e-09 Identities = 36/89 (40%), Positives = 37/89 (41%), Gaps = 3/89 (3%) Frame = -1 Query: 902 GXGGX--GXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXX 732 G GG G G+ GGG G G GGG G G GG GG G Sbjct: 44 GSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSG-HGGGGGGAASSGGYAS 102 Query: 731 XXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G GG GG GG GG G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGG 131 Score = 58.0 bits (134), Expect = 9e-09 Identities = 33/92 (35%), Positives = 33/92 (35%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG G G GG G GGG GG GGG G G GG Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 GG G G G GGG G G G GG Sbjct: 254 GGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285 Score = 56.8 bits (131), Expect = 2e-08 Identities = 40/109 (36%), Positives = 40/109 (36%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G GG G GG G GGG G G GG Sbjct: 70 GGGY---GGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGG 126 Query: 779 RXXGGX---GRGXXXXXXXXXGXGGGGGXG-XGXGGXXXGGXGGGGGXG 645 GG G G G G GGG G G GG GG GG GG G Sbjct: 127 SGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175 Score = 56.8 bits (131), Expect = 2e-08 Identities = 38/107 (35%), Positives = 39/107 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G G G G GG GGG G G GG Sbjct: 124 GGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGG--HGGGGGGGSAG 181 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GG G G G GGGG G GG GG GG GG G + Sbjct: 182 GAHGGSGYGGGEG-----GGAGGGGSHGGAGGYGGGGGGGSGGGGAY 223 Score = 55.6 bits (128), Expect = 5e-08 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 1/84 (1%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G GGGG GG GG G G GG GG G G GG Sbjct: 31 GQASGGGGHGGGGGSGGVS-SGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGG 89 Query: 713 GGGXGXGXGGXXXG-GXGGGGGXG 645 GGG GG G G GGGGG G Sbjct: 90 GGGGAASSGGYASGAGEGGGGGYG 113 Score = 54.8 bits (126), Expect = 8e-08 Identities = 39/110 (35%), Positives = 39/110 (35%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG---GGXXGGXXXGGGXGPXXGXXXXGG 789 GGG G A G GG G GG G G GGG G G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYG 166 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG--XXXGGXGGGGGXG 645 GG G G G GGG G G G GG GG GGGGG G Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 51.6 bits (118), Expect = 8e-07 Identities = 34/90 (37%), Positives = 34/90 (37%), Gaps = 4/90 (4%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G GG G G GG G G GGG G G G GG G G Sbjct: 38 GHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASS 97 Query: 725 GX---GGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G GG GG GGGG G Sbjct: 98 GGYASGAGEGGGGGYGGAA-GGHAGGGGGG 126 Score = 49.6 bits (113), Expect = 3e-06 Identities = 35/112 (31%), Positives = 35/112 (31%), Gaps = 7/112 (6%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGG-------XGPXXGXX 801 GGG G GG G G GG GG G G G G Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGG-GGGAASSGGYASGAGEGGGGGYGGAAGGHA 120 Query: 800 XXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GG G G G G G G G G G GGGGG G Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHG 172 Score = 49.2 bits (112), Expect = 4e-06 Identities = 35/109 (32%), Positives = 37/109 (33%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGX--GGXGXXXGKXGGGGXXG--GXXXGGGXGPXXGXXXXG 792 GGG GG + G GG G G+ GGG G G GGG G G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAA 95 Query: 791 GXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GGGG G G GG G GG G Sbjct: 96 SSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASG 144 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/105 (29%), Positives = 31/105 (29%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG GG G GG G G GGG G GG G Sbjct: 51 GGYGGESGGGYGGGSGEGAG-GGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGG 109 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GGG G GG G G G G G Sbjct: 110 GGYGGAAGGHAGGGGGGSGGGGGS--AYGAGGEHASGYGNGAGEG 152 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = -1 Query: 860 GGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGX 681 G GG GGG G G GG GG G G G GG G G G Sbjct: 31 GQASGGGGHGGGGGS--GGVSSGGYGGESGGGYGGGSGEGAGG--GYGGAEGYASGGGSG 86 Query: 680 XXGGXGGGGGXGXF 639 GG GG G + Sbjct: 87 HGGGGGGAASSGGY 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG-GGXGP 816 G G GG G G G G GGG GG G GG P Sbjct: 242 GYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 68.1 bits (159), Expect = 8e-12 Identities = 39/112 (34%), Positives = 40/112 (35%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPPPP------XPPXXXPPXPXPXPPPPPXP-XXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPPP PP PP P P PPPPP P P P PP Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNK 634 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P P P P PP P G+ PP PPP Sbjct: 635 RQAQPPPPPPPPPPTRIPAAKCAP--PPPPPPPTSHSGSIRVGPPSTPPPPP 684 Score = 61.3 bits (142), Expect = 9e-10 Identities = 43/130 (33%), Positives = 43/130 (33%), Gaps = 19/130 (14%) Frame = +1 Query: 628 TIFXXXPXPPPPPXPPXXX---------PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR 780 T F PPPPP P P P PPPPP P P PP R Sbjct: 539 TSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPR 598 Query: 781 GXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF----------PXXXPXPPXPXXXXGAGXX 930 PP P P P PP PPPP F P P PP P A Sbjct: 599 -PPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCA 657 Query: 931 XPPRRXXPPP 960 PP PPP Sbjct: 658 PPP--PPPPP 665 Score = 59.3 bits (137), Expect = 4e-09 Identities = 33/105 (31%), Positives = 34/105 (32%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP PP P PPPPP P R PP PP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSI---RVGPPSTPPPPPPPPPKANISNA 695 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P P PP P A P + PP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPP 740 Score = 57.6 bits (133), Expect = 1e-08 Identities = 33/100 (33%), Positives = 34/100 (34%), Gaps = 2/100 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXP--PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPPPP P PPPPP P P+P P P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPP- 716 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P PPP P PPPP P PP P G PP Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVP-PPPPGLGRGTSSGPPP 755 Score = 56.8 bits (131), Expect = 2e-08 Identities = 40/125 (32%), Positives = 41/125 (32%), Gaps = 14/125 (11%) Frame = +1 Query: 628 TIFXXXPXPPPPPXPP------XXXPPXPXPXPPPPP-XPXXXXXXXXXPRPXP--PXXR 780 T F PPPPP PP P P P PPPPP P P P P Sbjct: 497 TSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFS 556 Query: 781 GXXP-PXXXXPXXGPXPPPXXXPPXXP----PPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 P P PPP PP P PPP P PP P + P Sbjct: 557 NRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPS 616 Query: 946 XXPPP 960 PPP Sbjct: 617 APPPP 621 Score = 55.6 bits (128), Expect = 5e-08 Identities = 32/98 (32%), Positives = 34/98 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP P P P PPP P P P PP + PP Sbjct: 681 PPPPPPP-PKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP---------- 729 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PPP P PPPP P P G+ PP Sbjct: 730 PPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPP 767 Score = 51.6 bits (118), Expect = 8e-07 Identities = 36/111 (32%), Positives = 37/111 (33%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPX----PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PPPPP P P P P PPPP P P PP PP P Sbjct: 599 PPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPP-----PPPPTRIPA 653 Query: 814 XGPXPPPXXXPPXXPPPP--XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP P P PP P A P+ PPP Sbjct: 654 AKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPK-ANISNAPKPPAPPP 703 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/116 (29%), Positives = 35/116 (30%), Gaps = 11/116 (9%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX---PXPXPPPPPXP----XXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPPP PP P PPPPP P P P PP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSF 541 Query: 805 XPXXGPXPPP----XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP P P PP P + PP PPP Sbjct: 542 SPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPP 597 Score = 45.6 bits (103), Expect = 5e-05 Identities = 31/114 (27%), Positives = 31/114 (27%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P P P PPPP P P PP P P Sbjct: 468 PSDPPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPP 527 Query: 826 PPP---------XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P PPPP P P PP PPP Sbjct: 528 PPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPP 581 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 P PP PP P PPPP P P P PP PPP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Query: 835 XXXPPXXPPPPXFP 876 PPP P Sbjct: 756 LGAKGSNAPPPPPP 769 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 10/73 (13%) Frame = +1 Query: 646 PXPP-PPPXPPXXX------PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG---XXPP 795 P PP PPP PP PP P P P P P P P RG PP Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Query: 796 XXXXPXXGPXPPP 834 P PPP Sbjct: 756 LGAKGSNAPPPPP 768 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 13/59 (22%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP----XPXPPPPP---------XPXXXXXXXXXPRPXPPXXRG 783 P PPPPP PP P P PPPPP P P P PP RG Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGRG 773 Score = 35.5 bits (78), Expect = 0.053 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 2/83 (2%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXX--PXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPX 820 P PP P P P P PP P PP P+ PP P P Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP------------PPPP 624 Query: 821 PXXXXXXPXXXXPXPPXSPPPXP 889 P PP PPP P Sbjct: 625 PPSFGSTGNKRQAQPPPPPPPPP 647 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/102 (26%), Positives = 29/102 (28%), Gaps = 3/102 (2%) Frame = +2 Query: 665 PXXXXXXPXXPXPXPPXXPXXP--PXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXX 838 P P P P PP P P P PP G+ P P P Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPP---PP 645 Query: 839 XPXXXXPXPPXSPPPXPXXXXXLXXXXR-GXXXXPGXXXPPP 961 P P +PPP P R G P PPP Sbjct: 646 PPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPP 687 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/112 (25%), Positives = 30/112 (26%), Gaps = 11/112 (9%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXP-------PPPXPPXXPG----XXPXXXX 803 PP P PP PP PP PP PP P P Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPP 718 Query: 804 PXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P P PP PP G + APPP Sbjct: 719 PPPLSKTPAPPPPPLSKTPVPP----PPPGLGRGTSSGPPPLGAKGSNAPPP 766 Score = 33.1 bits (72), Expect = 0.28 Identities = 23/91 (25%), Positives = 24/91 (26%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P PP P P PP P P PPP P Sbjct: 464 PLNLPSDPPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPS 523 Query: 868 XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P P + PPP Sbjct: 524 QPP---PPPPPPPLFTSTTSFSPSQPPPPPP 551 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/105 (33%), Positives = 36/105 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P PPP P P P P P + PP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPP---EPKPAPP 90 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P PP A P P P Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/105 (32%), Positives = 36/105 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P P PP P P PPP P P P+P P PP P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPA-CPPTPPKPQPKPA 80 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P P P P P P PP + P P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 62.9 bits (146), Expect = 3e-10 Identities = 34/110 (30%), Positives = 35/110 (31%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP-----PXXRGXXPPXXXXP 810 P PP P PP P P P PPP P P P P P + PP Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPT 71 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P PP P P P P PP P P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 62.5 bits (145), Expect = 4e-10 Identities = 34/107 (31%), Positives = 36/107 (33%), Gaps = 4/107 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP-PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPP P P P P P P P PP P+P PP PP P P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCP 99 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXP 954 PP P P PP P P P P P P + P Sbjct: 100 SPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 59.7 bits (138), Expect = 3e-09 Identities = 33/106 (31%), Positives = 35/106 (33%), Gaps = 3/106 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXP--XPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P PP P P P+P P P P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPV 63 Query: 826 PPPXXXP-PXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P P P P P P P P PP+ P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/99 (31%), Positives = 31/99 (31%), Gaps = 3/99 (3%) Frame = +1 Query: 673 PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPX 852 P P P P PP P P P PP PP P P PPP P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Query: 853 XPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P P P P A P P P Sbjct: 63 VPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 Q P P P P P P P P PP P PP P P P Sbjct: 39 QPKPPPAPSPSPCPSPPPKPQPKPVPPPACPP-TPPKPQPKPAPPPEPKPAPPPAPKPVP 97 Query: 818 XPXXXXXXPXXXXPXPPXSPPPXP 889 P P PP PPP P Sbjct: 98 CPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 7/74 (9%) Frame = +3 Query: 687 PXXXXXXPPXXPPXX-PPXXXXP-PPPXP-----PXXPGXXPXXXXPXPXRXXXXXXPXP 845 P PP P PP P PPP P P P P P P P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Query: 846 XXXPPXPPFPXXPP 887 PP P P PP Sbjct: 78 KPAPPPEPKPAPPP 91 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 Q P PP P P P P P P PP P PP A P P Sbjct: 76 QPKPAPPPEP--KPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKP 133 Query: 818 XP 823 P Sbjct: 134 AP 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +2 Query: 659 PXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXX 838 P P P P P P P P PP A P P P Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPP--APSPSPCPSPPPKPQPKPV 63 Query: 839 XPXXXXPXPPXSPPPXP 889 P P PP P P P Sbjct: 64 PPPACPPTPP-KPQPKP 79 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 64.1 bits (149), Expect = 1e-10 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 6/108 (5%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPP P P P PPPPP P P P PP PP P PPP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAP--PAPPTPIVHTSSPPPPP 731 Query: 835 XXXPPXXPPPP------XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P P PP P PP PPP Sbjct: 732 PPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPP 779 Score = 62.5 bits (145), Expect = 4e-10 Identities = 38/114 (33%), Positives = 38/114 (33%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXX-------PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPPP PP PP P P PP PP P P P PP PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPP------PPAPP 740 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFP--XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PP P P PP G P PPP Sbjct: 741 TPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 54.0 bits (124), Expect = 1e-07 Identities = 39/123 (31%), Positives = 43/123 (34%), Gaps = 11/123 (8%) Frame = +1 Query: 619 QINTIFXXXPXPPP-PPXPP-----XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR 780 Q +T+ P PPP PP PP PP P P PPPP P + PP Sbjct: 699 QHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPP--- 755 Query: 781 GXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG-----AGXXXPPRR 945 P P PPP PP PPP PP P G +G PP Sbjct: 756 -APPAPPRLPTHSASPPPPTAPP--PPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 Query: 946 XXP 954 P Sbjct: 813 ALP 815 Score = 51.6 bits (118), Expect = 8e-07 Identities = 29/103 (28%), Positives = 30/103 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP P PPPP P P+ PP P P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHS 767 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPPP P G P PP Sbjct: 768 ASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPP 810 Score = 41.9 bits (94), Expect = 6e-04 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 11/95 (11%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPX--------PPPPPXPXXXXXXXXXPRPXPPXXRGXXPP---X 798 PPPPP PP PP P PP PP P P P PP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASP----PPPTAPPPPPLGQ 783 Query: 799 XXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PPP P P P P P Sbjct: 784 TRAPSAPPPPPPKLGTKLSPSGPNVPPTPALPTGP 818 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 2/82 (2%) Frame = +1 Query: 619 QINTIFXXXPXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP 792 Q N I PP PP PP P PP PPP P P P PP Sbjct: 743 QSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLS 802 Query: 793 PXXXXPXXGPXPPPXXXPPXXP 858 P GP PP P P Sbjct: 803 P------SGPNVPPTPALPTGP 818 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +1 Query: 757 RPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP 936 R PP P P P PPP PP P P PP P + P Sbjct: 672 RSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPP 731 Query: 937 PRRXXPPP 960 P P P Sbjct: 732 PPPPPPAP 739 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 4/80 (5%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXX----PXXXXPXPXRXX 824 PP P P PP P PPPP P P P P P + Sbjct: 739 PPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLG 798 Query: 825 XXXXPXPXXXPPXPPFPXXP 884 P PP P P P Sbjct: 799 TKLSPSGPNVPPTPALPTGP 818 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 63.7 bits (148), Expect = 2e-10 Identities = 39/106 (36%), Positives = 39/106 (36%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXX 783 GG GG G G G G GGG G G GG G G GG Sbjct: 406 GGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGR 465 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GGGGG G G GG GG GGG G G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGG 511 Score = 63.3 bits (147), Expect = 2e-10 Identities = 42/109 (38%), Positives = 42/109 (38%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG-GGXXGGXXXGGGXGPXXGXXXX--GG 789 G GG A G GG G G GG GG GG GG G G GG Sbjct: 395 GASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGG 454 Query: 788 XXPRXXGGXGRGXXXXXXXXXGX-GGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GRG G G GGG G G GG GG GGG G G Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGG 503 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/102 (39%), Positives = 40/102 (39%), Gaps = 3/102 (2%) Frame = -1 Query: 941 RGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXG--GXXXGGGXGPXXGXXXXGGXXP-RXX 771 RG A GG G G GGGG G G GGG G G GG Sbjct: 44 RGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGG 103 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GRG G GGG G G G GG G G GGG G Sbjct: 104 GGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Score = 62.1 bits (144), Expect = 5e-10 Identities = 35/87 (40%), Positives = 36/87 (41%), Gaps = 1/87 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G GG G G+ GGGG GG G G G G GG GG G Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGG 159 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GG G G GG GG G GGG G Sbjct: 160 GKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Score = 61.7 bits (143), Expect = 7e-10 Identities = 38/106 (35%), Positives = 38/106 (35%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG GG G G G G GGG G GGG G G GG Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Query: 779 RXXGGX-GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GRG G GGG G G G GG G G G G G Sbjct: 155 GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 60.5 bits (140), Expect = 2e-09 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGG-GGXXGGXXXGG--GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXX 732 G GG G G GG GG GG GG G G G GG GG G G Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSV 134 Query: 731 XXGXGGGGGXGXGXGGXXXGGXGGGG 654 G G GGG G GG GG GGGG Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGG 160 Score = 58.8 bits (136), Expect = 5e-09 Identities = 39/108 (36%), Positives = 40/108 (37%), Gaps = 3/108 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGX---GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG GG + G GG G G GGGG GG GGG G G GG Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGA--GGGVGGGVGGGVGGG 511 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG G G G GG GG G G G Sbjct: 512 VRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVG 559 Score = 58.4 bits (135), Expect = 7e-09 Identities = 41/110 (37%), Positives = 41/110 (37%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGX---GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG GG A G GG G G GG GG GGG G G GG Sbjct: 192 GGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGG 251 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG--GGGXG 645 R GG G G G GGG G G GG G GG GG G Sbjct: 252 G--RGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVG 299 Score = 57.6 bits (133), Expect = 1e-08 Identities = 38/105 (36%), Positives = 38/105 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG RGG G GG G G G G GG GGG G GG Sbjct: 157 GGGGKGRGGKSGGGAGGGVG-GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASG 215 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G GGG G GG GG G GG G Sbjct: 216 -GGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVG 259 Score = 57.6 bits (133), Expect = 1e-08 Identities = 40/108 (37%), Positives = 40/108 (37%), Gaps = 4/108 (3%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXGGGXGPXXGXXXXGGXX 783 GG GG G G G G GG GG GG GGG G GG Sbjct: 419 GGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSV 478 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG--GGGXG 645 GG G G G G GGG G G GG G GG GGG G Sbjct: 479 GAG-GGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVG 525 Score = 56.8 bits (131), Expect = 2e-08 Identities = 38/108 (35%), Positives = 38/108 (35%), Gaps = 3/108 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG G G G G G G GG GGG G G G Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSV 134 Query: 779 RXXGGXGRGXXXXXXXXXGXG-GGGGXGXG--XGGXXXGGXGGGGGXG 645 GG G G G GGGG G G GG GG GGG G G Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Score = 56.4 bits (130), Expect = 3e-08 Identities = 36/103 (34%), Positives = 36/103 (34%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG GG G G GGG GG GGG G G G Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGV--GGGVGGGVGGGVRGAVGG 518 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G G GGG G G GG G G G G Sbjct: 519 AVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAG 561 Score = 56.0 bits (129), Expect = 4e-08 Identities = 37/107 (34%), Positives = 37/107 (34%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXR-RGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG R R G G G G G G GG GG G G G GG Sbjct: 103 GGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKG 162 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG-GXXXGGXGGGGGXG 645 G G G G G GG G G G G GG G GG G Sbjct: 163 RGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRG 209 Score = 56.0 bits (129), Expect = 4e-08 Identities = 39/104 (37%), Positives = 39/104 (37%), Gaps = 2/104 (1%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXG--GXXXGGGXGPXXGXXXXGGXX 783 GG GG G GG G G GGGG G G GG G GG Sbjct: 186 GGSVGAGGGIGSGGGGTVGAGGRGSG-GASGGGGTVGAGGRGSGGASGGVGVGGGAGGSG 244 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG GRG G GG G G G GG GG GGG G Sbjct: 245 GGSVGGGGRG-SGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVG 287 Score = 56.0 bits (129), Expect = 4e-08 Identities = 38/109 (34%), Positives = 38/109 (34%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG-GGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG GG G G G GG GG GG G G G GG Sbjct: 249 GGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGG 308 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGX---GXGXGGXXXGGXGGGGGXG 645 GG G G GG GG G G GG GG GGG G G Sbjct: 309 SVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGG 357 Score = 55.6 bits (128), Expect = 5e-08 Identities = 35/107 (32%), Positives = 35/107 (32%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG--GGXGPXXGXXXXGGX 786 GGG GG G G G G GG GG G GG G G G Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGA 126 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GGG G G GG GG GGG G Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGG 173 Score = 55.2 bits (127), Expect = 6e-08 Identities = 37/107 (34%), Positives = 37/107 (34%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG A G GG G GG G GG GGG G GG Sbjct: 209 GSGGASGGGGTVGA--GGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGG 266 Query: 779 RXXGGXGRGXXXXXXXXXGXGG--GGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG GG G GG GG GG G G Sbjct: 267 NVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGG 313 Score = 55.2 bits (127), Expect = 6e-08 Identities = 36/103 (34%), Positives = 36/103 (34%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G G G GG G GG G G G GG Sbjct: 379 GGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGV-- 436 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G G GGGGG G GG GG GGG G Sbjct: 437 ----GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTG 475 Score = 55.2 bits (127), Expect = 6e-08 Identities = 40/109 (36%), Positives = 40/109 (36%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGG-XXXGGGXGPXXGXXXXGGXX 783 GG GG A G G G G GG GG GGG G G GG Sbjct: 438 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAG 497 Query: 782 PRXXGGXGRGXXXXXXXXXG---XGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG G G GG GG G GGG G Sbjct: 498 GGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGG-ASGGAGAGGGAG 545 Score = 54.8 bits (126), Expect = 8e-08 Identities = 39/110 (35%), Positives = 39/110 (35%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXG--GXXXGGGXGPXXG---XXXX 795 GGG GG A G G G GGG G G GGG G G Sbjct: 311 GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAV 370 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GG GRG G G GG G G GG GG GG G Sbjct: 371 GGGGGGSVGGGGRGSGGASGGASG-GASGGASGGASGGASGGVGGAGGAG 419 Score = 54.4 bits (125), Expect = 1e-07 Identities = 35/105 (33%), Positives = 36/105 (34%), Gaps = 1/105 (0%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPR 777 GG GG + G G G G GGG G G G G G GG Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGG 123 Query: 776 XXGGXGRGXXXXXXXXXGXGGGGGXGXGX-GGXXXGGXGGGGGXG 645 G G G G G GG G G GG GG G GG G Sbjct: 124 VGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSG 168 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/106 (35%), Positives = 38/106 (35%), Gaps = 3/106 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGX--GXXXGKXGGGGXX-GGXXXGGGXGPXXGXXXXGG 789 GGG GG G GG G G GGGG GG GG G G GG Sbjct: 216 GGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAG--GG 273 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G G GG G G GG GG G GG Sbjct: 274 LGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 319 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/107 (35%), Positives = 39/107 (36%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXGGGXGPXXGXXXXGGX 786 GGG GG + G G G G GG GG GG GG G G GG Sbjct: 372 GGGGGSVGGGGRGSGGASGGASG-GASGGASGGASGGASGGVGGAGGAGGSVGAG--GGV 428 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G GG G G GGG G Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTG 475 Score = 53.6 bits (123), Expect = 2e-07 Identities = 35/104 (33%), Positives = 35/104 (33%), Gaps = 1/104 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKX-GGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GG GG A G GG G G G GG GG G G GG Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG 343 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G G GG G G GG GG G GG Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 387 Score = 53.6 bits (123), Expect = 2e-07 Identities = 39/110 (35%), Positives = 39/110 (35%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXG---XXXXGG 789 GGG GG A G G G GGGG G GG G G GG Sbjct: 351 GGGV---GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGG 407 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG--GGGXG 645 G G G G G GGG G G GG G GG GGG G Sbjct: 408 ASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Score = 52.8 bits (121), Expect = 3e-07 Identities = 38/107 (35%), Positives = 38/107 (35%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXGGGXGPXXGXXXXGGX 786 GGG GG G G G G GG GG GG GGG G GG Sbjct: 339 GGGV---GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAS---GGA 392 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GG G G GG GG GGG G G Sbjct: 393 SGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGG 439 Score = 52.0 bits (119), Expect = 6e-07 Identities = 35/106 (33%), Positives = 35/106 (33%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXGGXX 783 GGG G A G G G G GG GG G GG G G GG Sbjct: 113 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAG 172 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G G G G G G G G GG G Sbjct: 173 GGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 52.0 bits (119), Expect = 6e-07 Identities = 39/110 (35%), Positives = 39/110 (35%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGG-GXGPXXGXXXXGGXX 783 GGG G A GG G G GGG GG GG G G G GG Sbjct: 117 GGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVG 176 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGG---GXGXGXGGXXXGGXG-GGGGXG 645 G G G G GGGG G G GG GG G GG G Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRG 226 Score = 52.0 bits (119), Expect = 6e-07 Identities = 38/108 (35%), Positives = 38/108 (35%), Gaps = 3/108 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG GG A G G G G GG GG GGG G G G Sbjct: 131 GGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGG-GAGGGVGGGVGAGGGAGGSV 189 Query: 779 RXXGGXGR-GXXXXXXXXXGXGG--GGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GGG G GG GG GG G G Sbjct: 190 GAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVG 237 Score = 51.6 bits (118), Expect = 8e-07 Identities = 38/111 (34%), Positives = 38/111 (34%), Gaps = 9/111 (8%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG------GGXXGGXXXGGGXGPXXGXXXX 795 GG GG G G G G GG GG GG GGG G Sbjct: 265 GGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGA 324 Query: 794 GGXXPRXXGGX-GRGXXXXXXXXXGXGGG--GGXGXGXGGXXXGGXGGGGG 651 G GG G G G GGG GG G GG G GGGGG Sbjct: 325 SGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 375 Score = 51.2 bits (117), Expect = 1e-06 Identities = 33/87 (37%), Positives = 33/87 (37%), Gaps = 1/87 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G GG G GGG G G GG G G G G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGG--GGIGGSGGVGAGGGVGGGAGGAIGGGASGG 100 Query: 722 XGGGG-GXGXGXGGXXXGGXGGGGGXG 645 GGGG G G GG GG GGG G G Sbjct: 101 AGGGGKGRGRKGGGGAGGGVGGGVGAG 127 Score = 51.2 bits (117), Expect = 1e-06 Identities = 40/108 (37%), Positives = 40/108 (37%), Gaps = 3/108 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG---GXXGGXXXGGGXGPXXGXXXXGG 789 GG GG G GG G GK GGG G GG GGG G G GG Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRG-GKSGGGAGGGVGGGVGAGGGAGGSVGAG--GG 194 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G G G GG GG G GGG G Sbjct: 195 IGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGAS-GGVGVGGGAG 241 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/111 (33%), Positives = 37/111 (33%), Gaps = 6/111 (5%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXG----XGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXG 792 GGG GG G GG G G GG G G GGG G G G Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGG 296 Query: 791 GXXPRXXGGXGRGXXXXXXXXXGXGGG--GGXGXGXGGXXXGGXGGGGGXG 645 GG G G GG GG G GG G G GGG G Sbjct: 297 AVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVG 347 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/103 (33%), Positives = 34/103 (33%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G G G GG GG GGG G G GG Sbjct: 306 GGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGV-GGGVGGGVG-GGVGGAVG 363 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G G GG G GG G GG G Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Score = 50.8 bits (116), Expect = 1e-06 Identities = 36/107 (33%), Positives = 37/107 (34%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXG-GX 786 GGG GG G GG G+ GG GG G GG G G G Sbjct: 182 GGGA---GGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGG 238 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GG G G GG GG GGG G G Sbjct: 239 GAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Score = 50.8 bits (116), Expect = 1e-06 Identities = 37/108 (34%), Positives = 37/108 (34%), Gaps = 3/108 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXG-GGXGPXXGXXXXGG 789 GG GG G G G GG GG GG G GG G G GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG G G GG GG G GG G Sbjct: 427 GV---GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAG 471 Score = 50.8 bits (116), Expect = 1e-06 Identities = 37/102 (36%), Positives = 37/102 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG A G G G GGGG G GGG G G GG Sbjct: 433 GGGV---GGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA-GGGTGGSVGAG--GGVGV 486 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG G G G G GGG GG GG GG G Sbjct: 487 GGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAG 528 Score = 49.6 bits (113), Expect = 3e-06 Identities = 34/107 (31%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGG--XGPXXGXXXXGGX 786 GGG G G G G GGG GG GG G G G Sbjct: 275 GGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG 334 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G G GG G GG GG GG G G Sbjct: 335 SVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG 381 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/105 (30%), Positives = 32/105 (30%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG GG G GG G G GG G G GG G G GG Sbjct: 326 GGASGGAGGSVGAGGGVGGGVGG-GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 384 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GG G G G G G GGG G Sbjct: 385 SGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVG 429 Score = 48.4 bits (110), Expect = 7e-06 Identities = 33/105 (31%), Positives = 33/105 (31%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG G A GG G G G G G GG G G G Sbjct: 172 GGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG-TVGAGGRGSGGA 230 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG G G G G G G GGG G Sbjct: 231 SGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLG 275 Score = 48.4 bits (110), Expect = 7e-06 Identities = 36/111 (32%), Positives = 36/111 (32%), Gaps = 6/111 (5%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGG---GXGPXXGXXXXGG 789 GG GG G G G G G GG GG GG G G G G Sbjct: 238 GGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGA 297 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGG--GGXGXGXGGXXXGGXG-GGGGXG 645 GG G G GG GG G GG G G GGG G Sbjct: 298 VGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGG 348 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = -3 Query: 960 GGGXXXPGXXXXPRXXXXXXXXXXGXGGGEXGGXGXXXXGXXXXXXGXGXGXXXXGXXXA 781 GG G R G GGG G G G G G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Query: 780 PXXGGXXAGXXXXXXXGGXXGXXGGXGXGXXGXXXXXXGXGGXXG 646 GG G GG G G G G G G GG G Sbjct: 155 GVGGG---GKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 63.3 bits (147), Expect = 2e-10 Identities = 37/108 (34%), Positives = 38/108 (35%), Gaps = 6/108 (5%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP P PPPP P P PP PP P Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVH 779 Query: 823 XPPP---XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PPP PP PPP P P PP P PP + P Sbjct: 780 SPPPPVHSPPPPVHSPPP--PVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 60.1 bits (139), Expect = 2e-09 Identities = 38/109 (34%), Positives = 38/109 (34%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPP---PPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPP PP PP PP P PPPP P P P PP PP P Sbjct: 678 PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP-PPPVHSPPPPVQSPPP 736 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P PPPP P P PP PP PPP Sbjct: 737 PPVFSPPPPAPIYSPPPP--PVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 59.3 bits (137), Expect = 4e-09 Identities = 41/120 (34%), Positives = 41/120 (34%), Gaps = 15/120 (12%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPP P PP PP P PPP PP P P PP P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 706 Query: 805 XPXXGPXPPPXXXPP---XXPPPPXF-----PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPPP P P PP P PP PPP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIY----SPPPPPVHSPPPP 762 Score = 59.3 bits (137), Expect = 4e-09 Identities = 37/106 (34%), Positives = 37/106 (34%), Gaps = 3/106 (2%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP P PPPP P P P PP P Sbjct: 706 PPPPVHSPPPPVHSPPPPV-HSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVH 764 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P PP PP PPP Sbjct: 765 SPPP---PPVHSPPP--PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 58.0 bits (134), Expect = 9e-09 Identities = 38/113 (33%), Positives = 38/113 (33%), Gaps = 10/113 (8%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPX-PXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P PP PP P PPPP P P P PP P P Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Query: 811 XXGPXPPPXXXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP P PPP P P PP PP PP Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPP 775 Score = 58.0 bits (134), Expect = 9e-09 Identities = 41/118 (34%), Positives = 41/118 (34%), Gaps = 13/118 (11%) Frame = +1 Query: 646 PXPPP---PPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXP----P 795 P PPP PP P PP P PPPP P P P PP P P Sbjct: 684 PPPPPVHSPPPPV-HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Query: 796 XXXXPXXGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP PP PPPP P P PP PP PPP Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPP--PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 57.2 bits (132), Expect = 2e-08 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP PP PP P PPPP P P P PP PP P Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP-- 700 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P P P PP PP PPP Sbjct: 701 ----PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744 Score = 57.2 bits (132), Expect = 2e-08 Identities = 39/113 (34%), Positives = 40/113 (35%), Gaps = 10/113 (8%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP P PPPPP P PP PP P P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHS---PPP---PVHSP 766 Query: 823 XPPPXXXPPXX---PPPPXF----PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPPP P P PP + PP PP Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPP 819 Score = 54.8 bits (126), Expect = 8e-08 Identities = 33/96 (34%), Positives = 33/96 (34%), Gaps = 10/96 (10%) Frame = +1 Query: 646 PXPPPP----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP---XPPXXRGXXPPXXX 804 P PP P P PP PP P PPPPP P P PP PP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Query: 805 XPXXGP---XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PPP PP P P P P P Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAP 837 Score = 45.6 bits (103), Expect = 5e-05 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP P P P PPPP P P PP P P Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHS--------PPPPVFSPPPPMHSPPPPVY 675 Query: 820 PXPPPXXXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP P PPP P P PP PP PPP Sbjct: 676 SPPPPVHSPPPPPVHSPPP--PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/101 (26%), Positives = 28/101 (27%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP PP PPP P P P P Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP P PP P P +PPP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPPPVHS----PPPPVHSPPP 722 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P PP P P P P P P P P PP Sbjct: 592 PPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQP-PSPSTEETKTTSPQSPPVHSPPPP 650 Query: 832 PXXXPPXXPPPPXF----PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPPP F P P PP PP PPP Sbjct: 651 P---PVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/108 (28%), Positives = 32/108 (29%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P PP P P+ P PP P Sbjct: 604 PLESPVPNDPYDASPIKKRRPQPPS-PSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFS 662 Query: 826 PPPXXX---PPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P PP PP PPP Sbjct: 663 PPPPMHSPPPPVYSPPP--PVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/82 (29%), Positives = 26/82 (31%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P P PP P P P P P+P PP + P P P PP Sbjct: 516 PPKPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPP--KQETPKPEESPK--PQPP 571 Query: 832 PXXXPPXXPPPPXFPXXXPXPP 897 P P P PP Sbjct: 572 KQETPKPEESPKPQPPKQEQPP 593 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/121 (27%), Positives = 34/121 (28%), Gaps = 16/121 (13%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXX 816 P P P PP P P P P P P+P PP P P P Sbjct: 530 PEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQ 589 Query: 817 GPXP----PPXXXPPXXPPPPXFP-------XXXPXPPXP--XXXXGAGXXXPPRRXXPP 957 P P PP P P P P PP P PP PP Sbjct: 590 EQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPP 649 Query: 958 P 960 P Sbjct: 650 P 650 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 1/86 (1%) Frame = +2 Query: 629 LFXQXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXX 808 +F P P P P P PP PP P PP P Sbjct: 660 VFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 719 Query: 809 PXPXPXXXXXXPXXXXPXPP-XSPPP 883 P P P P P PP SPPP Sbjct: 720 PPP-PVHSPPPPVQSPPPPPVFSPPP 744 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/120 (27%), Positives = 34/120 (28%), Gaps = 15/120 (12%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP--PXXXXPXXG 819 P P P PP P P P P P P+ P P P P Sbjct: 562 PEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKK 621 Query: 820 --PXPP-----------PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P PPPP P P PP PP PPP Sbjct: 622 RRPQPPSPSTEETKTTSPQSPPVHSPPPPP-PVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 Q P P P P P PP PP P P P P Sbjct: 640 QSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSP 699 Query: 818 XPXXXXXXPXXXXPXPPXSPPPXP 889 P P P PP PP P Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 5/91 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX---PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P P P P P P P + P P Sbjct: 525 PEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPK- 583 Query: 817 GPXPPPXXXPPXXPPPPXF--PXXXPXPPXP 903 P PP PP P P P P P Sbjct: 584 -PQPPKQEQPPKTEAPKMGSPPLESPVPNDP 613 Score = 36.3 bits (80), Expect = 0.030 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 3/110 (2%) Frame = +3 Query: 639 KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPP---PXPPXXPGXXPXXXXPX 809 K T P P PP P PP PPP P PP P P Sbjct: 635 KTTSPQSPPVHSPPPPPPVHSPPPPVFSP-PPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Query: 810 PXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P PP P PP P P +PPP Sbjct: 694 P---PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS----PPPPVQSPPP 736 Score = 35.9 bits (79), Expect = 0.040 Identities = 29/114 (25%), Positives = 34/114 (29%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP-----XPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP----PX 798 P P P P P P P P P P P+P P + P P Sbjct: 437 PEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKPKPESPKQESPKQEAPK 496 Query: 799 XXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P PP P + PP++ P P Sbjct: 497 PEQPKPKPESPKQESSKQEPPKPE-ESPKPEPPKPEE---SPKPQPPKQETPKP 546 Score = 35.5 bits (78), Expect = 0.053 Identities = 23/103 (22%), Positives = 27/103 (26%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P + PP P P P P Sbjct: 478 PKPKPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQ 537 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P + PP++ P P Sbjct: 538 PPKQET--PKPEESPKPQPPKQETPKPEESPKPQPPKQETPKP 578 Score = 34.7 bits (76), Expect = 0.093 Identities = 24/105 (22%), Positives = 29/105 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P P+P P + P P Sbjct: 460 PKEPKPESPKQESPKTEQPKPKPES-PKQESPKQEAPKPEQPKPKPESPKQESSKQE-PP 517 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P + PP++ P P Sbjct: 518 KPEESPKPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKP 562 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 7/108 (6%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXP----PXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 PP P P PP P P P PPP P P P P P Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP-PVHSP--PPPVHSPPPPSPI 808 Query: 825 XXXXPXPXXXPPXPPFPXXP---PXXXXPXXXXGXGXXXXXPAXAPPP 959 P PP P P P P P P AP P Sbjct: 809 YSPPPPVFSPPPKPVTPLPPATSPMANAPTPSSSESGEISTPVQAPTP 856 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/105 (23%), Positives = 25/105 (23%), Gaps = 3/105 (2%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 P PP P P P P P P P PP P P P Sbjct: 525 PEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKP 584 Query: 835 XXXPPXXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXPPP 960 PP P P P P A R P P Sbjct: 585 QPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSP 629 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/84 (25%), Positives = 22/84 (26%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P+P P P P P Sbjct: 427 PNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQES---PKTEQPKPKPE 483 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 P P P P P P P Sbjct: 484 SPKQESPKQEAPKPEQPKPKPESP 507 Score = 32.7 bits (71), Expect = 0.37 Identities = 30/111 (27%), Positives = 32/111 (28%), Gaps = 9/111 (8%) Frame = +1 Query: 652 PPPPPXPPXXX-----PPXPXPXPPP-PPXPXXXXXXXXXPRPXPPXXRGXXP--PXXXX 807 P P P P PP P P P PP P P+P PP P Sbjct: 500 PKPKPESPKQESSKQEPPKPEESPKPEPPKPEES------PKPQPPKQETPKPEESPKPQ 553 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXP-PXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P P P P P+ PP Sbjct: 554 PPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPP 604 Score = 32.7 bits (71), Expect = 0.37 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 10/69 (14%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPX----PP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 PPPP P PP PP P P PP PPP P P P Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPSSSESGEI 847 Query: 802 XXPXXGPXP 828 P P P Sbjct: 848 STPVQAPTP 856 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 63.3 bits (147), Expect = 2e-10 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 6/108 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPX----PPXXRGXXPPXXXXPXXG 819 PPP P P PP P PPPP P P PP PP P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 820 PXPPP--XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PPP PP PPP P P PP PP PP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 62.1 bits (144), Expect = 5e-10 Identities = 37/104 (35%), Positives = 37/104 (35%), Gaps = 3/104 (2%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP PP P P P PPP P P PP PP P P PPP Sbjct: 534 PPPQPPMPSPSPPSPIYSPPP-PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSP-PPPV 591 Query: 838 XXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P PPP P P PP P PP PP Sbjct: 592 HSPPPPPVFSPPP--PVFSPPPPSPVYSPPPPSHSPPPPVYSPP 633 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 3/106 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-PXP 828 PPPP PP P P P P P PP PP P P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP 582 Query: 829 PPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP PP P P PP P PP PPP Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 54.0 bits (124), Expect = 1e-07 Identities = 32/93 (34%), Positives = 32/93 (34%), Gaps = 7/93 (7%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPX--PPXXRGXXPPXXXXP 810 P PP P P PP PP P PPPP P P PP PP P Sbjct: 543 PSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSP 602 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXP--XPPXP 903 PP P PPPP P PP P Sbjct: 603 PPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 46.4 bits (105), Expect = 3e-05 Identities = 32/113 (28%), Positives = 33/113 (29%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P PP P P P Sbjct: 485 PEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMPSPS 544 Query: 826 PP-PXXXPP---XXPPPPXFPXXXP----XPPXPXXXXGAGXXXPPRRXXPPP 960 PP P PP PPPP + P PP P PP PPP Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 3/83 (3%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP---PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPPP PP PP P PPP PP P PP PP P Sbjct: 582 PPPPSPP---PPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFS 638 Query: 826 PPPXXXPPXXPPPPXFPXXXPXP 894 PPP P P P P Sbjct: 639 PPPTHNTNQPPMGAPTPTQAPTP 661 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPP P P P PPPP P P P P P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Query: 832 PXXXPPXXPPPPXFPXXXPXP 894 P PP P P P Sbjct: 635 PTFSPPPTHNTNQPPMGAPTP 655 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/103 (28%), Positives = 31/103 (30%), Gaps = 2/103 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P P P P PPPP P+P P P P PPP Sbjct: 506 PTPDDPYDASPVKNRRSPPPPK--VEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPV 563 Query: 838 XXPPXXPPPPXF--PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP + P PP P PP PPP Sbjct: 564 YSSP--PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 40.7 bits (91), Expect = 0.001 Identities = 28/106 (26%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXX-XPPPPXPPXXPGXXPXXXXPXPXRX 821 T PP P P PP PP PPPP P P P Sbjct: 531 TRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Query: 822 XXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP P F PP P +PPP Sbjct: 591 VHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHS--PPPPVYSPPP 634 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/107 (28%), Positives = 32/107 (29%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXX-RGXXP--PXXXXPXXGP 822 P P P P P P P P P PP +G P P P Sbjct: 461 PKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNR 520 Query: 823 X-PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPP P P PP P PP PPP Sbjct: 521 RSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSP-----PPPVHSPPPP 562 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/105 (25%), Positives = 28/105 (26%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P+P P P P P Sbjct: 425 PKTPEQPSPKPQPPKHESPKPEEPENKHELPKQKESPKPQPSKPEDSPKPEQPKPEESPK 484 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P P A RR PPP Sbjct: 485 PEQPQIP--EPTKPVSPPNEAQGPTPDDPYDAS-PVKNRRSPPPP 526 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/105 (25%), Positives = 28/105 (26%), Gaps = 2/105 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P P P PP PP Sbjct: 477 PKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPP 536 Query: 832 PXXXPPXXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P + P PP P PP PPP Sbjct: 537 QPPMPSPSPPSPIYSPPPPVHSPPPPVY----SSPPPPHVYSPPP 577 Score = 36.7 bits (81), Expect = 0.023 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 5/81 (6%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXP-----PXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 PP P P PP P P PP PPP P P P P P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPS--PVYSPPPPSH- 623 Query: 822 XXXXXPXPXXXPPXPPFPXXP 884 P P PP P F P Sbjct: 624 ---SPPPPVYSPPPPTFSPPP 641 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/88 (26%), Positives = 25/88 (28%), Gaps = 2/88 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPX-PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P P P P P P P P P P+P P + P P P Sbjct: 406 PSKPEPVMPKPSDSSKPETPKTPEQPSPKPQPPKHESPKPEEPENKHELPKQKESPKPQP 465 Query: 823 XPPPXXXPPXXPPPPXFP-XXXPXPPXP 903 P P P P P P P P Sbjct: 466 SKPEDSPKPEQPKPEESPKPEQPQIPEP 493 Score = 32.3 bits (70), Expect = 0.49 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPP-XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPP PP P PPPP P P PP P P P Sbjct: 602 PPPPVF-SPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPT 660 Query: 832 PXXXPPXXPPP 864 P P P Sbjct: 661 PSSETTQVPTP 671 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/113 (23%), Positives = 28/113 (24%), Gaps = 13/113 (11%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXP-------XXXXXXXXXPRPXPPXXRGXXPP----XXX 804 P P PP P P P P P P+P PP P Sbjct: 394 PSPNPPRTSEPKPSKPEPVMPKPSDSSKPETPKTPEQPSPKPQPPKHESPKPEEPENKHE 453 Query: 805 XPXXGPXPPPXXXPPXXPPPP--XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P P P P P P P PP P Sbjct: 454 LPKQKESPKPQPSKPEDSPKPEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGP 506 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 62.5 bits (145), Expect = 4e-10 Identities = 39/95 (41%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G GG G G G GG GG GGG G G GG GG G G G Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLG--WDGGNGGGGPGYGSGGGG 165 Query: 722 XGGG---------GGXGXGXGGXXXGGXGGGGGXG 645 GGG GG G G GG GG GGGGG G Sbjct: 166 IGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 45.2 bits (102), Expect = 7e-05 Identities = 36/102 (35%), Positives = 36/102 (35%), Gaps = 3/102 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXG---GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG GG G G G G G GG G GG G G G G GG Sbjct: 116 GGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNG-GGGPGYGSGGGGIGGGGGIGG 174 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXG 663 GG G G GGGGG G G GG G G Sbjct: 175 GVIIGGGGGGCG------GSCSGGGGGGGGYGHGGVSTKGSG 210 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/74 (40%), Positives = 30/74 (40%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GG G G GGG GP G GG GG G G G GGG G G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGG---GGVV--IGGGFGGGAGY------GSGGGLGWDGGNG 153 Query: 686 GXXXGGXGGGGGXG 645 G G GGGG G Sbjct: 154 GGGPGYGSGGGGIG 167 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 62.1 bits (144), Expect = 5e-10 Identities = 39/112 (34%), Positives = 39/112 (34%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPP---PPXPPX-XXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PPP PP PP PP P P PPP P P PP P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Query: 814 XGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPPP P P PP PP PPP Sbjct: 570 VHSPPPPVHSPPPPVYSPPPP--PVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Score = 62.1 bits (144), Expect = 5e-10 Identities = 39/112 (34%), Positives = 39/112 (34%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPP P PP PP P PPPP P P P PP PP P Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Query: 814 X-GPXPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PP P P P PP PP PPP Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/126 (33%), Positives = 44/126 (34%), Gaps = 16/126 (12%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXP--XPPPP---PXPXXXXXXXXXPRPXPPXXRGX 786 ++ P PP PPP PP PP P P PPPP P P P PP Sbjct: 515 VYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Query: 787 XP-PXXXXPXXGPXPPPXXXPP---XXPPPPXF----PXXXPXPPXPXXXXGAGXXXPPR 942 P P P PPP PP PPPP P P PP P PP Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Query: 943 RXXPPP 960 PP Sbjct: 635 PVHSPP 640 Score = 60.5 bits (140), Expect = 2e-09 Identities = 38/109 (34%), Positives = 38/109 (34%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 F P PPP PP PP P PPPPP P P PP PP P Sbjct: 489 FRRSPPPPPVHSPP---PPSPIHSPPPPP--------VYSPPPPPPVYSPPPPPPVYSP- 536 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP P P P PP PP PPP Sbjct: 537 --PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 59.7 bits (138), Expect = 3e-09 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP P PP P PPPP P PP PP P Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHS 565 Query: 826 PPP---XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P PP PP PPP Sbjct: 566 PPPPVHSPPPPVHSPPP--PVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Score = 59.3 bits (137), Expect = 4e-09 Identities = 34/104 (32%), Positives = 34/104 (32%), Gaps = 2/104 (1%) Frame = +1 Query: 655 PPPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPPP P PP P P PPPP P P PP P P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560 Query: 829 PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P P P PP PP PPP Sbjct: 561 PPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 58.4 bits (135), Expect = 7e-09 Identities = 39/114 (34%), Positives = 39/114 (34%), Gaps = 11/114 (9%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPP P PP PP P PPPP P P PP PP P Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Query: 814 X--GPXPPPXXX---PPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPP P P PP PP PPP Sbjct: 612 PVYSPPPPPPVHSPPPPVFSPPP--PVHSPPPPVYSPPPPVYSPPPPPVKSPPP 663 Score = 57.6 bits (133), Expect = 1e-08 Identities = 38/115 (33%), Positives = 41/115 (35%), Gaps = 13/115 (11%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP---XPPXXRGXXPP----XX 801 PPPP P PP PP P PPPPP P P PP PP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP 625 Query: 802 XXPXXGPXPPPXXXPP--XXPPPPXF-PXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PP PP PPPP + P P P + PP+ PP Sbjct: 626 PPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPP 680 Score = 56.8 bits (131), Expect = 2e-08 Identities = 37/114 (32%), Positives = 38/114 (33%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PP P P PP P P P PPPPP P PP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560 Query: 808 PXXGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPPP + P PP PP PPP Sbjct: 561 PPVHSPPPPVHSPPPPVHSPPPPVY--SPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 55.2 bits (127), Expect = 6e-08 Identities = 36/115 (31%), Positives = 36/115 (31%), Gaps = 10/115 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP------XPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PP PP P P P PP P P PP PP Sbjct: 449 PASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPP---S 505 Query: 808 PXXGPXPPPXXXPPXXP----PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP PP P PPP P P PP P PP PP Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPP 560 Score = 54.4 bits (125), Expect = 1e-07 Identities = 35/111 (31%), Positives = 35/111 (31%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P P PPPP P PP PP P Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPP---PPVY 525 Query: 817 GPXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PPP P P P PP PP PPP Sbjct: 526 SPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 51.6 bits (118), Expect = 8e-07 Identities = 36/121 (29%), Positives = 39/121 (32%), Gaps = 11/121 (9%) Frame = +1 Query: 631 IFXXXPXP---PPPPXP----PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX 789 ++ P P PPPP P PP P PPPPP P PP Sbjct: 584 VYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP---PPPVHSPP 640 Query: 790 PP--XXXXPXXGPXPPPXXXPPXXP--PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P P PPP PP P PP P PP P + P Sbjct: 641 PPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAP 700 Query: 958 P 960 P Sbjct: 701 P 701 Score = 48.4 bits (110), Expect = 7e-06 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 7/110 (6%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR-GXXPPXXXXP---XXG 819 PPPP P P P PP P +P PP P P Sbjct: 433 PPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRS 492 Query: 820 PXPPPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP P PP P P PP P + PP PPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVY---SPPPPPPVYSPPPP 539 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P P PP PP P PP P P P P Sbjct: 562 PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P P PP PP P Sbjct: 622 VHSPPPPVFSPPPPVHSPPPP 642 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP P P PPP P PP P P Sbjct: 639 PPPPVYSPPPPVYSPPPP-PVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTV 697 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPP 897 PP PP P PP Sbjct: 698 EAPPPSEEFIIPPFIGHQYASPPPP 722 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P P PP PP P PP P P P Sbjct: 569 PVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P P PP PP P Sbjct: 629 VFSPPPPVHSPPPPVYSPPPP 649 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P P PP PP P PP P P P Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP-PVYSPPPPPPVHSPPPPVFSPPPPVHS 638 Query: 836 XXPXXXXPXPPXSPPPXP 889 P P PP PP P Sbjct: 639 PPPPVYSPPPPVYSPPPP 656 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/80 (27%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P P PP PP P P P P P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSP 646 Query: 836 XXPXXXXPXPPXS--PPPXP 889 P P PP PPP P Sbjct: 647 PPPVYSPPPPPV-KSPPPPP 665 Score = 31.5 bits (68), Expect = 0.86 Identities = 29/106 (27%), Positives = 29/106 (27%), Gaps = 6/106 (5%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPX-PXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P P P P P PP P P R PP PPP Sbjct: 394 PSKSPSPVPTRPVHKPQPPKESPQPNDPYNQSP---VKFRRSPPPPQQPHHHVVHSPPPA 450 Query: 838 XXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 PP PP P P PP P RR PPP Sbjct: 451 SSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPP 496 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/110 (25%), Positives = 28/110 (25%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR-GXXPPXXXXPXXGP 822 P P P PP P P P P P P PP P P Sbjct: 398 PSPVPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSP---P 454 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGA----GXXXPPRRXXPPP 960 PP P P P P P P PP PPP Sbjct: 455 TSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPP 504 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP PP P P PP P P P PP Sbjct: 653 PPPPPVKSPP-PPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFI---I 708 Query: 826 PPPXXXPPXXPPPPXF 873 PP PPPP F Sbjct: 709 PPFIGHQYASPPPPMF 724 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 61.7 bits (143), Expect = 7e-10 Identities = 36/110 (32%), Positives = 36/110 (32%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP--XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P P PP PP P P PPPP P P PP PP P Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPV 579 Query: 820 PXPPP---XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P PP PP PP Sbjct: 580 YSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 61.3 bits (142), Expect = 9e-10 Identities = 37/115 (32%), Positives = 39/115 (33%), Gaps = 5/115 (4%) Frame = +1 Query: 631 IFXXXPXPPP--PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 ++ P PPP P PP PP P PPPP P P PP PP Sbjct: 530 VYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVY--SPPPPVH 587 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXPPP 960 P PP P PPPP P P P P PP PPP Sbjct: 588 SPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642 Score = 60.9 bits (141), Expect = 1e-09 Identities = 41/120 (34%), Positives = 44/120 (36%), Gaps = 16/120 (13%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPX---PXPPPPPXPXXXXXXXXXPRPX---PPXXRGXXPPX 798 P PPPP P PP PP P P PPPPP P P PP PP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 799 XXXPXXGPX---PPPXXXPPXXPPPPXF----PXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PPP PP PPPP + P P P + PP+ PP Sbjct: 594 HSPPPPAPVHSPPPPVHSPP--PPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPP 651 Score = 59.7 bits (138), Expect = 3e-09 Identities = 35/102 (34%), Positives = 35/102 (34%), Gaps = 2/102 (1%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P PP P PPPPP P P PP PP P P PP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPV---YSPPPPPPPVHSPPPPVFS 574 Query: 841 XPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP P P PP P PP PPP Sbjct: 575 PPPPVYSPPP-PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 54.8 bits (126), Expect = 8e-08 Identities = 33/108 (30%), Positives = 33/108 (30%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P P PPP P P PP PP P Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP P P PP PP PPP Sbjct: 554 PVYSPPPPPPPVHSPPP--PVFSPPPPVYSPPPPVHSPPPPVHSPPPP 599 Score = 54.4 bits (125), Expect = 1e-07 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 3/87 (3%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP P PPPP P P PP PP P Sbjct: 575 PPPPVYSPPPPVHSPPPPV-HSPPPPAPVHSPPPPVHSPPPPPPVYS-PPPPVFSPPPSQ 632 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP PP P PP P Sbjct: 633 SPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/107 (27%), Positives = 30/107 (28%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P R PP PP P P Sbjct: 479 PVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPP 538 Query: 826 PPPXXXPPX--XPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPPP + P PP PP PPP Sbjct: 539 PVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/84 (34%), Positives = 30/84 (35%), Gaps = 3/84 (3%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPPP PP P PPPP P P P PP + PP P P Sbjct: 589 PPPPVH-SPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQS--PPVVYSPP--PR 643 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP PP PPP PP Sbjct: 644 PPKINSPPVQSPPPAPVEKKETPP 667 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/107 (27%), Positives = 30/107 (28%), Gaps = 2/107 (1%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP--XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXR 818 T P P P PP PP PP PPPP P P P P Sbjct: 513 TKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP-- 570 Query: 819 XXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP P PP P + PPP Sbjct: 571 -PVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/105 (29%), Positives = 32/105 (30%), Gaps = 3/105 (2%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP-PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P P P + PP P P PP Sbjct: 472 PSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPA--PVNSP-PP 528 Query: 832 PXXXPPXXPPPPXF--PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPPP P P P PP PPP Sbjct: 529 PVYSPP--PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 33.5 bits (73), Expect = 0.21 Identities = 27/103 (26%), Positives = 30/103 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P P+P + P PP Sbjct: 461 PSPVPTTPVHEPSPVLATPVDKPSPVPSRPVQK-PQPPKESPQPDDPYDQSPVTKRRSPP 519 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPPP + P PP PP PPP Sbjct: 520 PA--PVNSPPPPVYSPPPPPPP-------VHSPPPPVHSPPPP 553 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/83 (24%), Positives = 22/83 (26%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP P PP PP P P+ P + P P P Sbjct: 612 PPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 Query: 835 XXXPPXXPPPPXFPXXXPXPPXP 903 PP PP P Sbjct: 672 APSDDEFIIPPFIGHQYASPPPP 694 Score = 31.9 bits (69), Expect = 0.65 Identities = 27/107 (25%), Positives = 28/107 (26%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P P P P P P P Sbjct: 419 PSKPSPVHKPTPVPTTPVHKPTPVP-----TTPVQKPSPVPTTPVQKPSPVPTTPVHEPS 473 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP--RRXXPPP 960 P P P P P PP P +R PPP Sbjct: 474 PVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPP 520 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/105 (24%), Positives = 26/105 (24%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P P P P P P P Sbjct: 430 PVPTTPVHKPTPVPTTPVQKPSPVP-----TTPVQKPSPVPTTPVHEPSPVLATPVDKPS 484 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P P PP PP Sbjct: 485 PVPSR--PVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPP 527 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/73 (24%), Positives = 18/73 (24%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P P PP PP PP P P P P Sbjct: 601 PVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPV 660 Query: 827 XXXXXPXXXXPXP 865 P P P Sbjct: 661 EKKETPPAHAPAP 673 Score = 29.5 bits (63), Expect = 3.5 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 4/91 (4%) Frame = +2 Query: 629 LFXQXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXX 808 +F P P P P P PP PP P PP + P Sbjct: 572 VFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP---PPPVYSPPPPVFSP 628 Query: 809 PXPXPXXXXXXPXXXXP----XPPXSPPPXP 889 P P P P SPPP P Sbjct: 629 PPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 61.3 bits (142), Expect = 9e-10 Identities = 35/84 (41%), Positives = 35/84 (41%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G GGGG GG GG G G R G G G G Sbjct: 103 GGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGG---GYG 159 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G G GG GG GGGGG G Sbjct: 160 GGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 56.4 bits (130), Expect = 3e-08 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 1/85 (1%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXG-PXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGX 720 GG G G GGG GG GGG G G GG G G G Sbjct: 92 GGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGY 151 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G G GG GG GG GG G Sbjct: 152 GGGGG-GYGGGGGYGGGGGGYGGGG 175 Score = 50.0 bits (114), Expect = 2e-06 Identities = 32/89 (35%), Positives = 35/89 (39%), Gaps = 1/89 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXG-GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G G G G+ G GGG GG GGG G G G R + Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARD 143 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GGGG G G GG GG G GGG G + Sbjct: 144 CSEGGGGYGGGGGGYGGGG-GYGGGGGGY 171 Score = 34.7 bits (76), Expect = 0.093 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 G GG G G GGGG GG GGG G Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 G P G G R G GRG G GGGG G G GG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGR 756 G GG G G GGGG GG GGG G G R GR Sbjct: 157 GYGGGGGYGG--GGGGYGGGGRGGGGGGGSCYSCGESGHFARDCTSGGR 203 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/92 (26%), Positives = 25/92 (27%) Frame = -3 Query: 960 GGGXXXPGXXXXPRXXXXXXXXXXGXGGGEXGGXGXXXXGXXXXXXGXGXGXXXXGXXXA 781 GG G R G GGG GG G G G + Sbjct: 88 GGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPG--HMARDCS 145 Query: 780 PXXGGXXAGXXXXXXXGGXXGXXGGXGXGXXG 685 GG G GG G GG G G G Sbjct: 146 EGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 60.9 bits (141), Expect = 1e-09 Identities = 37/115 (32%), Positives = 39/115 (33%), Gaps = 10/115 (8%) Frame = +1 Query: 646 PXPPP-PPXPPXXXPPXPXPXPPPPPX------PXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P P P PP PP P P PPPP P P+P PP Sbjct: 47 PQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPP 106 Query: 805 XPXXGPXPPPXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP PP PPPP P PP PP+ PPP Sbjct: 107 PPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 60.1 bits (139), Expect = 2e-09 Identities = 39/112 (34%), Positives = 40/112 (35%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPPP-PXPPXXXPPXPXPXPP----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPPP P P PP P PP PPP P P P PP P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTP-PALPPKPLPPPLSPP 100 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPP P P PP P P + PPP Sbjct: 101 QTTPPPPPAITPP--PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 58.4 bits (135), Expect = 7e-09 Identities = 38/108 (35%), Positives = 38/108 (35%), Gaps = 5/108 (4%) Frame = +1 Query: 652 PPPPPX----PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPPP P PP P P PP PP P P PP P P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQP-PPPPQSTSPPPVATTPPALP 89 Query: 820 PXP-PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP PPP P P PP PP PPP Sbjct: 90 PKPLPPPLSPPQTTPPPP-PAITPPPPPAITPP---LSPPPPAITPPP 133 Score = 54.4 bits (125), Expect = 1e-07 Identities = 36/110 (32%), Positives = 36/110 (32%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPP---PPXPPXXXPPXPXPXPPP--PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP PP PP P P PP PP P P PP PP P Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PP P P P P PP PP Sbjct: 121 PLSP-PPPAITPP--PPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 167 Score = 54.0 bits (124), Expect = 1e-07 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 1/85 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P PP PP P PPP P P PP P P P Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 826 P-PPXXXPPXXPPPPXFPXXXPXPP 897 P PP PP PPP P P Sbjct: 146 PLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 54.0 bits (124), Expect = 1e-07 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 1/85 (1%) Frame = +1 Query: 646 PXPPPPPX-PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P P PPP PP PP P PPPP P PP PP P Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK---P 146 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPP 897 PPP P PPPP PP Sbjct: 147 LPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/101 (25%), Positives = 26/101 (25%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP PP PPP P P P Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPP 105 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP PP P P PA P P Sbjct: 106 PPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 5/82 (6%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXP---PPPXPPXXPGXXPXXXXP--XPXRX 821 PP P P P P PP P PPP P P P P P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPA 128 Query: 822 XXXXXPXPXXXPPXPPFPXXPP 887 P P PP P PP Sbjct: 129 ITPPPPLATTPPALPPKPLPPP 150 Score = 36.3 bits (80), Expect = 0.030 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 Q P P P P P PP PP PA P P P P Sbjct: 48 QPDPQPPTPPTFQPAPPANDQPPPPPQSTSPP-PVATTPPALPPKPLPPPLSPPQTTPPP 106 Query: 818 XPXXXXXXPXXXXPXPPXSPPP 883 P P PP SPPP Sbjct: 107 PPAITPPPPPAI--TPPLSPPP 126 Score = 34.3 bits (75), Expect = 0.12 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 6/83 (7%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXX-PPXXPPXXXXPPPPXPPXXPGXXPXXXXP--XPXRXXX 827 PP P P PP P PP P P PP P P P + Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLP 148 Query: 828 XXXPXPXXXPPXPPF---PXXPP 887 P PP PP P PP Sbjct: 149 PPLSPPQTTPPPPPAITPPLSPP 171 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXX-PPXPXPXPPPPP 720 P PPP PP PP P PPPPP Sbjct: 258 PTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPP--XPPXXPGXXPXXXXP 806 P PP PP PPPP PP P P P Sbjct: 258 PTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPP 861 P P PP + PP P P PPP PP PP Sbjct: 262 PPPLPP--QTLKPPP---PQTTPPPPPAITPPLSPP 292 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/110 (36%), Positives = 42/110 (38%), Gaps = 3/110 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGX--GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGX 786 GGG RGG G G G G+ GGG GGG G G GG Sbjct: 302 GGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSS-GIGGYGGG 360 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGG-XGGGGGXGXF 639 GG RG G GG GG G G GG G GGGGG G + Sbjct: 361 MGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGY 410 Score = 51.2 bits (117), Expect = 1e-06 Identities = 37/109 (33%), Positives = 38/109 (34%), Gaps = 2/109 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXG--KXGGGGXXGGXXXGGGXGPXXGXXXXGGX 786 GGG G G GG G G GGGG GG G G G G Sbjct: 281 GGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGP-GDMYGGSYGEPGGGYG 339 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 P G G G G GG GG G GG G GGGG G + Sbjct: 340 GPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGY 388 Score = 50.0 bits (114), Expect = 2e-06 Identities = 38/103 (36%), Positives = 38/103 (36%), Gaps = 1/103 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG G G GG G G GGG G G GGG G G GG Sbjct: 316 GGGYGGGPGDMYGGSYGEPG-GGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGG 374 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG G G G GGG G GG GG GGGG Sbjct: 375 -YDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGG--RGGYGGGG 414 Score = 49.6 bits (113), Expect = 3e-06 Identities = 38/107 (35%), Positives = 39/107 (36%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGX-GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG GG G GG G G+ GG GG GGG GP G G Sbjct: 241 GGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGG---YGGGGYGGGVGPYRGEPALG--- 294 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXG-GGGGXG 645 G G G GGGGG G G G G G GGG G Sbjct: 295 --YSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYG 339 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 2/82 (2%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXG 759 GG P+ G G G G GG G GG GG G G GG GG G Sbjct: 336 GGYGGPSGSYGGGYGSSGIG-GYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGG 394 Query: 758 RGXXXXXXXXXGXGG--GGGXG 699 G G GG GGG G Sbjct: 395 NGGGSFYGGGGGRGGYGGGGSG 416 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/93 (32%), Positives = 31/93 (33%) Frame = -1 Query: 923 PAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXX 744 P+ G G GGG GG GG GP GG R G G G Sbjct: 217 PSKRFGDSRSNFGGGYGDGYGGGHGGGY--GGPGGPYKSGGGYGGG--RSGGYGGYGGEF 272 Query: 743 XXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G GGGG G Sbjct: 273 GGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGG 305 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGR 756 GG G G GGGG G GGG G GG GG GR Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGR 417 Score = 33.9 bits (74), Expect = 0.16 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGG-GGXGXGXGGXXXGGXGGG 657 GGG G G GG GG G G GG GG G GG GG G G Sbjct: 229 GGGYGDGYGGGHGGGY-----GGPGGPYKSGGGYGGGRSGGYGGYGGEFGGY--GGGGYG 281 Query: 656 GGXGXF 639 GG G + Sbjct: 282 GGVGPY 287 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG R GG G GG G GGG G GGG G G P Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAG----GGGNGGGSFYGGGGGRGGYGGGGSGRYHP 420 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 59.3 bits (137), Expect = 4e-09 Identities = 38/112 (33%), Positives = 38/112 (33%), Gaps = 8/112 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXP-RPXPPXXRGXXP---PXXX 804 P P PP PP P P P PP PPP P P P PP P P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVS 134 Query: 805 XPXXGPXPP-PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP PPPP P P P PP PP Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 58.0 bits (134), Expect = 9e-09 Identities = 34/93 (36%), Positives = 34/93 (36%), Gaps = 7/93 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP-RPXPPXXR----GXXPPXXXXP 810 P PPPP P P P PPPP P P P PP PP P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 Query: 811 XXGPXPPPXXXPPXXPPP--PXFPXXXPXPPXP 903 P PPP PP P P P P P PP P Sbjct: 174 MPSP-PPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 56.8 bits (131), Expect = 2e-08 Identities = 37/105 (35%), Positives = 38/105 (36%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P PP P P P PP P P P P PP PP P P Sbjct: 93 PTPPVSPPPPTPTPSVPSPTPPVSPPP--PTPTPSVPSPTPPV---SPPPPTPTPSV-PS 146 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P P P P PP P + PP PPP Sbjct: 147 PTPPVSPPPPTPTPSVP--SPTPPVPTDPMPS----PPPPVSPPP 185 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/105 (31%), Positives = 33/105 (31%), Gaps = 1/105 (0%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P PP PP P P P PP P P P PP PP P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV--SPPPPTPTPSVPSPT 166 Query: 826 PPPXXXPPXXPPPPXF-PXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P PPPP P P P P P PP Sbjct: 167 PPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 54.0 bits (124), Expect = 1e-07 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP--PXXXXPXXG 819 P PPPP P P P PPPP P P P P P P P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPS 191 Query: 820 -PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P P P P P PP P Sbjct: 192 VPSPPDVTPTPPTPSVPSPPDVTPTPPTP 220 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXPXXG 819 P PP P PP P P P PP P P P P P PP P Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPS 206 Query: 820 -PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P P P P PP P P PPP Sbjct: 207 VPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPP---YVPPP 251 Score = 53.2 bits (122), Expect = 2e-07 Identities = 36/107 (33%), Positives = 36/107 (33%), Gaps = 5/107 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PP P PP PP P P P PP P P P PP PP P P Sbjct: 74 PPAPVPPVSPPP-PTPSVPSPTPPVSPPPPTPTPSVPSPTPPV---SPPPPTPTPSV-PS 128 Query: 826 PPPXXXPPXXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P P P P PP P PP P P Sbjct: 129 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP-PXXRGXXPPXXXXPXXGP 822 P P P P P PP P P P P P P P P PP P P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP---P 156 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P PP P PP PP Sbjct: 157 TPTP-SVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPP 203 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 5/97 (5%) Frame = +1 Query: 646 PXPPPP----PXPPXX-XPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP PP P P P P P P PP PP P Sbjct: 165 PTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVT-PTPPTPSVP 223 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGA 921 P PP P P P P P GA Sbjct: 224 SPPDVTPTPPTPPSVPTPSGSPPYVPPPSDEEEAAGA 260 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXP--PXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXX 830 P P P PP P P P P PP P P P P P Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Query: 831 XXPXPXXXPPXPPFPXXPPXXXXP 902 P P P PP P P P Sbjct: 156 PTPTPSVPSPTPPVPTDPMPSPPP 179 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 9/68 (13%) Frame = +1 Query: 781 GXXPPXXXXPXXGPXPPPX---XXPPXXPPP----PXFPXXXP--XPPXPXXXXGAGXXX 933 G PP P P P P PP PPP P P P PP P Sbjct: 71 GYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPT 130 Query: 934 PPRRXXPP 957 PP PP Sbjct: 131 PPVSPPPP 138 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +1 Query: 817 GPXPPPXXXPPXXPPP--PXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPP 957 G PP PP PPP P P P PP P PP PP Sbjct: 70 GGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 120 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 59.3 bits (137), Expect = 4e-09 Identities = 33/82 (40%), Positives = 33/82 (40%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P P P PPPPP P P P PP PP P P PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPP---------PCPPPP-----SPPPCPPP---PSPPPS 88 Query: 838 XXPPXXPPPPXFPXXXPXPPXP 903 PP PPPP P P P P Sbjct: 89 PPPPQLPPPPQLPPPAPPKPQP 110 Score = 54.0 bits (124), Expect = 1e-07 Identities = 28/69 (40%), Positives = 28/69 (40%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP PP P P PPPP P P P PP PP P P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPP---------PSPPPPQ---LPPPPQLPPPAPPKPQ 109 Query: 832 PXXXPPXXP 858 P P P Sbjct: 110 PSPPTPDLP 118 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/86 (39%), Positives = 34/86 (39%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P PP PP P P P PP PP P P Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPP--------SPPPCPP------PP---SPPPSP- 89 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP PP PPP P P PP P Sbjct: 90 PPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P PP PP PP PP P PP P P P P + Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Query: 837 PXPXXXPPXPPFP 875 P P PP P P Sbjct: 106 PKPQPSPPTPDLP 118 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/57 (42%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX--PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPPPP PP PP P P PPP P P P P PP + PP P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQ-PSPPTPDLP 118 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXX 885 PPP P P P P PP PP P PPP PP PP P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPP---CPPP-------PSPPPCPPPPSPPPSPPPPQLP 95 Query: 886 PXPPXPXXXXGAGXXXPPRRXXP 954 P P P PP P Sbjct: 96 PPPQLPPPAPPKPQPSPPTPDLP 118 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXX 933 P P P PP P P PPP PP PPP P P PP Sbjct: 50 PSPEPEPEPADCPPPPPPP---PCPPPPSPPPCPPPPS--PPPSPPPPQLPPPPQLPPPA 104 Query: 934 PPRRXXPPP 960 PP+ PP Sbjct: 105 PPKPQPSPP 113 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 766 PPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PP P P PPP PP PPP P P P P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Query: 946 XXPPP 960 P P Sbjct: 106 PKPQP 110 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 58.8 bits (136), Expect = 5e-09 Identities = 35/112 (31%), Positives = 37/112 (33%), Gaps = 2/112 (1%) Frame = +1 Query: 628 TIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 TI P P PP P P P P P P P P P P PP + P Sbjct: 18 TIVSSAPAPKPPKPKPAPAPTPPKPKPTPAPTP---PKPKPKPAPTPPKPKPAPAPTPPK 74 Query: 808 PXXGPXP-PPXXXPPXXPPPP-XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P PP P P PP P P PP P P+ P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAP 126 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/89 (35%), Positives = 33/89 (37%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXP-PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PP P P PP P P P P PP P P P PP + P P P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKP------KPAPAPTPPKPKPKPAPTPPNPKPTP 101 Query: 823 XP-PPXXXPPXXPPPPXFPXXXPXP-PXP 903 P PP P P P P P P P P Sbjct: 102 APTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/97 (29%), Positives = 31/97 (31%), Gaps = 1/97 (1%) Frame = +1 Query: 673 PXXXPPXPXPXP-PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P PP P P P P PP P P P PP + P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKP------KPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Query: 850 XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P P + P P Sbjct: 78 APAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXP-PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 P P P P PP P P P P P P P P P+P P G Sbjct: 86 PKPKPAPTPPNPKPTPAPTP-PKPKPAPAPAPTPAPKPKPAPKPAPG 131 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P P P PP P P P PP P P P P P P G Sbjct: 75 PKPAPAPTPPKPKPK-PAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPG 131 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/79 (25%), Positives = 20/79 (25%), Gaps = 3/79 (3%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXP---PXXPGXXPXXXXPXPXRXXXX 830 P P P P P P P P P P P P P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Query: 831 XXPXPXXXPPXPPFPXXPP 887 P P P P P P Sbjct: 104 TPPKPKPAPAPAPTPAPKP 122 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 58.8 bits (136), Expect = 5e-09 Identities = 31/104 (29%), Positives = 31/104 (29%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P PP P PP P PP P P P P P PP P P Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPT 169 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P PP P PP Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPP 213 Score = 58.4 bits (135), Expect = 7e-09 Identities = 34/109 (31%), Positives = 35/109 (32%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP PP P P PP P P PP + P P P Sbjct: 54 PPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPK 113 Query: 826 P----PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P PP P P P P P PPP Sbjct: 114 PPIVKPPTKPPPSTPKPPTKP--PPSTPKPPTTKPPPSTPKPPHHKPPP 160 Score = 56.0 bits (129), Expect = 4e-08 Identities = 33/103 (32%), Positives = 34/103 (33%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PP PP PP P PP P P P P PP + P P P P Sbjct: 43 PVKPPKPPAVKPPKPPAVKPPTPKPPTVK-----PHPKPPTVK----PHPKPPTVKPHPK 93 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P PP P PPP Sbjct: 94 PPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 54.8 bits (126), Expect = 8e-08 Identities = 37/109 (33%), Positives = 37/109 (33%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP-XPXXXXXXXXXPRPXPPXXRGXXP-PXXXXPXXG 819 P P PP P PP P P PP P P P PP P P P Sbjct: 63 PTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTK 122 Query: 820 PXPPPXXXPPXXPPP--PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PPP P P P P P PP PPP Sbjct: 123 P-PPSTPKPPTKPPPSTPKPPTTKPPPSTPKPP----HHKPPPTPCPPP 166 Score = 53.6 bits (123), Expect = 2e-07 Identities = 34/108 (31%), Positives = 34/108 (31%), Gaps = 4/108 (3%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-X 813 P PP PPP P P P P PPP P P P PP PP P Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPV---ITPPTPTPPVV 195 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P P PP P PP P PP Sbjct: 196 TPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPP 243 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 3/107 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX--PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P PP P PP P P PP P P P PP + P P Sbjct: 72 PHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPP 131 Query: 820 PXPPP-XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PPP PP PPP P P P P PP Sbjct: 132 TKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Score = 52.0 bits (119), Expect = 6e-07 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXX-PRPXPPXXRGXXPPXXXXPX 813 P PP P P PP PP P P P P P P P P PP P Sbjct: 83 PKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP P P P PP P P Sbjct: 143 TTKPPPSTPKPPHHKPPPT-PCPPPTPTPTPPVVTPPTPTPPVITPPTP 190 Score = 52.0 bits (119), Expect = 6e-07 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPP--PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-XX 816 P PPP P PP PP P P PP P P P PP PP P Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTP--TPPVVTPPTPTPPV---ITPPTPTPPVIT 216 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P P P PP P PP P Sbjct: 217 PPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP--XP 828 PP P PP PP P P PP P P P PP PP P P Sbjct: 177 PPTPTPPVITPPTPTPPVVTPPTP--TPPVITPPTPTPPV---ITPPTPTPPVVTPPTPT 231 Query: 829 PPXXXPPXXPPPPXFPXXXP 888 PP PP PP P P Sbjct: 232 PPVVTPPTPTPPTPIPETCP 251 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 P P P PP PP P PPP P P P P P Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPT 161 Query: 837 PXPXXXPPXPPFPXXPPXXXXP 902 P P P P PP P Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPP 183 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/116 (24%), Positives = 29/116 (25%) Frame = +3 Query: 609 KSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXX 788 K T K + T P P P PP PP P P P P Sbjct: 66 KPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPK---PPTKPHPHPKPPIVKPPTK 122 Query: 789 PXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P P P P P P P P P P PP Sbjct: 123 PPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 3/83 (3%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXP-PXXXXPPPPXPP--XXPGXXPXXXXPXPX 815 T PP P PP P P P PP P PP P P P Sbjct: 161 TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTP 220 Query: 816 RXXXXXXPXPXXXPPXPPFPXXP 884 P P PP P P Sbjct: 221 TPPVVTPPTPTPPVVTPPTPTPP 243 Score = 31.9 bits (69), Expect = 0.65 Identities = 21/82 (25%), Positives = 21/82 (25%), Gaps = 2/82 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T P P P PP P P P P PP P P Sbjct: 132 TKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPT 191 Query: 825 XXXXPXPXXXPP--XPPFPXXP 884 P PP PP P P Sbjct: 192 PPVVTPPTPTPPVITPPTPTPP 213 Score = 31.5 bits (68), Expect = 0.86 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 2/82 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T PP PP P PP PP P PP P P Sbjct: 143 TTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP-VVTPPTPTPPVITPPTPTPPVVTPPTPT 201 Query: 825 XXXXPXPXXXPP--XPPFPXXP 884 P PP PP P P Sbjct: 202 PPVITPPTPTPPVITPPTPTPP 223 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 58.0 bits (134), Expect = 9e-09 Identities = 32/79 (40%), Positives = 33/79 (41%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G GGGG GG GGG G GG GG G G GGGGG G Sbjct: 86 GSGGGGGGRGGS--GGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGY 143 Query: 695 GXGGXXXGGXGGGGGXGXF 639 G GG GG GGG G + Sbjct: 144 GGGGRREGGGYGGGDGGSY 162 Score = 55.6 bits (128), Expect = 5e-08 Identities = 38/88 (43%), Positives = 38/88 (43%), Gaps = 4/88 (4%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG---GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXX 732 G GG G G GGG G GG GGG G G GG R GG G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGG---GGGYERRSGGYGSGGGGGGR- 141 Query: 731 XXGXGGGGGX-GXGXGGXXXGGXGGGGG 651 G GGGG G G GG G GGGGG Sbjct: 142 --GYGGGGRREGGGYGGGDGGSYGGGGG 167 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 57.6 bits (133), Expect = 1e-08 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 1/85 (1%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G GGGG G GGG G GG G G G G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYG 104 Query: 716 GGGGX-GXGXGGXXXGGXGGGGGXG 645 GGGG G G GG GG GGGG G Sbjct: 105 GGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 53.6 bits (123), Expect = 2e-07 Identities = 38/101 (37%), Positives = 38/101 (37%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G GG G G GG GG GGG G G GG Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG---GGGHYG 111 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG 657 GG G G G GGGG G G GG GG G G Sbjct: 112 GGGGGHGGG---------GHYGGGGGGYGGGGGHHGGGGHG 143 Score = 52.8 bits (121), Expect = 3e-07 Identities = 40/106 (37%), Positives = 40/106 (37%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G G G G GG GG GGG G G GG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGH-GLDGYGG--GGGHYGGGGGHYGG---GGGHYG 97 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG-XXXGGXGGGGGXG 645 G G G G GGGG G G GG GG GGGG G Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 41.5 bits (93), Expect = 8e-04 Identities = 34/82 (41%), Positives = 34/82 (41%), Gaps = 5/82 (6%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG--GGGX 702 G GG G GG GGG G G GG GG G G GG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGGG-------GHYGGGGGHYGGGG 93 Query: 701 GX-GXGGXXXGGXGG--GGGXG 645 G G GG GG GG GGG G Sbjct: 94 GHYGGGGGHYGGGGGHYGGGGG 115 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 57.2 bits (132), Expect = 2e-08 Identities = 37/89 (41%), Positives = 37/89 (41%), Gaps = 6/89 (6%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G GGGG GG GGG G G GG R GG G G GG Sbjct: 88 GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 145 Query: 713 G--GG----XGXGXGGXXXGGXGGGGGXG 645 G GG G G GG GG GG GG G Sbjct: 146 GSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 52.4 bits (120), Expect = 4e-07 Identities = 35/84 (41%), Positives = 35/84 (41%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G GG G G GGG GG GGG G G GG G RG Sbjct: 97 GGGGGGYRSG-GGGGYSGGGGSYGGGGGRREG---GGGYSGGGGGYSSRGGGGGSYGGGR 152 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGG 651 GGGG G G GG GG GGGGG Sbjct: 153 REGGGGYGGGEGG-GYGGSGGGGG 175 Score = 34.7 bits (76), Expect = 0.093 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -1 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG--GGXGXF 639 GR G GGGGG G GG G GGG GG G + Sbjct: 76 GRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSY 118 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -1 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GG R GG G G GGGG G GG GG G GG G + Sbjct: 91 GGGGHRGGGGGG----YRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 138 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 758 RGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 RG G GGG G G G GG GGGG Sbjct: 87 RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG 122 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 56.8 bits (131), Expect = 2e-08 Identities = 39/113 (34%), Positives = 40/113 (35%), Gaps = 10/113 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPX-----PPPPPX-----PXXXXXXXXXPRPXPPXXRGXXPPXX 801 PPPPP P PP P PPPPP P P P PP PP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPP 794 Query: 802 XXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPPP + P PP P G PP PPP Sbjct: 795 PAVHYSPPPPPVIHHSQPPPPPIY--EGPLPPIP----GISYASPP----PPP 837 Score = 54.8 bits (126), Expect = 8e-08 Identities = 34/105 (32%), Positives = 34/105 (32%), Gaps = 3/105 (2%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPPP P P P P P PPP P P PP PP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISP----PPPPTPIHSPPPQSHPPCIEYS 757 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P PP PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPP 802 Score = 49.6 bits (113), Expect = 3e-06 Identities = 35/109 (32%), Positives = 36/109 (33%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPP--XPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPPPP P P PPPPP P P+ PP PP P Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTP----IHSPPPQSHPPCIEYSPPP---PPTVH 765 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP--RRXXPPP 960 PPP P PPP P P P PP PPP Sbjct: 766 YNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP 814 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PP P P P P PP P P P P P + P P GP PP Sbjct: 543 PGSPPSPSSPTPSSPIPSPPTPSTP---------PTPISPG-QNSPPIIPSPPFTGPSPP 592 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXP 903 PP P P P P P P Sbjct: 593 SSPSPPLPPVIPSPPIVGPTPSSP 616 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP----PPPXPP-XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP PPP P P P P P P P P PP PP Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPA 775 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPPP P PP P + PP P P Sbjct: 776 HYSPPPSPPVYYYNSPPPP--PAVHYSPPPPPVIHHSQPPPPPIYEGPLP 823 Score = 45.2 bits (102), Expect = 7e-05 Identities = 32/113 (28%), Positives = 33/113 (29%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP-RPXPPXXRGXXPPXXXXPX 813 P PP P P P P P P PP P P P P G P P Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPS 515 Query: 814 XGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 G PP P P PP P PP P + P PP Sbjct: 516 PGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPP 568 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 5/79 (6%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPX-----PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPPP P PP P PPPPP P P P PP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPA------VHYSPPPPPVIHHSQPPPPPIYE-- 819 Query: 817 GPXPPPXXXPPXXPPPPXF 873 GP PP PPPP F Sbjct: 820 GPLPPIPGISYASPPPPPF 838 Score = 42.3 bits (95), Expect = 5e-04 Identities = 31/105 (29%), Positives = 31/105 (29%), Gaps = 3/105 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P P PP P PP P P P P PP P P P Sbjct: 520 PPSPSISPS--PPITVPSPPSTPTSPGSPPSPSSPTPSSPI---PSPPTPSTPPT-PISP 573 Query: 832 PXXXPPXXPPPP---XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P PP P P PP P P PP Sbjct: 574 GQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPP 618 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/86 (31%), Positives = 27/86 (31%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P PP P P P G PP P P Sbjct: 546 PPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIP---SPPFTGPSPPSSPSP---PL 599 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP P P P P P P Sbjct: 600 PPVIPSPPIVGPTPSSP--PPSTPTP 623 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 6/75 (8%) Frame = +1 Query: 628 TIFXXXPXPPPPP--XPPXXXPPXPXPXPPPPP----XPXXXXXXXXXPRPXPPXXRGXX 789 T+ P PP P PP P PPPPP P P PP G Sbjct: 763 TVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPL 822 Query: 790 PPXXXXPXXGPXPPP 834 PP P PPP Sbjct: 823 PPIPGISYASPPPPP 837 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/111 (28%), Positives = 33/111 (29%), Gaps = 9/111 (8%) Frame = +1 Query: 652 PPPPPXP-PXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPX--PPXXRGXXPPXXXXPX 813 P PP P P PP P P PP P P P P PP P P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPS 496 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXPP 957 P P PP P P P P P P + P PP Sbjct: 497 SPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPP 547 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/108 (25%), Positives = 28/108 (25%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP---XPPXXRGXXPPXXXXPXX 816 P P P P P P P PP P P P P PP Sbjct: 485 PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPG 544 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P P P P PP PP Sbjct: 545 SPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPP 592 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/103 (27%), Positives = 28/103 (27%), Gaps = 1/103 (0%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP-XPP 831 P PP P P P PP P P P P P P P Sbjct: 430 PSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPT 489 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P P P P P G P PP Sbjct: 490 PGGSPPSSPTTPT-PGGSP-PSSPTTPSPGGSPPSPSISPSPP 530 Score = 37.9 bits (84), Expect = 0.010 Identities = 32/112 (28%), Positives = 33/112 (29%), Gaps = 10/112 (8%) Frame = +1 Query: 652 PPPPPXP-PXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXP---PXXRGXXPPXXXXP 810 P PP P P PP P P PP P P P P P P P P Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSP-PSPSIVPSPPSTTPSPGSPP 469 Query: 811 XXGPXPPPXXXPPXXPPPP---XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PP P P P P P P + P PP Sbjct: 470 TSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPP 521 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/101 (26%), Positives = 27/101 (26%), Gaps = 1/101 (0%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P P P PP P P G PP P P PP Sbjct: 406 PPVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPP---SPSIVPSPPSTT 462 Query: 841 XPPXXPP-PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P PP G P P P Sbjct: 463 PSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTP 503 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 5/86 (5%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPP--XXPGXXPXXXXPXPXR 818 T PP P P P PP PP P P P P P Sbjct: 532 TVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591 Query: 819 XXXXXXPXPXXXPPXP---PFPXXPP 887 P P P P P P PP Sbjct: 592 PSSPSPPLPPVIPSPPIVGPTPSSPP 617 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P PP P P P P P P P P P P P P Sbjct: 543 PGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSP-PLP- 600 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P P P PP P Sbjct: 601 PVIPSPPIVGPTPSSPPPSTP 621 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXP 812 T PP P PP P P P PP P P P P P Sbjct: 563 TPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPP 618 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 56.8 bits (131), Expect = 2e-08 Identities = 32/109 (29%), Positives = 32/109 (29%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP P PP P P PPP PP P P PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PPP P P P P P P Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/100 (32%), Positives = 32/100 (32%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 P PP P P P PPP P PP PP P PPP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPP-------PVSAPPPVTTSPPPVTTAPPPANPPPPVS 75 Query: 841 XPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPP P PP P PP PPP Sbjct: 76 SPPPASPPPATPPPVASPPPP--VASPPPATPPPVATPPP 113 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPP--PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP P PP P P PPP P PP PP P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPAN-PPPPVSSPPPAS 81 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P P P P P Sbjct: 82 --PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/79 (26%), Positives = 23/79 (29%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXX 899 PP PP PPP P P P P P P PP P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 900 PXXXXGXGXXXXXPAXAPP 956 P P+ +PP Sbjct: 126 PAPTTKPDSPSPSPSSSPP 144 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP PP P P PPP P P PP P P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ--VPAPAPTTKPDSPS 136 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP P P P Sbjct: 137 PSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPPP PP PP P PP P P PP P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPP----VASPPPATPPPVATPPPAPLASPPAQ 122 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P P P P P P Sbjct: 123 VPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/98 (22%), Positives = 24/98 (24%) Frame = +3 Query: 666 PXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P P P PP PP PPPP P P P P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Query: 846 XXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P + +P P Sbjct: 125 APAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P P P P PP PA PP P P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P S PP P Sbjct: 126 PAPTTKPDSPSPSPSSSPPLP 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 3/84 (3%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP--XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXR 818 T P P P P PP PP PPP PP P P + Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122 Query: 819 XXXXXXPXPXXXPPXP-PFPXXPP 887 P P P P P P P Sbjct: 123 ---VPAPAPTTKPDSPSPSPSSSP 143 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 56.8 bits (131), Expect = 2e-08 Identities = 32/109 (29%), Positives = 32/109 (29%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP P PP P P PPP PP P P PP P Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPV 90 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PPP P P P P P P Sbjct: 91 ASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSP 139 Score = 53.2 bits (122), Expect = 2e-07 Identities = 32/100 (32%), Positives = 32/100 (32%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 P PP P P P PPP P PP PP P PPP Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPP-------PVSAPPPVTTSPPPVTTAPPPANPPPPVS 75 Query: 841 XPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPP P PP P PP PPP Sbjct: 76 SPPPASPPPATPPPVASPPPP--VASPPPATPPPVATPPP 113 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPP--PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP P PP P P PPP P PP PP P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPAN-PPPPVSSPPPAS 81 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P P P P P Sbjct: 82 --PPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/79 (26%), Positives = 23/79 (29%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXX 899 PP PP PPP P P P P P P PP P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 900 PXXXXGXGXXXXXPAXAPP 956 P P+ +PP Sbjct: 126 PAPTTKPDSPSPSPSSSPP 144 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP PP P P PPP P P PP P P Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ--VPAPAPTTKPDSPS 136 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP P P P Sbjct: 137 PSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPPP PP PP P PP P P PP P P Sbjct: 67 PANPPPPVSSPPPASPPPATPPPVASPPPP----VASPPPATPPPVATPPPAPLASPPAQ 122 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P P P P P P Sbjct: 123 VPAPAPTTKPDSPSPSPSSSPPLPSSDAP 151 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/98 (22%), Positives = 24/98 (24%) Frame = +3 Query: 666 PXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P P P PP PP PPPP P P P P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVP 124 Query: 846 XXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P + +P P Sbjct: 125 APAPTTKPDSPSPSPSSSPPLPSSDAPGPSTDSISPAP 162 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P P P P PP PA PP P P P Sbjct: 66 PPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPA 125 Query: 827 XXXXXPXXXXPXPPXSPPPXP 889 P S PP P Sbjct: 126 PAPTTKPDSPSPSPSSSPPLP 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 3/84 (3%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP--XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXR 818 T P P P P PP PP PPP PP P P + Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQ 122 Query: 819 XXXXXXPXPXXXPPXP-PFPXXPP 887 P P P P P P P Sbjct: 123 ---VPAPAPTTKPDSPSPSPSSSP 143 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P PP PP P P P P PP P P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP----PPSQPP 1111 Query: 826 PPPXXXPPXXPPPPXFP 876 PPP PP PPPP P Sbjct: 1112 PPPLSPPPSPPPPPPPP 1128 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +1 Query: 673 PXXXPPXPXPXPPP-PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P PP P PPP PP P P P PP PP P PPP P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSP------PPPSPPLPPSSLPPPPPAALFPPLPPPPSQP- 1110 Query: 850 XXPPPPXFPXXXPXPPXP 903 PPPP P P PP P Sbjct: 1111 --PPPPLSPPPSPPPPPP 1126 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXX 933 P PP + PP P P P P P PPPP P PP P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Query: 934 PPRRXXPPP 960 PP PPP Sbjct: 1118 PPSPPPPPP 1126 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 4/71 (5%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXX----PXPXRXXXXXXPXPXXX 854 P P PP PP PPPP PP P P P P P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Query: 855 PPXPPFPXXPP 887 PP PP P PP Sbjct: 1118 PPSPPPPPPPP 1128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 +F P PP P PP PP P PPPPP P G PP Sbjct: 1099 LFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQSLTTQLSIASHHQIPFQPGFPPP 1153 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P P P PP P P P+ PP A P P P P Sbjct: 1062 PPLPQESP--PPLP-PLPPSPPPPSP----PLPPSSLPPPPPAALFP----PLPPPPSQP 1110 Query: 836 XXPXXXXPXPPXSPPPXP 889 P P P PPP P Sbjct: 1111 PPPPLSPPPSPPPPPPPP 1128 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 4/84 (4%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXX-PPXPP---FPXXPP 887 P PP PPP PP P P P P P P PP PP FP PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPP----PSP--------PLPPSSLPPPPPAALFPPLPP 1105 Query: 888 XXXXPXXXXGXGXXXXXPAXAPPP 959 P P PPP Sbjct: 1106 PPSQPPPPP-LSPPPSPPPPPPPP 1128 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 55.6 bits (128), Expect = 5e-08 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 1/75 (1%) Frame = +1 Query: 646 PXPPPPPX-PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPP P PP PP P PP PP P P PP R PP P P Sbjct: 43 PSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPL-FPPPPLPR-LPPPLLPPPEEPP 100 Query: 823 XPPPXXXPPXXPPPP 867 PP PP PPP Sbjct: 101 REPPPPPPPPEEPPP 115 Score = 54.0 bits (124), Expect = 1e-07 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 5/88 (5%) Frame = +1 Query: 655 PPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPP P P PP P P P PP P P P PP P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRL 88 Query: 826 PPPXXXPPXXPP--PPXFPXXXPXPPXP 903 PPP PP PP PP P PP P Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/89 (34%), Positives = 32/89 (35%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 +F P PPP PP P P PPP PR P PP P Sbjct: 33 VFPLLPLSPPPSPPPSPSSP---PRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLP 89 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP PP PPPP P P PP Sbjct: 90 P--PLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 42.3 bits (95), Expect = 5e-04 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP PP PP PP P P P P Sbjct: 20 PPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFP----PEPPLPPRFEL 75 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P PP P PP P P PP Sbjct: 76 PPPLF--PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/103 (31%), Positives = 32/103 (31%), Gaps = 2/103 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P P P PPP P P PP PP P PPP Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSS---------PPRLPPPFPALFPPEPPLPPRFELPPPL 79 Query: 838 X-XPPXXP-PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPP P P P PP PPP Sbjct: 80 FPPPPLPRLPPPLLPPPEEPPREPP------PPPPPPEEPPPP 116 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +1 Query: 766 PPXXRGXX-PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR 942 PP G PP P P PP PP PP P P P PP Sbjct: 20 PPGTTGTCCPPPLVFPLL-PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPP 78 Query: 943 RXXPPP 960 PPP Sbjct: 79 LFPPPP 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP 792 F P PPP P PP P PP P P P R P Sbjct: 73 FELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPASCLRTKSP 125 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 55.6 bits (128), Expect = 5e-08 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 5/91 (5%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGR-----GXXXXX 738 G GG G GGGG GG GG G G GG R GG G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG---RGGGGGDNSCFKCGEPGHM 147 Query: 737 XXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G G GG G GGGGG G Sbjct: 148 ARECSQGGGGYSGGGGGGRYGSGGGGGGGGG 178 Score = 52.4 bits (120), Expect = 4e-07 Identities = 31/87 (35%), Positives = 32/87 (36%), Gaps = 1/87 (1%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G G GG GG GGG G GG G G G Sbjct: 97 GGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGG 156 Query: 716 G-GGGXGXGXGGXXXGGXGGGGGXGXF 639 G GG G G G GG GGGGG + Sbjct: 157 GYSGGGGGGRYGSGGGGGGGGGGLSCY 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 26/71 (36%), Positives = 26/71 (36%) Frame = -1 Query: 863 GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 G G GG G G GG GRG G GGG G G GG Sbjct: 83 GAPVQGNSGGGGSSGGRGG----------FGGGGGRG---------GGRGGGSYGGGYGG 123 Query: 683 XXXGGXGGGGG 651 GG GGGGG Sbjct: 124 RGSGGRGGGGG 134 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G GG GG GGG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGG 114 Score = 32.3 bits (70), Expect = 0.49 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGG--GGXGXGXGGXXXGGXGGGG-GXGXFXKIVFIC 618 G G G G GGG GG G G G GG G GG G G F C Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKC 141 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 55.2 bits (127), Expect = 6e-08 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 1/106 (0%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP-PXXRGXXPPXXXXPXXGP 822 P PPPPP P PP P P P P P P P P P P P P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSP 221 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP P P P P P P P Sbjct: 222 G-PDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLP 266 Score = 54.8 bits (126), Expect = 8e-08 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 6/110 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXP-PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPPP P P P P P P P P P P P P P GP Sbjct: 173 PLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGP 232 Query: 823 XP-----PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P P P P G P PP Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 53.2 bits (122), Expect = 2e-07 Identities = 35/119 (29%), Positives = 40/119 (33%) Frame = +1 Query: 604 IINLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 ++ L + ++ P PPPP PP P P PPPP P P P Sbjct: 147 VLLLLSVIVLWSSDPPLPPPP------PPYPSPLPPPPSPSPTPGPDSPLPSPGP----- 195 Query: 784 XXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P P P P P P PP P G P PPP Sbjct: 196 DSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP-PSSSPTPGPDSPLPSPGPPP 253 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 2/88 (2%) Frame = +1 Query: 646 PXPPPPPXP-PXXXPPXPXPXPPPP-PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPP P P P P P P P P P P P P P PP P G Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLP-SPGPPPSPSPTPG 260 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P P P P P PP P Sbjct: 261 PDSP---LPSPGPDSP-LPSPGPDPPLP 284 Score = 45.6 bits (103), Expect = 5e-05 Identities = 33/101 (32%), Positives = 33/101 (32%), Gaps = 4/101 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P P P P P P P P P PP P GP Sbjct: 189 PLPSPGPDSPL---PLPGPPPSPSPTP-GPDSPLPSPGPDSPLPL-PGPPPSSSPTPGPD 243 Query: 826 PP-PXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXP 936 P P PP P P P P P P P G P Sbjct: 244 SPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 Score = 42.3 bits (95), Expect = 5e-04 Identities = 31/96 (32%), Positives = 31/96 (32%), Gaps = 5/96 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP-PXXXXPXXGP 822 P P P P PP P P P P P P P PP P P P GP Sbjct: 198 PLPLPGP-PPSPSPTPGPDSPLPSPGP-----DSPLPLPGPPPSSSPTPGPDSPLPSPGP 251 Query: 823 XPPPXXXP----PXXPPPPXFPXXXPXPPXPXXXXG 918 P P P P P P P P P P G Sbjct: 252 PPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPG 287 Score = 41.9 bits (94), Expect = 6e-04 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP-PXXXXPXXG- 819 P P P P P P P PPP P P P PP P P P G Sbjct: 212 PGPDSPLPSPGPDSPLPLPGPPPSSSP-TPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGP 270 Query: 820 --PXPPPXXXPPXXPPPP 867 P P P PP P P Sbjct: 271 DSPLPSPGPDPPLPSPGP 288 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/99 (24%), Positives = 24/99 (24%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP 839 P P P P PP P P P P P P P Sbjct: 184 PGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPD 243 Query: 840 XPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P P P G P PP Sbjct: 244 SPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 35.9 bits (79), Expect = 0.040 Identities = 23/98 (23%), Positives = 24/98 (24%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP 839 P P P P P P PPP P PG P P P Sbjct: 173 PLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGP 232 Query: 840 XPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAP 953 P P P P P G P+ P Sbjct: 233 PPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGP 270 Score = 33.1 bits (72), Expect = 0.28 Identities = 28/102 (27%), Positives = 29/102 (28%), Gaps = 1/102 (0%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP P P P P P P P P P Sbjct: 161 PPLPPP---PPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLP-GPPPSPSPTPGPDS 216 Query: 837 PXPXXXPPXP-PFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P P P PP G P+ PPP Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPT-----PGPDSPLPSPGPPP 253 Score = 31.9 bits (69), Expect = 0.65 Identities = 25/103 (24%), Positives = 26/103 (25%), Gaps = 2/103 (1%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXP-PXXPPXXXXP-PPPXPPXXPGXXPXXXXPXPXRXXXX 830 PP P P P P P P P P P P P P P P Sbjct: 168 PPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPL 227 Query: 831 XXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P P P P +P P Sbjct: 228 PLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGP 270 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/73 (24%), Positives = 18/73 (24%) Frame = +2 Query: 659 PXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXX 838 P P P P P PP P PP P P P P Sbjct: 217 PLPSPGPDSPL-PLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLP 275 Query: 839 XPXXXXPXPPXSP 877 P P P P Sbjct: 276 SPGPDPPLPSPGP 288 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 55.2 bits (127), Expect = 6e-08 Identities = 35/107 (32%), Positives = 36/107 (33%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKS 159 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PPPP P PP P + P PPP Sbjct: 160 PPPPPYVYSP--PPPP--PYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 54.4 bits (125), Expect = 1e-07 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPPP P P P PP PP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSS 209 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PPPP + P PP Sbjct: 210 PPPPPYVY--KSPPPPPYVYSSPPPP 233 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSS 299 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PPPP + P PP Sbjct: 300 PPPPPYVY--SSPPPPPYVYKSPPPP 323 Score = 50.4 bits (115), Expect = 2e-06 Identities = 33/112 (29%), Positives = 34/112 (30%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 239 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP-----PXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP + P P P P PP PP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 291 Score = 50.4 bits (115), Expect = 2e-06 Identities = 33/113 (29%), Positives = 34/113 (30%), Gaps = 10/113 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSS 309 Query: 820 PXPPPXXXPPXXPPPPXF------PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP + P PP P P PPP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 50.0 bits (114), Expect = 2e-06 Identities = 35/108 (32%), Positives = 36/108 (33%), Gaps = 5/108 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP---XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPPP PP P PPPPP P P PP PP P Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP---PPYV 196 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 197 YKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 50.0 bits (114), Expect = 2e-06 Identities = 39/123 (31%), Positives = 42/123 (34%), Gaps = 13/123 (10%) Frame = +1 Query: 631 IFXXXPXPP-----PPPXPPXXXPPXPXP----XPPPPP----XPXXXXXXXXXPRPXPP 771 ++ P PP PPP P PP P P PPPPP P P P PP Sbjct: 146 VYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSP-PPPP 204 Query: 772 XXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXX 951 PP P PPP PPPP P PP P + P Sbjct: 205 YVYSSPPP---PPYVYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKS 259 Query: 952 PPP 960 PPP Sbjct: 260 PPP 262 Score = 49.6 bits (113), Expect = 3e-06 Identities = 35/109 (32%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P P + PP P Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP----PY 325 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP + PP P PP PPP Sbjct: 326 VYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYV-----YKPPPYVYKPPP 369 Score = 49.2 bits (112), Expect = 4e-06 Identities = 32/105 (30%), Positives = 33/105 (31%), Gaps = 2/105 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPPPP PP P PPPPP PP P P Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQS 179 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 180 PPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 46.4 bits (105), Expect = 3e-05 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX---PXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPP P P P PP PP P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 125 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP + P PP P PP PPP Sbjct: 126 VYKSPPPPPYVYSSPPPPPYVYSSP-PPPPYVY--KSPPPPPYVYSPPP 171 Score = 45.2 bits (102), Expect = 7e-05 Identities = 31/105 (29%), Positives = 32/105 (30%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P PP PP P PPP P PP PP P Sbjct: 33 PYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPP---PPYVYNS 89 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 90 PPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 44.8 bits (101), Expect = 9e-05 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP P PPP P P PP PP P P Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPPPPYVYTSP-----PPPPYVYKSPPPPPYVDSYSPPPA 354 Query: 832 P--XXXPPXXPPPPXFPXXXPXPPXP 903 P PP PP + PP P Sbjct: 355 PYVYKPPPYVYKPPPYVYNYSPPPAP 380 Score = 44.4 bits (100), Expect = 1e-04 Identities = 33/117 (28%), Positives = 35/117 (29%), Gaps = 14/117 (11%) Frame = +1 Query: 652 PPP-----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXX 804 PPP P PP P P PPP P P P PP PP Sbjct: 45 PPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPP 104 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXP-----PXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP + P P P P + PP PP Sbjct: 105 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPP 161 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/95 (32%), Positives = 32/95 (33%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP-----PXPPXX----XPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXP 792 PPPP P PP PP P PPP P P P PP P Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PPP PPPP + P PP Sbjct: 281 PPPPYVYSSPPPPPYVY--SSPPPPPYVYSSPPPP 313 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/91 (29%), Positives = 28/91 (30%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P P PP P PP PP P PPP PPPP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYI---YSSPPPPPYVY--SSPPPP 83 Query: 868 XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P + P PPP Sbjct: 84 --PYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPPPP PP P PPPP P P PP P Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPA 379 Query: 829 PPXXXPPXXP---PPPXFPXXXPXPP 897 P PP PP P PP Sbjct: 380 PYVYKPPPYVYSYSPPPAPYVYKPPP 405 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 54.4 bits (125), Expect = 1e-07 Identities = 37/112 (33%), Positives = 37/112 (33%), Gaps = 11/112 (9%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPP---XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPP P PP P P PP P P P P PP P P P Sbjct: 62 PPPETPLSSPP-PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSS--P 118 Query: 829 PPXXXPPXXPP---PPXFPXXXP-----XPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP PP PP P P PP P PP PPP Sbjct: 119 PPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Score = 54.0 bits (124), Expect = 1e-07 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 6/108 (5%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP------PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPP P PP P P PP PP P P P PP PP P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEA---PPTT--PIT 139 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PP P P P PPR PP Sbjct: 140 SPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 53.2 bits (122), Expect = 2e-07 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 7/110 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP------XPXPXP-PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P P PP P PP P P P PPPP P PP PP Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTE 131 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXP 954 P P P P PPPP P P P P PP P Sbjct: 132 APPTTPITSP-SPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPP 180 Score = 52.4 bits (120), Expect = 4e-07 Identities = 34/113 (30%), Positives = 34/113 (30%), Gaps = 2/113 (1%) Frame = +1 Query: 628 TIFXXXPXPPPPPXP-PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 TI P P PP P P PP P PPP P P P Sbjct: 89 TIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP 148 Query: 805 XPXXGPXPPPXXXPPXXP-PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P PPP PP A PP R P P Sbjct: 149 PPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSP 201 Score = 51.2 bits (117), Expect = 1e-06 Identities = 36/123 (29%), Positives = 37/123 (30%), Gaps = 11/123 (8%) Frame = +1 Query: 625 NTIFXXXPXPPPPPXPPXXXPP--------XPXPXPPPPPXPXXXXXXXXXPRPXPPXXR 780 N + P PPP PP PP P PPPP P P PP Sbjct: 113 NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPK- 171 Query: 781 GXXPPXXXXPXXGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXX 951 PP P P PP PP P PP P P RR Sbjct: 172 -LVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQ 230 Query: 952 PPP 960 PPP Sbjct: 231 PPP 233 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXX-PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PP P PP PP P P P P PP P P Sbjct: 160 PDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSP 219 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXP---XXXXGAGXXXPPRRXXPPP 960 PP PPPP P PP P PP PPP Sbjct: 220 PPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPP 268 Score = 47.2 bits (107), Expect = 2e-05 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T P P P PP P PP PPPP P P P P Sbjct: 89 TIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP 148 Query: 825 XXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP PP P PA PP Sbjct: 149 PPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 Score = 46.8 bits (106), Expect = 2e-05 Identities = 31/108 (28%), Positives = 31/108 (28%), Gaps = 4/108 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXX----RGXXPPXXXXPX 813 P PP PP PP P PP P P P PP PP P Sbjct: 184 PSPPASEIPP---PPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPT 240 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P PP P P PP Sbjct: 241 PSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPP 288 Score = 45.2 bits (102), Expect = 7e-05 Identities = 30/104 (28%), Positives = 31/104 (29%), Gaps = 1/104 (0%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPP P P P P P P P PP PP P P Sbjct: 217 PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPS-----PPEETLPPPKPS 271 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP-PRRXXP 954 P P PP P PP P +G P P P Sbjct: 272 PDPLPSNSSSPPTLLPPSSVVSPPSPPRKSVSGPDNPSPNNPTP 315 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/104 (27%), Positives = 29/104 (27%), Gaps = 4/104 (3%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P P PP P P P P PP PP P P P Sbjct: 41 PTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSP 100 Query: 838 XXP-PXXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXPP 957 P P PPP P P P P P A P PP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPP 144 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/102 (25%), Positives = 28/102 (27%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P PP P PP P P + P P P P Sbjct: 77 PPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPV---SSPPPESSPPPPPPTEAP 133 Query: 836 XXPXXXXPXPPXSPPPXPXXXXXLXXXXRGXXXXPGXXXPPP 961 P PP +PPP P L P PP Sbjct: 134 PTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 36.3 bits (80), Expect = 0.030 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP-PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX-GPX 825 PPP P P P P P P P P P P GP Sbjct: 27 PPPQPSFPGDNATSPTREPTNGNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPP 86 Query: 826 PPP--XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPP P P P P PP PPP Sbjct: 87 PTTIPVSPPPEPSPPPPLPTEAPPPANPV------SSPPPESSPPPP 127 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T P P P P P PP PPPP P P P P Sbjct: 66 TPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEP-SPPPPLPTEAP--PPANPVSSPPPES 122 Query: 825 XXXXPXPXXXPPXPPFPXXPPXXXXP 902 P P PP P P P Sbjct: 123 SPPPPPPTEAPPTTPITSPSPPTNPP 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/105 (22%), Positives = 24/105 (22%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P P P P PP P P P P P P P P Sbjct: 51 PETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIP----VSPPPEPSPPPPLPT 106 Query: 827 XXXXXPXXXXPXPPXSPPPXPXXXXXLXXXXRGXXXXPGXXXPPP 961 PP S PP P P PPP Sbjct: 107 EAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 54.0 bits (124), Expect = 1e-07 Identities = 32/106 (30%), Positives = 32/106 (30%), Gaps = 3/106 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPPP P PP PPPP P P P P PP P Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPP 516 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPP P P PP PP PP Sbjct: 517 YVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPP 562 Score = 54.0 bits (124), Expect = 1e-07 Identities = 40/118 (33%), Positives = 43/118 (36%), Gaps = 15/118 (12%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP----------PXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 PPPPP PP PP P PPPP P P + PP PP Sbjct: 523 PPPPPSPP---PPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVT 579 Query: 802 XXPXXGPXPPPXXXPP--XXPPPP---XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PP PPPP +P P PP P + PP PPP Sbjct: 580 NSP---PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPP-----SPLYYPPVTPSPPP 629 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/99 (29%), Positives = 30/99 (30%), Gaps = 5/99 (5%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P P PPPPP P PP PP P PP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYV 500 Query: 838 XXPPXXP-----PPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P P PPP + P PP P PP Sbjct: 501 YSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPP 539 Score = 49.6 bits (113), Expect = 3e-06 Identities = 32/101 (31%), Positives = 34/101 (33%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P PP PPPP P P P P P P PP Sbjct: 567 PPPPSPVYYPPVTNS--PPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVT 624 Query: 838 XXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P +P P PP P + PP PPP Sbjct: 625 PSPP-PPSPVYYPPVTPSPPPP-----SPVYYPPVTPSPPP 659 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/111 (30%), Positives = 36/111 (32%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP----XXXXPXXGP 822 PPPP PP P PPP P P PP PP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPP 553 Query: 823 XPPPXXXPP--XXPPPP---XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPPP +P PP P + PP PPP Sbjct: 554 PPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP-----SPVYYPPVTYSPPP 599 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/102 (30%), Positives = 33/102 (32%), Gaps = 1/102 (0%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P PP PPP P P P PP P P P P Sbjct: 582 PPPPSPVYYPPVTYSPPPPSPV----YYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPP 637 Query: 838 XXPPXXPPPP-XFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P +P P PP P + P PPP Sbjct: 638 VTPSPPPPSPVYYPPVTPSPPPP-----SPVYYPSETQSPPP 674 Score = 45.6 bits (103), Expect = 5e-05 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 13/109 (11%) Frame = +1 Query: 652 PPPPPX---PPXXXPPXPXP-----XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 PPP P P PP P P P PP P P P PP PP Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSP-VYYPPVTPS 641 Query: 808 PXXGPXPPPXXXPPXXP-PPPXFPXXXP----XPPXPXXXXGAGXXXPP 939 P P P P PP P PPP P P PP P + PP Sbjct: 642 P---PPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPP 687 Score = 44.8 bits (101), Expect = 9e-05 Identities = 29/102 (28%), Positives = 31/102 (30%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP P PPPPP P PP + P P P P P Sbjct: 407 PPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSK-MSPSVRAYPPP-PPPSP 464 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P PP P + P PPP Sbjct: 465 SPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/98 (31%), Positives = 31/98 (31%), Gaps = 14/98 (14%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP---PXXRGXXPP---XXXXPX 813 P PPP P PP P PPPP P P P P PP P Sbjct: 625 PSPPPPSPVYYPPVT-PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPS 683 Query: 814 XGPXP--------PPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP P PPP P PP P Sbjct: 684 QSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSP 721 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/99 (27%), Positives = 29/99 (29%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP 839 P P P PP P PP PPPP P P P P P Sbjct: 552 PPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYP---PVTYSPPPPSPVYYPQV 608 Query: 840 XPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P PP P + PP P P+ PP Sbjct: 609 TPSPPPPSPLY--YPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 5/107 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PPP P PP PPPP P P P P PP P P P Sbjct: 610 PSPPPPSPLYYPPVTPS--PPPPSPVYYPPVTPSPPPPSPV---YYPPVTPSP---PPPS 661 Query: 832 PXXXP--PXXPPPP---XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PPPP + PP G P PP Sbjct: 662 PVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPP 708 Score = 37.5 bits (83), Expect = 0.013 Identities = 27/96 (28%), Positives = 28/96 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P PP PP P P P P PP + PP Sbjct: 651 PPVTPSPP---PPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPP 707 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P PPPP P PP P A PP Sbjct: 708 PEYSYSSSPPPPS-PTSY-FPPMPSVSYDASPPPPP 741 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/79 (27%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +2 Query: 656 PPXPXXXXXXPXX-PXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXX 832 PP P P P PP PP PP + P P P Sbjct: 459 PPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYV 518 Query: 833 XXXPXXXXPXPPXSPPPXP 889 P P PP PPP P Sbjct: 519 YSSP---PPPPPSPPPPCP 534 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/89 (25%), Positives = 24/89 (26%), Gaps = 13/89 (14%) Frame = +1 Query: 646 PXPPPP-----------PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP--RPXPPXXRGX 786 P PPPP P PP P PPP P P P Sbjct: 655 PSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSS 714 Query: 787 XPPXXXXPXXGPXPPPXXXPPXXPPPPXF 873 PP P P PPPP + Sbjct: 715 SPPPPSPTSYFPPMPSVSYDASPPPPPSY 743 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 53.6 bits (123), Expect = 2e-07 Identities = 40/105 (38%), Positives = 41/105 (39%), Gaps = 1/105 (0%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXX-GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG + GG A GG G G GG G GG GGG G G GG Sbjct: 93 GGIGKYGGIGGAAGIGGFHSIGGVGGLGGVGGGVGGLGGV--GGGVGGLGGVGGLGGAGL 150 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG G G GG GG G GG G Sbjct: 151 GGVGGVG-GGIGKAGGIGGLGGLGGAGGGLGG--VGGLGKAGGIG 192 Score = 47.6 bits (108), Expect = 1e-05 Identities = 39/112 (34%), Positives = 39/112 (34%), Gaps = 4/112 (3%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXX--GGXXXGGGXGPXXGXXXXGGXX 783 GG GG P G G G G G GG GG GG G G G Sbjct: 76 GGVAGVGGLGMPLIGGLGGIGKYGGIGGAAGIGGFHSIGGVGGLGGVGGGVGGLGGVGGG 135 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG-XXXGGXGGG-GGXGXFXK 633 GG G G GGG G G GG GG GGG GG G K Sbjct: 136 VGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGK 187 Score = 43.2 bits (97), Expect = 3e-04 Identities = 31/90 (34%), Positives = 31/90 (34%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPR 777 GG GG G GG G G GG G G GGG G G GG Sbjct: 117 GGLGGVGGGVGGLGGVGGGVGGLGGVGG-LGGAGLGGVGGVGGGIGKAGGIGGLGGL--- 172 Query: 776 XXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G G G G G GGG G G G Sbjct: 173 GGAGGGLGGVGGLGKAGGIGVGGGIGGGHG 202 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXG 807 GGG + GG G GG G G GG G GGG G G Sbjct: 157 GGGIGKAGGIGGLGGLGGAG-GGLGGVGGLGKAGGIGVGGGIGGGHGVVGG 206 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 52.8 bits (121), Expect = 3e-07 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P PPP P PP G PP P GP PPP PP PPPP Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXP 726 PPPPP PP PP P PPPP P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXP 726 PPPPP P PP P PPPPP P Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 754 PRPXPPXXRGXXP---PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAG 924 PRP P G P P G PPP PP PPP P PP P G G Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRG 711 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPP PP PP P PPPPP Sbjct: 682 PPPPPGGGPP--PPPGGGPPPPPPP 704 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 PP P P PP P PPPPP P P PP G Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPP------GGGPPPPPPPPGALG 709 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 673 PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P PPPPP P P PP G PP P Sbjct: 668 PSARPPLPGGGPPPPPPP---------PGGGPPPPPGGGPPPPPPP 704 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXP 812 P P PP PP PP PP PG P P P Sbjct: 668 PSARPPLPGGGPPPPPP----PPGGGPPPPPGGGPPPPPPPP 705 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 52.8 bits (121), Expect = 3e-07 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 9/95 (9%) Frame = -1 Query: 902 GXGGXGXXXG-KXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXG--------RGX 750 G GG G G K GGGG GG GGG G G GG GG G R Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSS 62 Query: 749 XXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GG GG GGG G Sbjct: 63 YISRDNFESDPKGGSGGGGKGGGGGGGISGGGAGG 97 Score = 50.8 bits (116), Expect = 1e-06 Identities = 32/99 (32%), Positives = 33/99 (33%) Frame = -1 Query: 941 RGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGX 762 +GG G GG G G GGGG GG GG G G Sbjct: 4 KGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSY 63 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G G GG GG GG G G Sbjct: 64 ISRDNFESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCG 102 Score = 50.8 bits (116), Expect = 1e-06 Identities = 41/118 (34%), Positives = 41/118 (34%), Gaps = 15/118 (12%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXX----- 795 GGG GG G GG G G GGGG GG GGG G Sbjct: 10 GGGGKGGGGG---GSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISR 66 Query: 794 --------GGXXPRXXGGXGRGXXXXXXXXX--GXGGGGGXGXGXGGXXXGGXGGGGG 651 GG GG G G G GGG G G GG GG GGGGG Sbjct: 67 DNFESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGG 124 Score = 49.2 bits (112), Expect = 4e-06 Identities = 36/110 (32%), Positives = 38/110 (34%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXG---- 792 G G +GG + G GG G G GGG GG GGG G Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGG-KSGGGGGGGGYMVAPGSNRSSYISR 66 Query: 791 -GXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GGG G G GG GG GGGG G Sbjct: 67 DNFESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/69 (40%), Positives = 30/69 (43%) Frame = -1 Query: 860 GGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGX 681 GG GG GGG G G GG + G G+ G GG GG G G GG Sbjct: 75 GGSGGGGKGGGGGGGISG----GGAGGKSGCGGGKSGGGGGGGKNG-GGCGGGGGGKGGK 129 Query: 680 XXGGXGGGG 654 GG GGGG Sbjct: 130 SGGGSGGGG 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/75 (37%), Positives = 29/75 (38%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G GGGG GG G G G GG GG G+ GGG G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKN-----------GGGCGGGG 123 Query: 695 GXGGXXXGGXGGGGG 651 G G GG GGGG Sbjct: 124 GGKGGKSGGGSGGGG 138 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -1 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GG G+G G GGGGG G GG GG GGGG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGG-GRGGGGG-GGAKGGCGGGGKSGGGGGG 49 Score = 38.7 bits (86), Expect = 0.006 Identities = 33/95 (34%), Positives = 34/95 (35%), Gaps = 18/95 (18%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGG--- 705 G GG G GG GGG G G GG + GG G G G GGGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAK--GGCGGG-----GKSGGGGGGGGYMV 54 Query: 704 ---------------XGXGXGGXXXGGXGGGGGXG 645 GG GG GGGGG G Sbjct: 55 APGSNRSSYISRDNFESDPKGGSGGGGKGGGGGGG 89 Score = 35.1 bits (77), Expect = 0.070 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG + G G G GK GGGG GG GGG G G GG Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGG--GKSGGGG--GGGKNGGGCG--GGGGGKGGKSG 131 Query: 779 RXXGGXG 759 GG G Sbjct: 132 GGSGGGG 138 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/67 (37%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG--GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXX 729 G GG G G GG G GG GGG G G G GG G+G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGG-------GGGGKG----GKSG 131 Query: 728 XGXGGGG 708 G GGGG Sbjct: 132 GGSGGGG 138 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 52.4 bits (120), Expect = 4e-07 Identities = 38/114 (33%), Positives = 38/114 (33%), Gaps = 11/114 (9%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPP PP PP P P P PPPPP P PP PP Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPV-- 112 Query: 811 XXGPXPPPXXXPPXXPP----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PP PP P PP P PP PPP Sbjct: 113 NLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVL---LSPPPPPVLFSPPP 163 Score = 50.8 bits (116), Expect = 1e-06 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 10/115 (8%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXP--XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PP PPP P PP P PPPPP P PP PP Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPV- 121 Query: 808 PXXGPXPPPXXXPPXXPP----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PP PP P PP P PP PPP Sbjct: 122 -LLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLF----SPPPPTVTRPPP 171 Score = 48.8 bits (111), Expect = 5e-06 Identities = 39/121 (32%), Positives = 39/121 (32%), Gaps = 16/121 (13%) Frame = +1 Query: 646 PXPPPP----PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPP P PP P P P PPPPP P PP PP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPV-NLSPPPPP 147 Query: 805 XPXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPP-----RRXXPP 957 P PP PP PPPP P PP P PP R PP Sbjct: 148 VLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPP 207 Query: 958 P 960 P Sbjct: 208 P 208 Score = 47.6 bits (108), Expect = 1e-05 Identities = 35/107 (32%), Positives = 35/107 (32%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP PPPPP P PP PP P PP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSP--------PPPPVNLSPPPPPVNL---SPPPP 92 Query: 832 PXXXPPXXPP----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP P PP P PP PPP Sbjct: 93 PVLLSPPPPPVNLSPPPPPVNLSPPPPPVL---LSPPPPPVLLSPPP 136 Score = 46.8 bits (106), Expect = 2e-05 Identities = 33/109 (30%), Positives = 35/109 (32%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP PPP P PP P PPP P P P R PP Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSP------PPPTVTRPPPPPTITRSP 179 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPPP + PP P A +R PPP Sbjct: 180 PPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSY---KRSPPPP 225 Score = 41.5 bits (93), Expect = 8e-04 Identities = 32/102 (31%), Positives = 32/102 (31%), Gaps = 4/102 (3%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP PPP P PP P PPP P PRP PP Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPP--PPTITRSPPPPRPQAAAYYKKTPPPPPYKY 201 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PPP PP PP PP P G PP Sbjct: 202 GRVYPPP---PP--PPQAARSYKRSPPPPPPSKYGRVYSPPP 238 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/99 (31%), Positives = 31/99 (31%), Gaps = 8/99 (8%) Frame = +1 Query: 688 PXPXPX----PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXX 855 P P P PPPPP P PP PP P PPP P Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVN--LSPPPPPVNLSPPP 91 Query: 856 PP----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P PP P PP PPP Sbjct: 92 PPVLLSPPPPPVNLSPPPPP---VNLSPPPPPVLLSPPP 127 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +1 Query: 652 PPPPPX----PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PP P P P PP + P Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP--QAARSYKRSPP--- 223 Query: 820 PXPPPXXXPPXXPPPP 867 P PP PPPP Sbjct: 224 PPPPSKYGRVYSPPPP 239 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 52.0 bits (119), Expect = 6e-07 Identities = 39/109 (35%), Positives = 39/109 (35%), Gaps = 6/109 (5%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXX-GXGGXGXXXGKXG----GGGXXGGXXXGGGXGPXXGXXXX 795 G G RGG P G GG G G G G G G G G GP Sbjct: 14 GRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWS 73 Query: 794 GGXXPRXXGGXGRG-XXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G PR GG G G GGGGG G G G GG G GG Sbjct: 74 GPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQGQGG 122 Score = 46.8 bits (106), Expect = 2e-05 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 3/89 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G G G G G G GG G GG G G GG PR G RG Sbjct: 18 GGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRG 77 Query: 725 GX-GGGGGXGXGXGGXXXGGX-GGGGGXG 645 GGGGG G G G GGGGG G Sbjct: 78 PRPGGGGGPGPGPWSGPRGPRPGGGGGPG 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G RG P GG G G G G GGG GP G G Sbjct: 61 GPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSG---PRGPRPGGGGGPGSGCGSGTGGGN 117 Query: 779 RXXGGXGR 756 + GG R Sbjct: 118 QGQGGMWR 125 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 52.0 bits (119), Expect = 6e-07 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 1/75 (1%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXG-GXGRGXXXXXXXXXGXGGGGGXGXGX 690 GGGG GG GGG G G G G G GR GGG G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGG 155 Query: 689 GGXXXGGXGGGGGXG 645 GG G G G G G Sbjct: 156 GGGGDGSSGSGSGSG 170 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -1 Query: 887 GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGG 708 G GGGG G GGG G G G G G GGGG Sbjct: 138 GEYSASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGG 197 Query: 707 GXGXGXGGXXXG-GXGGGGGXG 645 G G G GG G G G G G G Sbjct: 198 GGGGGGGGGVDGSGSGSGSGSG 219 Score = 48.4 bits (110), Expect = 7e-06 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 4/88 (4%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP----RXXGGXGRGXXXXXXXX 729 GG G G GGGG G G G G G P GG G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGG-------- 196 Query: 728 XGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G G G G GGG G Sbjct: 197 -GGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/104 (32%), Positives = 34/104 (32%), Gaps = 18/104 (17%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXG----GXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXX 735 G GG G G G GG G G G G G G G GG G G Sbjct: 97 GGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGG 156 Query: 734 XXX------GXGGGGGXGXGXGGXXX--------GGXGGGGGXG 645 G G G G G G G GG GGGGG G Sbjct: 157 GGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGG 200 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G GG G G G G G GP GG GG G G G Sbjct: 155 GGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGG------GGGGGG---------G 199 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGG 651 GGGGG G G G GGG G Sbjct: 200 GGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/105 (27%), Positives = 29/105 (27%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G G GG GGG G G GG Sbjct: 53 GGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGS-- 110 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G G G GGG G G Sbjct: 111 ---GGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEG 152 Score = 35.1 bits (77), Expect = 0.070 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = -1 Query: 848 GGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG---GGGXGXGXGGXX 678 GG GGG G G G G G GG GGG G G GG Sbjct: 47 GGGGGGGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGG-- 104 Query: 677 XGGXGGGGG 651 GG GG GG Sbjct: 105 -GGGGGSGG 112 Score = 35.1 bits (77), Expect = 0.070 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGX---GGGGGXGX 696 GGGG GG GG G G G G G GGGGG G Sbjct: 48 GGGGGGGGASVEGGTEKGIDDNANG-----YGDGNGNGNAHGRADCPGGIVVGGGGGGGG 102 Query: 695 GXGGXXXGGXGGGGGXGXF 639 G GG GG G GG G F Sbjct: 103 GGGG---GG-GSGGSNGSF 117 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/91 (26%), Positives = 24/91 (26%) Frame = -1 Query: 917 PXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXX 738 P G GG G GG G G G G G G G Sbjct: 42 PICAAGGGGGGGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGG 101 Query: 737 XXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG GG G G G G G Sbjct: 102 GGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 52.0 bits (119), Expect = 6e-07 Identities = 34/107 (31%), Positives = 35/107 (32%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 169 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPPP P PP P + P PPP Sbjct: 170 PPPPPYVY--SSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 52.0 bits (119), Expect = 6e-07 Identities = 34/107 (31%), Positives = 35/107 (32%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 249 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPPP P PP P + P PPP Sbjct: 250 PPPPPYVY--SSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 52.0 bits (119), Expect = 6e-07 Identities = 34/107 (31%), Positives = 35/107 (32%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 329 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPPP P PP P + P PPP Sbjct: 330 PPPPPYVY--NSPPPP--PYVYKSPPPPPYVYSSPPPSPYVYKSPPP 372 Score = 51.2 bits (117), Expect = 1e-06 Identities = 34/107 (31%), Positives = 35/107 (32%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKS 109 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPPP P PP P + P PPP Sbjct: 110 PPPPPYVY--SSPPPP--PYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 350 PPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 409 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PPPP + P PP Sbjct: 410 PPPPPYVY--SSPPPPPYVYKSPPPP 433 Score = 50.4 bits (115), Expect = 2e-06 Identities = 33/112 (29%), Positives = 34/112 (30%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 189 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP-----PXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP + P P P P PP PP Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 241 Score = 50.4 bits (115), Expect = 2e-06 Identities = 33/112 (29%), Positives = 34/112 (30%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 210 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 269 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP-----PXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP + P P P P PP PP Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 321 Score = 49.2 bits (112), Expect = 4e-06 Identities = 36/114 (31%), Positives = 37/114 (32%), Gaps = 11/114 (9%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP-PPPPYVYKSPPPPPYVYN 338 Query: 814 XGPXPPPXXXPPXXPP-----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PP PP P PP P + P PPP Sbjct: 339 SPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 4/85 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPP P P P PP PP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSS 439 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP 894 P PPP PPP + P P Sbjct: 440 PPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 70 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP-PPPPYVYSSPPP---PPY 125 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 126 VYKSPPPPPYVYNSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYNSPPP---PPY 145 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 146 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 150 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 205 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 206 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 170 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 225 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 226 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 230 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 285 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 286 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 305 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 306 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 310 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYSSPPP---SPY 365 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 366 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 48.8 bits (111), Expect = 5e-06 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 330 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSP-PPPPYVYSSPPP---PPY 385 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 386 VYKSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 48.0 bits (109), Expect = 9e-06 Identities = 31/88 (35%), Positives = 32/88 (36%), Gaps = 6/88 (6%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPPP PP P PPPPP P P P PP PP P Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPP---PPY 425 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 PPP PPPP + P PP Sbjct: 426 VYKSPPPPPYVYSSPPPPPYVYKSPSPP 453 Score = 48.0 bits (109), Expect = 9e-06 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 4/88 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP--XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP P PPPPP P PP PP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 449 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP PPPP + PP P Sbjct: 450 PSPPPYVY-KSPPPPPSYSYSYSSPPPP 476 Score = 47.6 bits (108), Expect = 1e-05 Identities = 36/123 (29%), Positives = 41/123 (33%), Gaps = 13/123 (10%) Frame = +1 Query: 631 IFXXXPXPP-----PPPXPPXXXPPXPXP----XPPPPP----XPXXXXXXXXXPRPXPP 771 ++ P PP PPP P P P P PPPPP P P P P Sbjct: 346 VYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPY 405 Query: 772 XXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXX 951 + PP P PPP PPPP + P PP P + Sbjct: 406 VYKSPPPP----PYVYSSPPPPPYVYKSPPPPPYVYSSP-PPPPYVYKSPSPPPYVYKSP 460 Query: 952 PPP 960 PPP Sbjct: 461 PPP 463 Score = 43.6 bits (98), Expect = 2e-04 Identities = 33/107 (30%), Positives = 34/107 (31%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PP PP P PPPPP P P P PP PP P Sbjct: 32 PPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSP-PPPPYVYSSPPP---PPYIY 87 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + P PPP Sbjct: 88 KSPPPPPYVYSSPPPP--PYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/74 (32%), Positives = 26/74 (35%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP P PPP P P P P + PP P PP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPP----YVYSSPPPPPYVYKSPSPPPYVYKSP-PPPP 464 Query: 832 PXXXPPXXPPPPXF 873 PPPP + Sbjct: 465 SYSYSYSSPPPPIY 478 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 9/39 (23%) Frame = +1 Query: 631 IFXXXPXPP-----PPPXPPXXXPPXPXP----XPPPPP 720 ++ P PP PPP P P P P PPPPP Sbjct: 426 VYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 51.6 bits (118), Expect = 8e-07 Identities = 34/113 (30%), Positives = 34/113 (30%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPP P PP P P PPP P P PP PP Sbjct: 45 PQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPAT 104 Query: 811 XXGPXPPPXXXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P P P P PP P PP PP Sbjct: 105 TP-PAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Score = 50.0 bits (114), Expect = 2e-06 Identities = 31/110 (28%), Positives = 32/110 (29%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP-----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP PPP P PP P PPP P PP PP Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPS 147 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 G P P P P P P PP + P PPP Sbjct: 148 PPGETPSPPKPSPSTPTPTT-TTSPPPPPATSASPPSSNPTDPSTLAPPP 196 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/111 (28%), Positives = 33/111 (29%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP--XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PPP PP P P P PPP P P PP P P Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Query: 820 P--XPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP P PP P P PP P PP+ PP Sbjct: 92 VVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 47.2 bits (107), Expect = 2e-05 Identities = 34/114 (29%), Positives = 34/114 (29%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR---PXPPXXRGXXPPXXXXP-- 810 P PPP PP P P PPP P P PP PP P Sbjct: 66 PSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSP 125 Query: 811 ----XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P P PP P P PPP Sbjct: 126 PAPTTTNPPPKPSPSPPGETPSP--PGETPSPPKP----SPSTPTPTTTTSPPP 173 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP P P P P P P P P PP P P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P P P P Sbjct: 175 PATSASPPSSNPTDPSTLAPPPTPLP 200 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/107 (28%), Positives = 33/107 (30%), Gaps = 6/107 (5%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR-GXXPPXXXXPXXGPXPPP 834 PPP P P PPP P P+ PP PP P PPP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSP---------PQSPPPVVSSSPPPPVVSSPPPSSSPPP 72 Query: 835 XXXPPXXPPPPXFPXXXPXPP-----XPXXXXGAGXXXPPRRXXPPP 960 PP PP P PP P PP+ PPP Sbjct: 73 --SPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPP 117 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 5/108 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP----XXG 819 P P PP PP P P PPP P P PP P Sbjct: 29 PTTPSAPPPVTPP-PSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASS 87 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP-PRRXXPPP 960 P PP P P P P P A P P PPP Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP 135 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P PP P PP PP Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTL 192 Query: 826 PPPXXXPPXXP 858 PP P P Sbjct: 193 APPPTPLPVVP 203 Score = 35.5 bits (78), Expect = 0.053 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 3/82 (3%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P P PPP P PP PP P PPP Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPS----PPQSPPPVVSSSPPPPV 60 Query: 841 X---PPXXPPPPXFPXXXPXPP 897 PP PPP P PP Sbjct: 61 VSSPPPSSSPPPSPPVITSPPP 82 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/86 (25%), Positives = 22/86 (25%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T PP P P PP P PP PP P P P P P Sbjct: 112 TVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP--KPSPSTPTPTTTT 169 Query: 825 XXXXPXPXXXPPXPPFPXXPPXXXXP 902 P P P P P Sbjct: 170 SPPPPPATSASPPSSNPTDPSTLAPP 195 Score = 33.1 bits (72), Expect = 0.28 Identities = 22/86 (25%), Positives = 22/86 (25%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T PP P P PP PP P PG P P P Sbjct: 105 TPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSP---- 160 Query: 825 XXXXPXPXXXPPXPPFPXXPPXXXXP 902 P PP PP P P Sbjct: 161 STPTPTTTTSPPPPPATSASPPSSNP 186 Score = 32.7 bits (71), Expect = 0.37 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T PP PP PP PP PP PP P P Sbjct: 19 TTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPP-PPVVSSPPPSSSPPPSPPVI 77 Query: 825 XXXXPXPXXXPPXPPFPXXPP 887 P PP P PP Sbjct: 78 TSPPPTVASSPPPPVVIASPP 98 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P PP PP PP P P P Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSP 64 Query: 837 PXPXXXPPXPPFPXXPP 887 P PP PP PP Sbjct: 65 PPSSSPPPSPPVITSPP 81 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/87 (25%), Positives = 23/87 (26%), Gaps = 3/87 (3%) Frame = +2 Query: 638 QXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXP 817 Q P P P P P PP PP P P P P P Sbjct: 26 QTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPS---PPVITSPPP 82 Query: 818 XPXXXXXXPXXXXPXPPXSP---PPXP 889 P PP +P PP P Sbjct: 83 TVASSPPPPVVIASPPPSTPATTPPAP 109 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/88 (22%), Positives = 22/88 (25%) Frame = +2 Query: 626 ILFXQXXPXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXX 805 ++ P P P P P P P P P G P Sbjct: 92 VVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSP--- 148 Query: 806 XPXPXPXXXXXXPXXXXPXPPXSPPPXP 889 P P P P SPPP P Sbjct: 149 -PGETPSPPKPSPSTPTPTTTTSPPPPP 175 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 51.6 bits (118), Expect = 8e-07 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP P P PPP P PP PP P P Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPP----PVKSP 100 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP + P PP P PP + PPP Sbjct: 101 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 50.8 bits (116), Expect = 1e-06 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP P P PPP P PP PP P P Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSP 132 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP + P PP P PP + PPP Sbjct: 133 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 50.8 bits (116), Expect = 1e-06 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP P P PPP P PP PP P P Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSP 148 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP + P PP P PP + PPP Sbjct: 149 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 50.4 bits (115), Expect = 2e-06 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP P P PPP P PP PP P P Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPP----PVKSP 116 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PP PPP + P PP P PP + PPP Sbjct: 117 PPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 6/88 (6%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG- 819 PPPP P PP P P PPP P PP PP P Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 184 Query: 820 --PXPPPXXXPPXXPPPPXFPXXXPXPP 897 PPP P PPPP + P PP Sbjct: 185 LYSSPPP---PVKSPPPPVYIYASPPPP 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/102 (28%), Positives = 31/102 (30%), Gaps = 2/102 (1%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P P P PPPP P P PP P P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP--PYVYSSP 93 Query: 841 XPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PP PPP + P PP P PP + PPP Sbjct: 94 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/122 (25%), Positives = 35/122 (28%) Frame = +3 Query: 594 MLVNYKSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPX 773 +LV T YY+ PP P P PP PP PPP P Sbjct: 20 LLVGSAMATEPYYYSS-----PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPP-PYY 73 Query: 774 XPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAP 953 P P P P P PP P + PP P +P Sbjct: 74 YHSPPPPVKSPPPP-YVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSP 132 Query: 954 PP 959 PP Sbjct: 133 PP 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 3/77 (3%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP P P PPP P PP PP P Sbjct: 141 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSP---- 196 Query: 823 XPPPXXXPPXXPPPPXF 873 PPP PPP + Sbjct: 197 -PPPVYIYASPPPPTHY 212 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/119 (24%), Positives = 32/119 (26%), Gaps = 2/119 (1%) Frame = +3 Query: 609 KSQTNKYYFXKXTXXX--PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG 782 KS YY+ PP P P PP PP PP P Sbjct: 66 KSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVK-SPPPPYYYHS 124 Query: 783 XXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P P PP P + PP P +PPP Sbjct: 125 PPPPVKSPPPP-YYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPP 182 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 2/95 (2%) Frame = +3 Query: 609 KSQTNKYYFXKXTXXX--PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG 782 KS YY+ PP P P PP PP PP P Sbjct: 98 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK-SPPPPYYYHS 156 Query: 783 XXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P PP Sbjct: 157 PPPPVKSPPPP-YYYHSPPPPVKSPPPPYLYSSPP 190 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/95 (25%), Positives = 26/95 (27%), Gaps = 2/95 (2%) Frame = +3 Query: 609 KSQTNKYYFXKXTXXX--PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG 782 KS YY+ PP P P PP PP PP P Sbjct: 114 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK-SPPPPYYYHS 172 Query: 783 XXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P + P Sbjct: 173 PPPPVKSPPPP-YLYSSPPPPVKSPPPPVYIYASP 206 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 51.2 bits (117), Expect = 1e-06 Identities = 35/87 (40%), Positives = 35/87 (40%), Gaps = 1/87 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXG-GGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G GG G G GG G GG G GG G G GG GG G G Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGA--GGYGGNSGGGYG-GNAAGGYGGS 182 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG GG G GG GG G GG G Sbjct: 183 GAGGYGGDATGHGGAG-GGYGSSGGFG 208 Score = 48.8 bits (111), Expect = 5e-06 Identities = 33/89 (37%), Positives = 33/89 (37%), Gaps = 1/89 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G GGGG G GGG G G GG G G G G Sbjct: 122 GGGFGGGGYG-GGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG--YGGNAAGG 178 Query: 722 XGGGGGXGXGXGGXXXGGXGGG-GGXGXF 639 GG G G G GG GGG G G F Sbjct: 179 YGGSGAGGYGGDATGHGGAGGGYGSSGGF 207 Score = 46.0 bits (104), Expect = 4e-05 Identities = 31/107 (28%), Positives = 33/107 (30%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG + G GG G G GG G GG GG G GG Sbjct: 127 GGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG-----YGGNAAGGYGG 181 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GG G G G GG G G G G + Sbjct: 182 SGAGGYGGDATGHGGAGGGYGSSGGFGSSGNTYGEGSSASAGAVGDY 228 Score = 35.9 bits (79), Expect = 0.040 Identities = 33/107 (30%), Positives = 33/107 (30%), Gaps = 2/107 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXGGGXGPXXGXXXXGGX 786 GGG GG A G GG G G GG GG GG GG G G G Sbjct: 134 GGGYGGSGGYGGGA-GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGY---GG 189 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G G G G G G G Sbjct: 190 DATGHGGAG-GGYGSSGGFGSSGNTYGEGSSASAGAVGDYNGSSGYG 235 Score = 30.3 bits (65), Expect = 2.0 Identities = 29/113 (25%), Positives = 30/113 (26%), Gaps = 7/113 (6%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG---GXXGGXXXGGGXGPXXGXXXXGGX 786 GG G + G GG G G GG G GG GG G G GG Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGG----GGGXGXGXGGXXXGGXGGGGGXGXF 639 G G G G G G GG G F Sbjct: 201 YGSSGGFGSSGNTYGEGSSASAGAVGDYNGSSGYGSANTYGSSNGGFAGDSQF 253 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P PP P P P P PP P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPP 78 Query: 826 PPPXXXPPXXPPP 864 PPP PP P P Sbjct: 79 PPPHVLPPPPPTP 91 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/69 (34%), Positives = 25/69 (36%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXX 933 P P PP PP PPP PP PPP +P P PP P Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPH--PHQPP 78 Query: 934 PPRRXXPPP 960 PP PPP Sbjct: 79 PPPHVLPPP 87 Score = 48.4 bits (110), Expect = 7e-06 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 2/78 (2%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXP-RPXPPXXR-GXXPPXXXXPXXGPXPPPXXX 843 PP P P P PPPP P P PP PP P P PP Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Query: 844 PPXXPPPPXFPXXXPXPP 897 P PPPP P P PP Sbjct: 73 HPHQPPPP--PHVLPPPP 88 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFP 875 PP PP PP PP PP P P P P P P PP PP P Sbjct: 36 PPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPX-PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PP P PP PP P P P P P P +P PP PP P Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +1 Query: 646 PXPPPP-PXPPXXXPPXPX---PXPPPPPXP 726 P PPPP P P PP P P PPP P P Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 701 PXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXXXPXXXXPXPPXSPP 880 P PP P P P PP P P P P P P PP P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 30.3 bits (65), Expect = 2.0 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 1/84 (1%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXP-PFPXXPP 887 P P PP PPP PP P P P P P PP P P P PP Sbjct: 19 PLPSPVPPPPSHISPPP-PPFSPPHHP----PPPH------FSPPHQPPPSPYPHPHPPP 67 Query: 888 XXXXPXXXXGXGXXXXXPAXAPPP 959 P P P P Sbjct: 68 PSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG 782 PP P P P PP PP PPPP P PG Sbjct: 56 PPSPYPHPHPPPPSPYPHPHQPP--PPPHVLPPPP-PTPAPG 94 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 50.8 bits (116), Expect = 1e-06 Identities = 38/117 (32%), Positives = 40/117 (34%) Frame = +1 Query: 610 NLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX 789 N K + T P PPP PP P PPPPP P P PP Sbjct: 26 NRKLLQTTTNYQPIYSPPP-PPYRSP---VTIPPPPPV---YSRPVAFP-PPPPIYSPPP 77 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P PPP PP PPP P P A R+ PPP Sbjct: 78 PPIYPPPIYSPPPPPIYPPPIYSPPP--TPISPPPKVHHPAPQAQKAFYYRQSPPPP 132 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PP PPPP P P PP P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHPAPQAQKAFYYRQ 127 Query: 823 XPPPXXXPP 849 PPP P Sbjct: 128 SPPPPSGQP 136 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 50.8 bits (116), Expect = 1e-06 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 9/83 (10%) Frame = +1 Query: 652 PPPPPXPPXXXPP--XPXPXPP---PPPXP----XXXXXXXXXPRPXPPXXRGXXPPXXX 804 PPPPP P PP P P PP PPP P P PP PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPS 470 Query: 805 XPXXGPXPPPXXXPPXXPPPPXF 873 GP PP PPPP F Sbjct: 471 PEFEGPLPPVIGVSYASPPPPPF 493 Score = 48.0 bits (109), Expect = 9e-06 Identities = 33/102 (32%), Positives = 33/102 (32%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 P PP PP P P PPP P P PP PP P PPP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVY--SPPPPPSIHYSSPPPPP 460 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P F P PP G PP PPP Sbjct: 461 VHHSSPPPPSPEF--EGPLPP----VIGVSYASPP----PPP 492 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/68 (32%), Positives = 24/68 (35%) Frame = +1 Query: 757 RPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP 936 +P PP PP P P P PP PPP P P PP P + P Sbjct: 402 KPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSP-PPPPSIHYSSPPPPP 460 Query: 937 PRRXXPPP 960 PPP Sbjct: 461 VHHSSPPP 468 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 +F P PP PP P PPPPP P P P G PP Sbjct: 433 VFSPPPSPPVYSPPP--PPSIHYSSPPPPP------VHHSSPPPPSPEFEGPLPPVIGVS 484 Query: 811 XXGPXPPP 834 P PPP Sbjct: 485 YASPPPPP 492 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 50.8 bits (116), Expect = 1e-06 Identities = 34/112 (30%), Positives = 35/112 (31%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP P P PPP P PP PP P P Sbjct: 39 PSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDL-TPPPSSPPPPDAPP 97 Query: 826 PPPXXXPP--XXPPP-----PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P PP P + PP PPP Sbjct: 98 PIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 49.2 bits (112), Expect = 4e-06 Identities = 33/96 (34%), Positives = 33/96 (34%), Gaps = 12/96 (12%) Frame = +1 Query: 646 PXPPP----PPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXP------RPXPPXXRGXX 789 P PPP PP PP PP P PP PPP P P P PP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPP 127 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 PP P PPP PPP P P P Sbjct: 128 PPPADEDESPPAPPPP---EQLPPPASSPQGGPKKP 160 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/103 (29%), Positives = 30/103 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP P P PPP P P PP P P PP Sbjct: 18 PPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPS-LPPAVFSPPPTVS-----SPPPP 71 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPPP PP P PP PPP Sbjct: 72 PLDSSP--PPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPP 112 Score = 41.9 bits (94), Expect = 6e-04 Identities = 35/116 (30%), Positives = 37/116 (31%), Gaps = 17/116 (14%) Frame = +1 Query: 646 PXPPPPPX--PP---XXXPPXPXPXP-----PPP-----PXPXXXXXXXXXPRPXPPXXR 780 P PPPP PP PP P P PPP P P P P PP Sbjct: 87 PSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPE-- 144 Query: 781 GXXPPXXXXPXXGPXPPP--XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR 942 PP P GP P P PP P P P P + PP+ Sbjct: 145 -QLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAPPRNSSHALPPK 199 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/101 (26%), Positives = 29/101 (28%), Gaps = 5/101 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG--XXPPXXXXPXXGPX 825 PPPPP PP P PPP P P+ G PP P P Sbjct: 126 PPPPPADEDESPPAP---PPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPP 182 Query: 826 PPPXXXPPXXP---PPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP P PP P +G PP Sbjct: 183 APPNAPPRNSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPP 223 Score = 36.3 bits (80), Expect = 0.030 Identities = 28/101 (27%), Positives = 29/101 (28%), Gaps = 5/101 (4%) Frame = +1 Query: 673 PXXXPPXPXPXPPPPPXPXXXXXXXXXPR-----PXPPXXRGXXPPXXXXPXXGPXPPPX 837 P PP P PPP P P PP P P PPP Sbjct: 5 PTSSPPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPT 64 Query: 838 XXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PP + PP PPP Sbjct: 65 VSSP---PPPPLDSSPPPPPDLTPPPSS----PPPPDAPPP 98 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXX 824 T PP P PP P PP PPP PP P P P Sbjct: 64 TVSSPPPPPL--------DSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPEST 115 Query: 825 XXXXPXPXXXPPXPP 869 P PP PP Sbjct: 116 NSPPPPEVFEPPPPP 130 Score = 33.1 bits (72), Expect = 0.28 Identities = 28/107 (26%), Positives = 28/107 (26%), Gaps = 7/107 (6%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPP----XPPXXPGXXPXXXXPXP---X 815 PP P P PP PP PPPP PP P P P P Sbjct: 38 PPSPPADSSPPPALPSLPPAVFSP-PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Query: 816 RXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP PP PA PP Sbjct: 97 PPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/103 (24%), Positives = 26/103 (25%), Gaps = 3/103 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXP---PXXXXPPPPXPPXXPGXXPXXXXPXPXRXXX 827 PP P P PP PP P P PPP P P P Sbjct: 77 PPPPPDLTPPPSSPP--PPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADED 134 Query: 828 XXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P G PA + P Sbjct: 135 ESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAP 177 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPP 869 PP PP PPP P P P P P PP PP Sbjct: 137 PPAPPPPEQLPPPASSPQGGPKKPKKHHPGP-ATSPPAPSAPATSPPAPP 185 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 701 PXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXXXPXXXXPXPPXSPP 880 P P PP A PP A P P P P P S P Sbjct: 9 PPAPSADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSP 68 Query: 881 PXP 889 P P Sbjct: 69 PPP 71 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 50.8 bits (116), Expect = 1e-06 Identities = 36/99 (36%), Positives = 38/99 (38%), Gaps = 1/99 (1%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGXGXXXGKXGG-GGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGX 762 GG + G GG G G GG GG GG GGG G G GG GG Sbjct: 57 GGGGGISGGGGFGAGG-GWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGA 115 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G+G G G GG G G G G GG G G Sbjct: 116 GKG----VDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKG 150 Score = 44.8 bits (101), Expect = 9e-05 Identities = 34/108 (31%), Positives = 35/108 (32%), Gaps = 6/108 (5%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG--GGXGPXX----GXXX 798 GGG G GG G G G GG G GG G G Sbjct: 92 GGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKGF 151 Query: 797 XGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG GG G+G G GG G G G GG GGGG Sbjct: 152 EGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGGGG 199 Score = 44.4 bits (100), Expect = 1e-04 Identities = 38/114 (33%), Positives = 39/114 (34%), Gaps = 9/114 (7%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKX-GGGGXXGGXXXG--GGXGPXX----GXX 801 GGG GG GG G G GGGG GG G GG G G Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKG 118 Query: 800 XXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG--GGXG 645 GG GG G+G G G G G G GG G G GG G Sbjct: 119 VDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAG 172 Score = 41.5 bits (93), Expect = 8e-04 Identities = 33/93 (35%), Positives = 33/93 (35%) Frame = -1 Query: 923 PAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXX 744 P P G G GGGG G GGG G G GG GG G G Sbjct: 38 PHPHPLLHKKGFKKEFGDLGGGGGISG---GGGFG--AGGGWIGGSVGGFGGGIGGG--- 89 Query: 743 XXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G G G GG G G Sbjct: 90 ----FGGGGFGGGAGKGVDGGFGKGVDGGAGKG 118 Score = 39.1 bits (87), Expect = 0.004 Identities = 35/106 (33%), Positives = 36/106 (33%), Gaps = 4/106 (3%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG--GGXXGGXXXGGGXGPXXGXXXX--GG 789 GG GG A G G G G G GG G G G G G GG Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGG 146 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G+G G GG G G G GG GGG G Sbjct: 147 VGKGFEGGIGKGIEGGVGK--GFDGGAGKGVDGGA--IGGIGGGAG 188 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 G G GGG G G GG GGG G G F Sbjct: 67 GFGAGGGWIGGSVGGFGGGIGGGFGGGGF 95 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 G GGGG G GG GG GG G F Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGF 82 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 50.4 bits (115), Expect = 2e-06 Identities = 34/110 (30%), Positives = 34/110 (30%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGX-----GPXXGXXXX 795 G G GG G GG G GGG G G Sbjct: 45 GIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAG 104 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G R G GRG G GGGGG G G G G G GGG G Sbjct: 105 SGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 45.2 bits (102), Expect = 7e-05 Identities = 29/93 (31%), Positives = 30/93 (32%), Gaps = 1/93 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGX-GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG + G GG G G G G G G G GG Sbjct: 67 GGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHG 126 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 GG GRG G G GGG G G GG Sbjct: 127 GGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 45.2 bits (102), Expect = 7e-05 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 3/77 (3%) Frame = -1 Query: 866 GGGGXXG---GXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 GGGG G G G G G G GG G G G GGG G G Sbjct: 86 GGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGE 145 Query: 695 GXGGXXXGGXGGGGGXG 645 G G GG GGG G G Sbjct: 146 GYG--EGGGYGGGYGGG 160 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GGGG G G G G G G G G G G GGG G G G Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Query: 686 GXXXGGXGGGGGXG 645 G G GGG G Sbjct: 145 EGYGEGGGYGGGYG 158 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGG 765 G G G GGGG GG GGG G G GG GG Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 887 GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGG 708 G G GG G G G G G GG GG G G G G GG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Query: 707 G 705 G Sbjct: 160 G 160 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -1 Query: 887 GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGG 708 G G G G G GGG G G G GG GGGG Sbjct: 34 GLDLGGIGAGIGIGIGIGGGGSGSGAGAGSGSGG-----GGSSSSSSSSSSSSSSSGGGG 88 Query: 707 GXGXGXGGXXXGGXGGGGGXG 645 G G G G G G Sbjct: 89 GDAGSEAGSYAGSHAGSGSGG 109 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 G R G G GG G G GGGG G G G G G GG Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGG-SGNGEGYGEGGGYGGGYGGG 160 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P PP PP P PPP P P P P PP P Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQL 69 Query: 826 PPPXXXPPXXPPPPXFP 876 P PP PPP P Sbjct: 70 QAPPPPPPPSAPPPLVP 86 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/89 (34%), Positives = 31/89 (34%), Gaps = 5/89 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP P PP P P PP PPP P P PP PP G Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP-----PPPPHAYYQQG 60 Query: 820 PXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P P PP PPP P P PP Sbjct: 61 PHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 Score = 46.4 bits (105), Expect = 3e-05 Identities = 32/99 (32%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP PP PP PPPP P P P PP P P P PPP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPP-------SLPPPVPPPPPSHQPYSYPPP---PPPPPHA 55 Query: 841 XPPXXPPPPXF-PXXXPXPPXPXXXXGAGXXXPPRRXXP 954 P P F P PP P PPR P Sbjct: 56 YYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 3/88 (3%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXP---PXXPPPPXFP 876 PP PP P P P PP PP P PPP P P PPPP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPP---SLPPPV-------PPPPPSHQPYSYPPPPPPPPHA 55 Query: 877 XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP Sbjct: 56 YYQQGPHYPQFNQLQAPPPPPPPSAPPP 83 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +1 Query: 778 RGXXPPXXXXPXXG---PXPPPXXXPPXXPPPPXF--PXXXPXPPXP 903 R PP P P PPP PP PPPP P P PP P Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXP 726 PPP PP PP P PP P Sbjct: 72 PPPPPPPSAPPPLVPDPPRHQGP 94 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 50.0 bits (114), Expect = 2e-06 Identities = 34/101 (33%), Positives = 34/101 (33%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPR 777 GG G P G G G G GGGG G GGG G G G Sbjct: 298 GGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGG-GKNGGKGGGGHPLDG 356 Query: 776 XXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG G G G GG G G GG GGGG Sbjct: 357 KMGGGG-GGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 46.0 bits (104), Expect = 4e-05 Identities = 37/112 (33%), Positives = 37/112 (33%), Gaps = 7/112 (6%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G GG GGG P G GG P Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGG-------KGGGGHPLDGKMGGGGGGP 365 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGG-------XGGGGGXG 645 G G G G GGGG G G GG GG GGGGG G Sbjct: 366 NGNKGGG-GVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 Score = 46.0 bits (104), Expect = 4e-05 Identities = 36/106 (33%), Positives = 37/106 (34%), Gaps = 7/106 (6%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG-----GXXGGXXXGGGXGPXXGXXXX 795 GG +GG P G GG G K GGG G GG GGG G G Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGG-GPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMS 399 Query: 794 GGXXP--RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXG 663 GG P R GG G G GG G G GG G Sbjct: 400 GGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQMGGGPG 445 Score = 45.2 bits (102), Expect = 7e-05 Identities = 34/106 (32%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXX-GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG G G GG G GK GGGG GGG G GG Sbjct: 327 GGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG-GVQMNGGPNGGKK 385 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG G G GG GG G Sbjct: 386 GGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMG 431 Score = 41.9 bits (94), Expect = 6e-04 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = -1 Query: 872 KXGGG-GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 K GGG G GG G G GG GG G G G GG G G Sbjct: 289 KNGGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNG-GK 347 Query: 695 GXGGXXXGGXGGGGGXG 645 G GG G GGGG G Sbjct: 348 GGGGHPLDGKMGGGGGG 364 Score = 41.5 bits (93), Expect = 8e-04 Identities = 36/113 (31%), Positives = 37/113 (32%), Gaps = 13/113 (11%) Frame = -1 Query: 944 RRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGG 765 + GG PA G G GGGG G GG G G GG GG Sbjct: 289 KNGGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGG------GG 342 Query: 764 XGRGXXXXXXXXXGXGGGGGXG-------------XGXGGXXXGGXGGGGGXG 645 G G GGGG G G G GG GGGGG G Sbjct: 343 KNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGG 395 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G GG GGGGG G Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGG 132 Score = 35.5 bits (78), Expect = 0.053 Identities = 37/123 (30%), Positives = 38/123 (30%), Gaps = 18/123 (14%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXG----GXXXGGGXGPXXGXXXXG 792 GGG GG P G GG G G GG G G GGG GP G Sbjct: 371 GGGVQMNGG---PNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMG 427 Query: 791 GXX-------PRXXGGXG-------RGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 G P+ GG G G GGGG G G G G Sbjct: 428 GAMGGPMGSLPQMGGGPGPMSNNMQAVQGLPAMGPGGGGGGGPSAEAPPGYFQGQVSGNG 487 Query: 653 GXG 645 G G Sbjct: 488 GGG 490 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G GG GGGGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGG 133 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G GGGGG G G GG GGGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGG------GGGGGGGG 139 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/106 (26%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = -3 Query: 960 GGGXXXPGXXXXPRXXXXXXXXXXGXGGGEXGGXGXXXXGXXXXXXGXGXG-XXXXGXXX 784 GGG G P GGG+ GG G G G G G Sbjct: 314 GGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 Query: 783 APXXGGXXAGXXXXXXXGGXXGXXGGXGXGXXGXXXXXXGXGGXXG 646 GG G GG G GG G G GG G Sbjct: 374 VQMNGGPNGG---KKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGP 816 GGGG GG GGG GP Sbjct: 124 GGGGGGGGGGGGGGGGP 140 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = -1 Query: 902 GXGGXGXXXG----KXGGGGXXGGXXXGGGXG 819 G GG G K GGGG GG GGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/95 (34%), Positives = 33/95 (34%), Gaps = 3/95 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP PP PP P PPP P P P PP R P P P Sbjct: 22 PLPPPPPPPP---PPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP---PP 75 Query: 826 PPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGA 921 P P PP P PP P GA Sbjct: 76 PLPMFDAEVLCCCYPPTRVRREAPLPPPPLIFVGA 110 Score = 44.8 bits (101), Expect = 9e-05 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 8/91 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP-------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPPP P P P P PPP PP P PRP PP P Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP--PLPMFDA 82 Query: 805 XPXXGPXPPP-XXXPPXXPPPPXFPXXXPXP 894 PP PPPP P P Sbjct: 83 EVLCCCYPPTRVRREAPLPPPPLIFVGAPPP 113 Score = 34.7 bits (76), Expect = 0.093 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +1 Query: 769 PXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRX 948 P RG P P P PPP PPPP P P P PR Sbjct: 15 PPMRGRVP---LPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPP 71 Query: 949 XPPP 960 PPP Sbjct: 72 PPPP 75 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPP-XXRGXXPPXXXXPXXGPXPPPXXXPPXXPP 861 PP P PPP P P PP R PP P P P PP PP Sbjct: 15 PPMRGRVPLPPPPPP----------PPPPMRRRAPLPPPPPPPMRRRAPLP---PP--PP 59 Query: 862 PPXFPXXXPXPPXP 903 P P PP P Sbjct: 60 PAMRRRVLPRPPPP 73 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 4/106 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PP PP PP PPP P RP P G PP Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQR--- 206 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PPPP P PP P G PPR PP Sbjct: 207 PMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 50.0 bits (114), Expect = 2e-06 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 4/106 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PP PP PP PPP P RP P G PP Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQR--- 206 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PPPP P PP P G PPR PP Sbjct: 207 PMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/100 (30%), Positives = 30/100 (30%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P P PPPPP P P R PP P PPP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSP-----PPPSP 540 Query: 841 XPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P P PP PP PPP Sbjct: 541 PPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPP 580 Score = 49.2 bits (112), Expect = 4e-06 Identities = 39/113 (34%), Positives = 39/113 (34%), Gaps = 10/113 (8%) Frame = +1 Query: 652 PPPPPX--PPXXXPPXPXPX--PP----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 PPPPP PP P P P PP PPP P P P P PP Sbjct: 676 PPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVY---YPPVAKS 732 Query: 808 PXXGPXPPPXXXPPXX--PPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PP PPPP P P P PP PPP Sbjct: 733 P---PPPSPVYYPPVTQSPPPPSTPVEYHPPASP------NQSPPPEYQSPPP 776 Score = 48.4 bits (110), Expect = 7e-06 Identities = 38/121 (31%), Positives = 41/121 (33%), Gaps = 10/121 (8%) Frame = +1 Query: 628 TIFXXXPXPPPPPX--PPXXXPPXPXPX------PPPPPXPXXXXXXXXXPRPXPPXXRG 783 T + PPPPP PP P P P PPP P P P PP Sbjct: 625 TYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVY-- 682 Query: 784 XXPPXXXXPXXGP--XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P P PP PP PPP + PP P + PP PP Sbjct: 683 -YPPVTQSPPPSPVYYPPVTQSPP--PPPVYYLPVTQSPPPP-----SPVYYPPVAKSPP 734 Query: 958 P 960 P Sbjct: 735 P 735 Score = 46.4 bits (105), Expect = 3e-05 Identities = 35/125 (28%), Positives = 38/125 (30%), Gaps = 15/125 (12%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXP--------PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR-- 780 I+ P P P P PP P PPPP P P PP + Sbjct: 545 IYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYT 604 Query: 781 GXXPPXXXXPXXGPXPPP-----XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PP P PPP P PPP +P PP P PP Sbjct: 605 SSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPP-- 662 Query: 946 XXPPP 960 PPP Sbjct: 663 --PPP 665 Score = 45.6 bits (103), Expect = 5e-05 Identities = 29/91 (31%), Positives = 30/91 (32%), Gaps = 7/91 (7%) Frame = +1 Query: 646 PXPPPP-----PXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 P PPPP P PP P P P PPP P P PP PP Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVN 570 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP P +P P PP Sbjct: 571 CPPTTQSPPPPKYEQTPSPREYYP--SPSPP 599 Score = 45.6 bits (103), Expect = 5e-05 Identities = 30/103 (29%), Positives = 31/103 (30%), Gaps = 8/103 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP---XXXXPXXGPX 825 PPPP PP P PPP P P P + PP P Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPP 677 Query: 826 PPPXXXPPXXPPPPXFPXXXP-----XPPXPXXXXGAGXXXPP 939 PPP PP PP P P PP P PP Sbjct: 678 PPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPP 720 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/86 (30%), Positives = 26/86 (30%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPP P PP P P P P PP PP P Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPP------PSPS 555 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP PP P PP P Sbjct: 556 PPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 42.3 bits (95), Expect = 5e-04 Identities = 33/113 (29%), Positives = 33/113 (29%), Gaps = 13/113 (11%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP----XPPXXRGXXPPXXXXPXXG--- 819 PP P P PPPPP P P P R PP Sbjct: 425 PPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRA 484 Query: 820 -PXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAG--XXXPPRRXXPPP 960 P PP P PPPP P P PP P PP PPP Sbjct: 485 TPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPP 537 Score = 40.3 bits (90), Expect = 0.002 Identities = 37/116 (31%), Positives = 38/116 (32%), Gaps = 11/116 (9%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPX----PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P P PP PP P PPPPP P P P PP PP P Sbjct: 594 PSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQS--PPPPPPVY---YPPVTASP- 647 Query: 814 XGPXPP----PXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P PPPP + P PP P PP PP Sbjct: 648 --PPPPVYYTPVIQSP--PPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPP 699 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/100 (26%), Positives = 28/100 (28%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP 839 P P P PP P PPPP PP P P P Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPP--------EYEPSPPPPSSEMSP 522 Query: 840 XPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 PP PP PP P P+ +PPP Sbjct: 523 SVRAYPPPPPLSPPPPSPPPPYIYSS----PPPPSPSPPP 558 Score = 35.9 bits (79), Expect = 0.040 Identities = 22/80 (27%), Positives = 25/80 (31%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP P PP PPPP P + PP + P Sbjct: 733 PPPPSPVYYPPVTQS-PPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQT 791 Query: 838 XXPPXXPPPPXFPXXXPXPP 897 PP PPP + P PP Sbjct: 792 PTPPSLPPP--YYEDTPLPP 809 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/101 (22%), Positives = 24/101 (23%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP P PPPP P P P Sbjct: 440 PPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSF--RATPPPPSSKMSPSV 497 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 PP P + PP P PPP Sbjct: 498 KAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/77 (27%), Positives = 22/77 (28%), Gaps = 2/77 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG--PX 825 PPPP P PP PPP + PP P P Sbjct: 748 PPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYEDTPL 807 Query: 826 PPPXXXPPXXPPPPXFP 876 PP PPPP P Sbjct: 808 PPIRGVSYASPPPPSIP 824 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 2/81 (2%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPX 826 P PP P P P PP P PP P P P P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPY-IYSSPPPPSPSPPPP 559 Query: 827 XXXXXPXXXXPXPP--XSPPP 883 P PP SPPP Sbjct: 560 YIYSSPPPVVNCPPTTQSPPP 580 Score = 31.5 bits (68), Expect = 0.86 Identities = 21/84 (25%), Positives = 21/84 (25%), Gaps = 2/84 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXP--PXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXX 830 PP P P P P PP PP P PP P P Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYS 563 Query: 831 XXPXPXXXPPXPPFPXXPPXXXXP 902 P PP P P P Sbjct: 564 SPPPVVNCPPTTQSPPPPKYEQTP 587 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/88 (26%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +3 Query: 630 YFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXP---PXXPGXXPXXX 800 Y+ T PP P PP P PP PPPP P P Sbjct: 667 YYSPVTQSPPPPPPVYY---PPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 723 Query: 801 XPXPXRXXXXXXPXPXXXPPXPPFPXXP 884 P P P PP P P Sbjct: 724 VYYPPVAKSPPPPSPVYYPPVTQSPPPP 751 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/89 (24%), Positives = 23/89 (25%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P P P P P P P P +G Sbjct: 733 PPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCNDSPSNDHHYQTP 792 Query: 826 PPPXXXPP---XXPPPPXFPXXXPXPPXP 903 PP PP P PP PP P Sbjct: 793 TPPSLPPPYYEDTPLPPIRGVSYASPPPP 821 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 49.6 bits (113), Expect = 3e-06 Identities = 34/112 (30%), Positives = 36/112 (32%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPX--PXPXPP---PPPXPXXXXXXXXXP-RPXPPXXRGXXPPXXXXPX 813 PPP PP PP P PP PPP P PP + PP P Sbjct: 77 PPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPP 136 Query: 814 XGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP +P P PP PPP Sbjct: 137 FKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPP 188 Score = 49.6 bits (113), Expect = 3e-06 Identities = 31/108 (28%), Positives = 33/108 (30%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP PP PPP P P P + PP P Sbjct: 95 PHPPVKYPPPEQYPPPIKKYPPPEQYP-PPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKY 153 Query: 826 PPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PP +P P P PP PPP Sbjct: 154 PPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPP 201 Score = 47.2 bits (107), Expect = 2e-05 Identities = 36/116 (31%), Positives = 37/116 (31%), Gaps = 11/116 (9%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXP----RPXPPXXRGXXPPXX 801 P PP P PP P P PPP PP P P P PP PP Sbjct: 50 PYSPPKP-PPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVK--YPPPEQ 106 Query: 802 XXPXXGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPP + P P PP PPP Sbjct: 107 YPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPP 162 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/112 (27%), Positives = 35/112 (31%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP PP P P PPP P PP + PP P PP Sbjct: 161 PPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPP 220 Query: 832 P---XXXPPXXPPPPXF------PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPP + P PP PP++ PPP Sbjct: 221 PIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPP 272 Score = 46.8 bits (106), Expect = 2e-05 Identities = 36/117 (30%), Positives = 38/117 (32%), Gaps = 14/117 (11%) Frame = +1 Query: 652 PPPPPXPPXXXP-PXPXPXPPP----PPXPXXXXXXXXXPRPX--PPXXRGXXPPXXXXP 810 PPP PP P P PPP PP P P PP + PP P Sbjct: 141 PPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPP 200 Query: 811 XXGPXPPP---XXXPPXXPPP----PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P PPP P P P PP PP + PPP Sbjct: 201 PIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP 257 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/112 (28%), Positives = 34/112 (30%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPPPPPX----PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PPP PP P PPP P P PP + P P Sbjct: 117 PEQYPPPIKKYPPPEQYSPPFKKYPPPEQYP-PPIKKYPPPEHYPPPIKKYPPQEQYPPP 175 Query: 814 XGPXPPPXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP +P P P PP PPP Sbjct: 176 IKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPI------KKYPPPEEYPPP 221 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/88 (30%), Positives = 28/88 (31%), Gaps = 4/88 (4%) Frame = +1 Query: 652 PPPPPXPPXXXP-PXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P PPP P P P PP PP P Sbjct: 193 PPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPK 252 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP P PP +P P P Sbjct: 253 ECPPPPEHYP-WPPKKKYPPPVEYPSPP 279 Score = 40.3 bits (90), Expect = 0.002 Identities = 31/108 (28%), Positives = 33/108 (30%), Gaps = 6/108 (5%) Frame = +1 Query: 652 PPPPPXPPXX--XPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-- 819 PPP PP PP P PPP P PP + P P Sbjct: 180 PPPEKYPPPIKKYPP-PEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYK 238 Query: 820 --PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PP PP P P PP PP + PP Sbjct: 239 TYPHPPIKTYPPPKECPPP-PEHYPWPPKKKYPPPVEYPSPPYKKYPP 285 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/106 (30%), Positives = 33/106 (31%), Gaps = 7/106 (6%) Frame = +1 Query: 664 PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-PXPP 831 P P PP P P PPP P P PP PP P PP Sbjct: 47 PKFPYS-PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVK--YPPPIKTYPHPPVKYPP 103 Query: 832 PXXXPP---XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPP +P P P PP PPP Sbjct: 104 PEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPP 149 Score = 35.5 bits (78), Expect = 0.053 Identities = 23/81 (28%), Positives = 25/81 (30%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP PP P PP P P+ PP P P Sbjct: 215 PEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP-----PEHYPWPPKKKY 269 Query: 826 PPPXXXPPXXPPPPXFPXXXP 888 PPP P PP +P P Sbjct: 270 PPPVEYPS--PPYKKYPPADP 288 Score = 32.7 bits (71), Expect = 0.37 Identities = 29/92 (31%), Positives = 29/92 (31%), Gaps = 8/92 (8%) Frame = +1 Query: 646 PXPPPPPX----PPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 P PPP PP P P PPP P P P PP PP Sbjct: 195 PEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIK--TYPPPK 252 Query: 802 XXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P P PP PP P P PP Sbjct: 253 ECP---PPPEHYPWPPKKKYPP--PVEYPSPP 279 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 49.6 bits (113), Expect = 3e-06 Identities = 32/112 (28%), Positives = 33/112 (29%), Gaps = 3/112 (2%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPP---PXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 F P PP P PP P PPP P P PP PP Sbjct: 177 FLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVE 236 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PP P P P PP+ PPP Sbjct: 237 LPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPP 288 Score = 49.2 bits (112), Expect = 4e-06 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 7/110 (6%) Frame = +1 Query: 652 PPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPP P PP P P P P PP P P PP PP P P Sbjct: 223 PPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPV---PVYKP 279 Query: 823 XPPPXXXPPXX----PPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P P PP P PP++ PPP Sbjct: 280 PPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPP 329 Score = 44.8 bits (101), Expect = 9e-05 Identities = 33/106 (31%), Positives = 35/106 (33%), Gaps = 3/106 (2%) Frame = +1 Query: 652 PPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPP P PP P P P PPP P P P PP P P Sbjct: 208 PPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPP---VPVYKP 264 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P P PP P PP++ PPP Sbjct: 265 -PPKIEKPPPVPVYKPPPKIEHPPPVPVHKL-PKKPCPPKKVDPPP 308 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/113 (30%), Positives = 36/113 (31%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP--XPPXXRGXXPPXXXXPXXG 819 P PPP PP P P PP P P+ PP PP P Sbjct: 167 PLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPV 226 Query: 820 P---XPPPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P PP P PP P PP+ PPP Sbjct: 227 PVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPV------YKPPPKIEKPPP 273 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/82 (35%), Positives = 30/82 (36%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP PP PP P PPP P +P PP PP P P PP Sbjct: 358 PPKIEHPPIYIPPI-VKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKK-PCPP 415 Query: 832 PXXXPPXXPPPPXFPXXXPXPP 897 P PP P FP P PP Sbjct: 416 ----LPQLPPLPKFP---PLPP 430 Score = 41.9 bits (94), Expect = 6e-04 Identities = 35/118 (29%), Positives = 37/118 (31%), Gaps = 13/118 (11%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPP---XPXPXP---PPP--PXPXXXXXXXXXPRPXPPXXRGXX 789 P PP PPP P PP P P P PPP P +P PP Sbjct: 248 PKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPP 307 Query: 790 P-PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PP PP P P PP PP + PP Sbjct: 308 PVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPP 365 Score = 41.5 bits (93), Expect = 8e-04 Identities = 31/108 (28%), Positives = 33/108 (30%), Gaps = 6/108 (5%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 P P PP P P PPP P P+ PP P P PPP Sbjct: 152 PMPKLPPFKGFDHPFPLPPPLELP-PFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPP 210 Query: 835 ---XXXPPXXPPPPXFPXXXPXPP---XPXXXXGAGXXXPPRRXXPPP 960 PP PP P P P P PP+ PPP Sbjct: 211 VPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPP 258 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/92 (29%), Positives = 28/92 (30%), Gaps = 8/92 (8%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP PP P PPP +P PP PP Sbjct: 335 PPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPC 394 Query: 820 PXPPPXXXPPXX----PPPPXFPXXXPXPPXP 903 P P P PP P P P P P P Sbjct: 395 PPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFP 426 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXX 816 P P P P PP PPP P P PP + P P P Sbjct: 329 PVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVV 388 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P PP P PP P Sbjct: 389 IPKKPCPPPVPVYKPPVVVIPKKPCPPLP 417 Score = 37.1 bits (82), Expect = 0.017 Identities = 32/114 (28%), Positives = 33/114 (28%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPP-----XXXPPXPXPXPPP---PPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 P P P PP PP P PPP P P PP P Sbjct: 239 PPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKP 298 Query: 802 XXP-XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PP P P P PP P PP + PP Sbjct: 299 CPPKKVDPPPVPVHKPPTKKPCP--PKKVDPPPVPVHKPPPKIVIPPPKIEHPP 350 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/82 (26%), Positives = 24/82 (29%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP P PP PPP P P P P + Sbjct: 194 PPVPVYE---PPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKP 250 Query: 837 PXPXXXPPXPPFPXXPPXXXXP 902 P PP P + P P Sbjct: 251 PKIEHPPPVPVYKPPPKIEKPP 272 Score = 33.5 bits (73), Expect = 0.21 Identities = 30/97 (30%), Positives = 31/97 (31%), Gaps = 11/97 (11%) Frame = +1 Query: 646 PXPPPPPXPPXXXP-----PXPXPXPP--PPPXPXXXXXXXXXPRPXP---PXXRGXXPP 795 P P P PP P P P P PPP P P P P + PP Sbjct: 306 PPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPP 365 Query: 796 XXXXP-XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PPP P PP P PP P Sbjct: 366 IYIPPIVKKPCPPPV---PIYKPPVVIPKKPCPPPVP 399 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 49.2 bits (112), Expect = 4e-06 Identities = 31/75 (41%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = -1 Query: 863 GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGG--GGXGXGX 690 GGG G GGG G G GG G G G G GGG GG G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGY 103 Query: 689 GGXXXGGXGGGGGXG 645 GG GG GGGG G Sbjct: 104 GGG--GGHHGGGGHG 116 Score = 46.0 bits (104), Expect = 4e-05 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G GGGG G GGG G GG G G G G G Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYG 104 Query: 716 GGGGXGXGXG 687 GGGG G G Sbjct: 105 GGGGHHGGGG 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/77 (41%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG--GGGX 702 G GG G GG GGG G G GG GG G G GG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHG-HGGHNGGGGHGLDGYGGGG-------GHYGGGGGHYGGGG 93 Query: 701 GXGXGGXXXGGXGGGGG 651 G GG GG GGGGG Sbjct: 94 GHYGGG--GGGYGGGGG 108 Score = 38.3 bits (85), Expect = 0.008 Identities = 31/80 (38%), Positives = 31/80 (38%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G GGG G GGG G G GG GG G G Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGG---GGG----HYGGGG-----------GHY 96 Query: 716 GGGGXGXGXGGXXXGGXGGG 657 GGGG G G GG GG G G Sbjct: 97 GGGGGGYGGGGGHHGGGGHG 116 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXX--GGGXGPXXGXXXXGGXX 783 GG GG G GG G G GGGG GG GGG G G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLD-GYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 Query: 782 PRXXGGXGRG 753 GG G G Sbjct: 107 GGHHGGGGHG 116 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGG-GGGXGXGXGGXXXGGXGGGGGXGXF 639 GG G G GG GG G G G GG GGG G + Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHY 89 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 49.2 bits (112), Expect = 4e-06 Identities = 30/99 (30%), Positives = 31/99 (31%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 PP P PP P PP P P P PP P P P P P Sbjct: 66 PPASPVTPPPAVTPTSPPAPKVAPVISPATPP-PQPPQSPPASAPTVSPPPVSPPPAPTS 124 Query: 841 XPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP PP P PP P A PP + P Sbjct: 125 PPPTPASPP--PAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/89 (32%), Positives = 29/89 (32%), Gaps = 5/89 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXP---PXXRGXXPPXXXXPXX 816 PP P P P P P PP PP P P P P PP P Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P PPP P PP P Sbjct: 142 APASPP--PAPVSPPPVQAPSPISLPPAP 168 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXP---PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P P PP PP P P P PP P P PP PP P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Query: 817 GPXPPPXXXPPXXPPPP 867 P P PP P P Sbjct: 156 VQAPSPISLPPAPAPAP 172 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/89 (28%), Positives = 26/89 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP P P P P P P PP P P P + P P Sbjct: 132 PPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPA 191 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXG 918 P PP P PP P P G Sbjct: 192 PI--PPSPPSPPVLTDPQDTAPAPSPNTG 218 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/104 (27%), Positives = 29/104 (27%), Gaps = 1/104 (0%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP PP P PP P P P P P P P Sbjct: 46 PPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQP-PQSP 104 Query: 832 PXXXPPXXPPP-PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP P PP P A PP PPP Sbjct: 105 PASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP P P P PP P P+ P PP P P Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPP-PAVTPTSPPAPKVAPVISPATPPPQP--PQSPPASA 108 Query: 832 PXXXPP--XXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P P P PP P A PP PPP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/101 (29%), Positives = 30/101 (29%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 P P P PP PP PP P PP P P P P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSP-PPVSPPPAPTSPPPTPASPP---- 133 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P P PP P P PP P PA AP P Sbjct: 134 PAPASPPPAPASP--PPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX-PXXGPXP 828 PPP P P P P P P PP PP P P Sbjct: 39 PPPTTAAP---PTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPAT 95 Query: 829 PPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP PP P P PP P PP PPP Sbjct: 96 PPPQ-PPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 5/91 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXP-----PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPP P P P P PPP P P P PP P Sbjct: 70 PVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPV----SPPPAPTSP 125 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P PP P P P P P Sbjct: 126 PPTPASPP-PAPASPPPAPASPPPAPVSPPP 155 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/102 (26%), Positives = 28/102 (27%), Gaps = 4/102 (3%) Frame = +3 Query: 666 PXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPX- 842 P P PP P PP PP P P P P P + P Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTV 111 Query: 843 ---PXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P PP P P P P PA A PP Sbjct: 112 SPPPVSPPPAPTSPPPTPASPPP------APASPPPAPASPP 147 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 9/82 (10%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXX--PPXXXXPPPPXPPXXPGXXPXXXXPXPXR---- 818 PP P P P PP PP PPP P P P P + Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAPTKHKRK 178 Query: 819 ---XXXXXXPXPXXXPPXPPFP 875 P P PP PP P Sbjct: 179 HKHKRHHHAPAPAPIPPSPPSP 200 Score = 33.5 bits (73), Expect = 0.21 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 10/91 (10%) Frame = +2 Query: 647 PXXPPXPXXXXXX-PXXPXPXPPXXPXX------PPXXXXXXXPAXXPPXXGAXXXPXXX 805 P PP P P P P PP P PP P PP A P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTP-ASPPPAPA 137 Query: 806 XPXPXPXXXXXXPXXXXPXPPXSP---PPXP 889 P P P P P SP PP P Sbjct: 138 SPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/99 (24%), Positives = 24/99 (24%), Gaps = 3/99 (3%) Frame = +1 Query: 673 PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPX 852 P P PPP P P PP PPP P Sbjct: 27 PAASPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPV-----TPPPAVTPTS 81 Query: 853 XPPPPXFPXXXPXPPXPXXXXGAGXXXP---PRRXXPPP 960 P P P P P P P P PPP Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPP 120 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 49.2 bits (112), Expect = 4e-06 Identities = 35/105 (33%), Positives = 36/105 (34%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG +GG GG G K GGG GG G G G GG Sbjct: 15 GGGDGTKGGGNTIT-------GGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G G G G G GG G Sbjct: 68 ISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGGWNG 112 Score = 45.2 bits (102), Expect = 7e-05 Identities = 37/109 (33%), Positives = 37/109 (33%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G GG G GGGG G GGG G G G Sbjct: 22 GGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGG-GGDGTKGGGDGISGGGH---GDGL 77 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXFXK 633 GG G G G G G G G G GG G G G G K Sbjct: 78 GCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGG--WNGRKGFSGEGVVGK 124 Score = 42.7 bits (96), Expect = 3e-04 Identities = 34/95 (35%), Positives = 35/95 (36%), Gaps = 9/95 (9%) Frame = -1 Query: 902 GXGGXGXXXGKX---GGGGXX----GGXXXGGGXGPXXGXXXXGGXXPRXXG-GXGRGXX 747 G GG G G GGGG GG GGG G GG + G G G Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGH 73 Query: 746 XXXXXXXGXGGGGGXGXGXGGXXXG-GXGGGGGXG 645 G GG G G G G G G G GGG G Sbjct: 74 GDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRG 108 Score = 41.9 bits (94), Expect = 6e-04 Identities = 32/102 (31%), Positives = 33/102 (32%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G + GG G GG G G GGG G G G G G Sbjct: 32 GEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGG 91 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 R G GRG G GGG G G G G G G Sbjct: 92 RRGDGLGRG--------LGRGGGRGGWNGRKGFSGEGVVGKG 125 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 48.8 bits (111), Expect = 5e-06 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPP PP P P PP P PP PP P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPS 147 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP PPPP P P Sbjct: 148 LPPPTPKKSPPPPPSHHSSSPSNP 171 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/110 (29%), Positives = 33/110 (30%), Gaps = 6/110 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P P P P PP P P PPPP P P PP P P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTP--------KKSPSPPSLTPFVPHPTPKKSPSP 128 Query: 823 XPPPXXXPP---XXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPP 957 P P PP P P P P PP P + PP P Sbjct: 129 PPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPPHHQQNP 178 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/75 (29%), Positives = 26/75 (34%), Gaps = 6/75 (8%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPP------PXXXPPXXPPPPXFPXXXPXPPXPXXXX 915 P P PP + PP P P PP P P P PP P P P Sbjct: 88 PSPPPPAPKKSPPPPT--PKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPST 145 Query: 916 GAGXXXPPRRXXPPP 960 + P++ PPP Sbjct: 146 PSLPPPTPKKSPPPP 160 Score = 35.9 bits (79), Expect = 0.040 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 1/84 (1%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX-PXPXXXPPXPPFPXXPP 887 P P P PPPP P P P P P P P PP P PP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPP 136 Query: 888 XXXXPXXXXGXGXXXXXPAXAPPP 959 P +PPP Sbjct: 137 PAPKKSPST-PSLPPPTPKKSPPP 159 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P PPP P P PP P + PPP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPF--VPHPTPKKSPSPPP 130 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 48.8 bits (111), Expect = 5e-06 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 1/76 (1%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXX-GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXG 699 G GGGG GG GGG G G GG G G G G G GGG G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 147 Query: 698 XGXGGXXXGGXGGGGG 651 G GG GGGGG Sbjct: 148 GG-----YGGSGGGGG 158 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GGG G G GG R GG G G GG G G GG GG GGG Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Query: 653 GXG 645 G Sbjct: 150 YGG 152 Score = 36.7 bits (81), Expect = 0.023 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG R GG G G G GGG GG GGG G G GG Sbjct: 103 GGGGRREGGGGYSG--GGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 34.7 bits (76), Expect = 0.093 Identities = 31/85 (36%), Positives = 31/85 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG RGG G GG G GGG G GGG G G GG Sbjct: 90 GGGGGHRGGGSY------GGGGGRREGGGGYSGGG-GGYSSRGGGGGSYGGGRREGG--- 139 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGG 705 GG G G G GGGGG Sbjct: 140 ---GGYGGG---EGGGYGGSGGGGG 158 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 725 GXGG--GGGXGXGXGGXXXGGXGGGGGXGXF 639 G GG GGG G GG GG G GG G + Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGGGGGY 121 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 48.4 bits (110), Expect = 7e-06 Identities = 31/84 (36%), Positives = 31/84 (36%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G GG G GG GGG G GG GG G G G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGR------GNR 62 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G G G GGGG G Sbjct: 63 GGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -1 Query: 920 APXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXX-GGXGRGXXX 744 AP G G G G GG GG GG G G GG R GG G G Sbjct: 13 APIPSYGGDGYGGGGGYGGGDAGYGGRGASGG-GSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Query: 743 XXXXXXGXGGGGGXG 699 G GGGG G Sbjct: 72 GDRGGRGSGGGGRDG 86 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG RGG G GG G G GG G GG G P Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCPNPSCGNVNFARR 103 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG 657 G GGGG G G GG GG Sbjct: 104 VECNKCGALAPSGTSSGANDRGGGGYSRGGGDSDRGGGRGG 144 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G G G GGGG G GGG G G GG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGR--GNRGGGGGGYQGG--DRGG--- 76 Query: 779 RXXGGXGR 756 R GG GR Sbjct: 77 RGSGGGGR 84 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 48.4 bits (110), Expect = 7e-06 Identities = 31/84 (36%), Positives = 31/84 (36%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G GG G GG GGG G GG GG G G G Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGR------GNR 62 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G G G GGGG G Sbjct: 63 GGGGGGYQGGDRGGRGSGGGGRDG 86 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -1 Query: 920 APXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXX-GGXGRGXXX 744 AP G G G G GG GG GG G G GG R GG G G Sbjct: 13 APIPSYGGDGYGGGGGYGGGDAGYGGRGASGG-GSYGGRGGYGGGGGRGNRGGGGGGYQG 71 Query: 743 XXXXXXGXGGGGGXG 699 G GGGG G Sbjct: 72 GDRGGRGSGGGGRDG 86 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG RGG G GG G G GG G GG G P Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCPNPSCGNVNFARR 103 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG 657 G GGGG G G GG GG Sbjct: 104 VECNKCGALAPSGTSSGANDRGGGGYSRGGGDSDRGGGRGG 144 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG G G G G GGGG G GGG G G GG Sbjct: 24 GGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGR--GNRGGGGGGYQGG--DRGG--- 76 Query: 779 RXXGGXGR 756 R GG GR Sbjct: 77 RGSGGGGR 84 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 48.4 bits (110), Expect = 7e-06 Identities = 36/117 (30%), Positives = 37/117 (31%), Gaps = 12/117 (10%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP-------PPXPXXXXXXXXXPRPX--PPXXRGXXPPX 798 P PP PP PP P PP PP P +P PP P Sbjct: 96 PIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPP 155 Query: 799 XXXPXXGPXPPPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP PP PP P P P A PP PPP Sbjct: 156 TYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP---TPPP 209 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/107 (28%), Positives = 31/107 (28%), Gaps = 3/107 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP-XPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PP PP P P P PP P P PP PP P P Sbjct: 68 PIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPT-VKPPSVQPPTYKP 126 Query: 823 XPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PP P PP P P P P PP Sbjct: 127 -PTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPP 172 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/112 (28%), Positives = 33/112 (29%), Gaps = 10/112 (8%) Frame = +1 Query: 652 PPPPPX----PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXP 810 PP P PP PP P P PP P PP + P P P Sbjct: 80 PPTIPVTPVKPPVSTPPIKLP-PVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138 Query: 811 XXGPXPPPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PP PP PP P P P P PP Sbjct: 139 VKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPP 190 Score = 36.7 bits (81), Expect = 0.023 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 5/89 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP--PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P P P PP P PP P P P PP P P Sbjct: 34 PTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVS 93 Query: 820 PXP---PPXXXPPXXPPPPXFPXXXPXPP 897 P PP P PP P PP Sbjct: 94 TPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/107 (25%), Positives = 28/107 (26%), Gaps = 6/107 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXP---PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PP P P P P P PP P P PP P P Sbjct: 54 PPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPT 113 Query: 823 XPPPXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXP 954 PP PP PP P P P + PP P Sbjct: 114 VKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPP 160 Score = 34.3 bits (75), Expect = 0.12 Identities = 24/102 (23%), Positives = 25/102 (24%), Gaps = 2/102 (1%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP 839 P P P P PP P PP PP P P P P Sbjct: 41 PSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLP 100 Query: 840 XPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAP--PP 959 PP P P P P +P PP Sbjct: 101 PVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPP 142 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR 780 P PP PP PP P PP P P PP R Sbjct: 167 PTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPPVR 211 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 48.4 bits (110), Expect = 7e-06 Identities = 35/113 (30%), Positives = 37/113 (32%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXP 810 P PP PP PP P PP PPP P PP + P P P Sbjct: 330 PTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 389 Query: 811 XXGPXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P PP + PPP Sbjct: 390 PIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVK--PPP 440 Score = 48.4 bits (110), Expect = 7e-06 Identities = 34/109 (31%), Positives = 36/109 (33%), Gaps = 7/109 (6%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP---- 822 PP PP PP P PP P P P PP + P P P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQK 510 Query: 823 XPPPXXXPPXXPPP--PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 557 Score = 48.0 bits (109), Expect = 9e-06 Identities = 36/114 (31%), Positives = 38/114 (33%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXP 810 P PP PP PP P PP PPP P PP + P P P Sbjct: 178 PTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPP 237 Query: 811 XXGPXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 238 PVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVK--PPP 289 Score = 48.0 bits (109), Expect = 9e-06 Identities = 37/111 (33%), Positives = 38/111 (34%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPP---XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PP PP PP P PP PPP P P P P PP P Sbjct: 300 PPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHK 359 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P P P PP + PPP Sbjct: 360 P-PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIK--PPP 407 Score = 48.0 bits (109), Expect = 9e-06 Identities = 36/114 (31%), Positives = 38/114 (33%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXP 810 P PP PP PP P PP PPP P PP + P P P Sbjct: 514 PTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 Query: 811 XXGPXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 574 PVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 625 Score = 48.0 bits (109), Expect = 9e-06 Identities = 33/101 (32%), Positives = 33/101 (32%), Gaps = 3/101 (2%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP P P PP P PP P P PP PP P Sbjct: 654 PIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPT-YSPPVKPPPVQ 712 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P P P PP PPP P P P P G PP Sbjct: 713 VP-PTPTYSPPIKPPPVQVP---PTPTTPSPPQGGYGTPPP 749 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQ 308 Query: 820 PXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P PP + PPP Sbjct: 309 KPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVK--PPP 356 Score = 47.6 bits (108), Expect = 1e-05 Identities = 37/114 (32%), Positives = 39/114 (34%), Gaps = 9/114 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXP 810 P PP PP PP P PP PPP P PP + P P P Sbjct: 464 PTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPP 523 Query: 811 XXGPXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P P P PP + PPP Sbjct: 524 PVKP-PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIK--PPP 574 Score = 47.6 bits (108), Expect = 1e-05 Identities = 34/111 (30%), Positives = 36/111 (32%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 602 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQ 661 Query: 820 PXPPPXXXPPXXPPPPXFP----XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P PP + PPP Sbjct: 662 KPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVK--PPP 710 Score = 46.8 bits (106), Expect = 2e-05 Identities = 34/119 (28%), Positives = 37/119 (31%), Gaps = 3/119 (2%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP 792 +K I+ PPP PP P PP P P P P P Sbjct: 425 VKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSP 484 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P PP PPP P P P P PP + PPP Sbjct: 485 PVQPPPVQKP-PTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIK--PPP 540 Score = 46.8 bits (106), Expect = 2e-05 Identities = 34/110 (30%), Positives = 35/110 (31%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX--- 825 PP PP PP P PP P P P PP P P P Sbjct: 501 PPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHK 560 Query: 826 -PPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 608 Score = 46.8 bits (106), Expect = 2e-05 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 610 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 611 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 659 Score = 46.8 bits (106), Expect = 2e-05 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 627 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 628 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVK--PPP 676 Score = 46.8 bits (106), Expect = 2e-05 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 644 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 645 KPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVK--PPP 693 Score = 46.4 bits (105), Expect = 3e-05 Identities = 36/110 (32%), Positives = 37/110 (33%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPP-PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPP PP PP P PP P P PP PP P P Sbjct: 66 PIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPT-YSPPIYPPPIQKP 124 Query: 823 XPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 125 -PTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIK--PPP 171 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/111 (29%), Positives = 35/111 (31%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR---GXXPPXXXX 807 P PPP P P PP P PP P P PP PP Sbjct: 267 PVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQK 326 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PP P + P P P PP + PPP Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIY--SPPVKPPPVHKPPTPIYSPPVK--PPP 373 Score = 46.4 bits (105), Expect = 3e-05 Identities = 34/111 (30%), Positives = 36/111 (32%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQ 678 Query: 820 PXPPPXXXPPXXPPPPXFP----XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P PP + PPP Sbjct: 679 LPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIK--PPP 727 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 5/107 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQ 274 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P PP PP Sbjct: 275 TPPTPIYSPPVKPPPVHKP---PTPTYSPPVKSPPVQKPPTPTYSPP 318 Score = 46.0 bits (104), Expect = 4e-05 Identities = 34/112 (30%), Positives = 35/112 (31%), Gaps = 10/112 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP---- 822 PP PP PP P PP P P P PP P P P Sbjct: 317 PPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHK 376 Query: 823 XPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXP--PP 960 P P PP PPP P P P P P PP + P PP Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPP 428 Score = 45.6 bits (103), Expect = 5e-05 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 97 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQ 156 Query: 820 PXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P PP + PPP Sbjct: 157 MPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIK--PPP 204 Score = 45.6 bits (103), Expect = 5e-05 Identities = 37/111 (33%), Positives = 38/111 (34%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP P P PP P P PP P P PP PP P Sbjct: 402 PIKPPPLQKPPTPTYSPPIKLP-PVKPPTPIYSPPVKPPPVHKPPTPI-YSPPVKPPPVH 459 Query: 817 GPXPPPXXXPPXXPPP--PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P P P PP + PPP Sbjct: 460 KP-PTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVK--PPP 507 Score = 45.6 bits (103), Expect = 5e-05 Identities = 33/108 (30%), Positives = 33/108 (30%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP P P PP P PP P P PP PP P Sbjct: 637 PIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPT-YSPPVKPPPVQ 695 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P PP P P Sbjct: 696 VP-PTPTYSPPVKPPPVQVP---PTPTYSPPIKPPPVQVPPTPTTPSP 739 Score = 45.2 bits (102), Expect = 7e-05 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 5/107 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 80 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQ 139 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P PP PP Sbjct: 140 KPPTPSYSPPVKPPPVQMP---PTPTYSPPIKPPPVHKPPTPTYSPP 183 Score = 44.8 bits (101), Expect = 9e-05 Identities = 34/110 (30%), Positives = 35/110 (31%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP P P P Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVH 173 Query: 820 PXPPPXXXPPXXPP---PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP PP P P P PP + PPP Sbjct: 174 KPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIK--PPP 221 Score = 44.8 bits (101), Expect = 9e-05 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP-XPPXXRGXXP---PXXXXPXXGP 822 PP PP PP P PP P P P PP + P P P Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHK 207 Query: 823 XPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIK--PPP 255 Score = 44.8 bits (101), Expect = 9e-05 Identities = 34/121 (28%), Positives = 38/121 (31%), Gaps = 5/121 (4%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXP--PXXXPPXPXPXPPPPPXPXXXXXXXXXP---RPXPPXX 777 +K I+ PPP P P PP P PP P P P P Sbjct: 341 VKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYS 400 Query: 778 RGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P PP PP PP P + P P P PP + PP Sbjct: 401 PPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIY--SPPVKPPPVHKPPTPIYSPPVK--PP 456 Query: 958 P 960 P Sbjct: 457 P 457 Score = 44.4 bits (100), Expect = 1e-04 Identities = 34/110 (30%), Positives = 36/110 (32%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP-PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXGP 822 PP PP PP P PP PP P PP + P P P Sbjct: 165 PPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHK 224 Query: 823 XPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 225 PPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVK--PPP 272 Score = 43.6 bits (98), Expect = 2e-04 Identities = 34/115 (29%), Positives = 36/115 (31%), Gaps = 5/115 (4%) Frame = +1 Query: 631 IFXXXPXPPPPPXP--PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 I+ PPP P P PP P PP P P PP PP Sbjct: 280 IYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPT-YSPPIKP 338 Query: 805 XPXXGPXP---PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PP PP P P P PP + PPP Sbjct: 339 PPVKPPTPIYSPPVKPPPVHKPPTPI-YSPPVKPPPVHKPPTPIYSPPVK--PPP 390 Score = 43.2 bits (97), Expect = 3e-04 Identities = 35/110 (31%), Positives = 36/110 (32%), Gaps = 7/110 (6%) Frame = +1 Query: 652 PPP---PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPP PP P P P P P P P P P PP P P Sbjct: 488 PPPVQKPPTPTYSPPVKPPPIQKP---PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKP 544 Query: 823 XPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 545 -PTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 591 Score = 43.2 bits (97), Expect = 3e-04 Identities = 33/111 (29%), Positives = 34/111 (30%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PPP P P PP P PP P P PP PP P Sbjct: 535 PIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPT-YSPPIKPPPVH 593 Query: 817 GPXPP---PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PP P P P PP + PPP Sbjct: 594 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK--PPP 642 Score = 42.7 bits (96), Expect = 3e-04 Identities = 34/111 (30%), Positives = 35/111 (31%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP P P P Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVH 291 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP P P P P P PP + PPP Sbjct: 292 KPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIK--PPP 340 Score = 41.9 bits (94), Expect = 6e-04 Identities = 33/115 (28%), Positives = 36/115 (31%), Gaps = 6/115 (5%) Frame = +1 Query: 631 IFXXXPXPPP---PPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPX 798 I+ PPP PP P P P P PP P P P PP Sbjct: 381 IYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440 Query: 799 XXXPXXGPXPPPXXXPP-XXPPPPXF-PXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PP PP P + P P P P + PP PP Sbjct: 441 VHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPP 495 Score = 41.9 bits (94), Expect = 6e-04 Identities = 36/111 (32%), Positives = 38/111 (34%), Gaps = 9/111 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXXG 819 PP PP PP P PP PPP P PP + P P P Sbjct: 418 PPIKLPP-VKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVK 476 Query: 820 PXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P P P PP + PPP Sbjct: 477 P-PTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIK--PPP 524 Score = 41.5 bits (93), Expect = 8e-04 Identities = 32/110 (29%), Positives = 34/110 (30%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPX--PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPPP PP PP P PP P PP PP P Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIY----PPPIQKPPTPTYS 113 Query: 829 PPXXXPPXXPP------PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P PP +P PP P PP + P P Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP--SYSPPVKPPPVQMPPTP 161 Score = 41.1 bits (92), Expect = 0.001 Identities = 36/112 (32%), Positives = 38/112 (33%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXX 816 PP P P PP P PP PPP P PP + P P P Sbjct: 131 PPIYPP-PIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVH 189 Query: 817 GPXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P P P P PP + PPP Sbjct: 190 KP-PTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVK--PPP 238 Score = 40.7 bits (91), Expect = 0.001 Identities = 34/112 (30%), Positives = 36/112 (32%), Gaps = 10/112 (8%) Frame = +1 Query: 655 PPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP---PXXXXPXX 816 PPP P PP P PP P P P PP + P P P Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPI 104 Query: 817 GPXPPPXXXPPXXPPP---PXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PPP P P P P P PP + PPP Sbjct: 105 QKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVK--PPP 154 Score = 37.1 bits (82), Expect = 0.017 Identities = 35/117 (29%), Positives = 35/117 (29%), Gaps = 15/117 (12%) Frame = +1 Query: 655 PPPPX--PPXXXPPXPXPXPP-------PPPXPXXXXXXXXXPRPXPPXXRG---XXPPX 798 PP P PP PP P P PPP P PP PP Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPV 436 Query: 799 XXXPXXGPXPPPXXXPPXXPPP---PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PP PPP P P P P PP PPP Sbjct: 437 KPPPVHKP-PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPP--VQPPP 490 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/72 (29%), Positives = 22/72 (30%), Gaps = 5/72 (6%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPX--PPXXPGXX---PXXXXPXPXRXXXXXXPXPXX 851 P P PP PP PP P PP P P P + P P Sbjct: 137 PIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIY 196 Query: 852 XPPXPPFPXXPP 887 PP P P P Sbjct: 197 SPPIKPPPVHKP 208 Score = 32.7 bits (71), Expect = 0.37 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 8/85 (9%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXX---PPXXPPXXXXPPPP--XPPXXP---GXXPXXXXPXP 812 PP P PP PP PP PP P PP P P P Sbjct: 360 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Query: 813 XRXXXXXXPXPXXXPPXPPFPXXPP 887 + P P PP P P P Sbjct: 420 IKLPPVKPPTPIYSPPVKPPPVHKP 444 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/107 (26%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 633 TYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP------PVQLPPTP-TY 685 Query: 822 XXXXXPXPXXXPPXPPF--PXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P + P PP P P PP Sbjct: 686 SPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPP 732 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/107 (26%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 599 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP------PVHKPPTP-TY 651 Query: 822 XXXXXPXPXXXPPXPPF--PXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P + P PP P P PP Sbjct: 652 SPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/107 (26%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 531 TYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPP------PVHKPPTP-TY 583 Query: 822 XXXXXPXPXXXPPXPPF--PXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P + P PP P P PP Sbjct: 584 SPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/107 (26%), Positives = 29/107 (27%), Gaps = 3/107 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 565 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP------PVHKPPTP-TY 617 Query: 822 XXXXXPXPXXXPPXPPF--PXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP P + P PP P P PP Sbjct: 618 SPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPP 664 Score = 29.5 bits (63), Expect = 3.5 Identities = 25/107 (23%), Positives = 26/107 (24%), Gaps = 3/107 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P Sbjct: 229 TYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Query: 822 XXXXXPXPXXXPP--XPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P PP PP P P P +PP Sbjct: 289 PVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPP 335 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 111 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPP------PVQMPPTP-TY 163 Query: 822 XXXXXPXPXXXPPXPPF--PXXPPXXXXP 902 P P PP P + P PP P Sbjct: 164 SPPIKPPPVHKPPTPTYSPPIKPPVHKPP 192 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXPP-XXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRX 821 T P P P P PP PP PP PP P P P Sbjct: 667 TYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP------PVQVPPTP-TY 719 Query: 822 XXXXXPXPXXXPPXPPFPXXP 884 P P PP P P P Sbjct: 720 SPPIKPPPVQVPPTPTTPSPP 740 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 48.4 bits (110), Expect = 7e-06 Identities = 29/71 (40%), Positives = 29/71 (40%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G GGGG GG GGG G GG GG G G G G Sbjct: 34 GGSGKGQWLHGGGGEGGGGEGGGGEG--------GGGQKISKGGGGGGSGGGQRSSSGGG 85 Query: 716 GGGGXGXGXGG 684 GGGG G G GG Sbjct: 86 GGGGEGDGGGG 96 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 G G G G GG G G G GGGGG G G GG GGG Sbjct: 31 GNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGE 90 Query: 653 GXG 645 G G Sbjct: 91 GDG 93 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXG--XGXGGXXXGGXGG 660 GGG G GG GG G G G GGG G G GG GG G Sbjct: 33 GGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGD 92 Query: 659 GGG 651 GGG Sbjct: 93 GGG 95 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGG---XXGGXXXGGGXGPXXGXXXXGGXXPRXXGG 765 G GG G G GGGG GG G G G GG GG Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGK---XGGGGXXGGXXXGGG 825 GGG GG G GG G G+ GGGG G GGG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXG-GGGGXG 645 GG G G G G GG G GGGG G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEG 54 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 48.0 bits (109), Expect = 9e-06 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P PPPPP P P P PP P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPP-------PQSLPPPSPSPEPEHYPPPPYHHYITPS 102 Query: 826 PPPXXXPPXXPPPP 867 PPP P PPPP Sbjct: 103 PPPPRPLPPPPPPP 116 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P PPPP P P P P PP P PP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPP---PSPSPEPEHYPPPPYHHYITPSP-PP 105 Query: 832 PXXXPPXXPPPPXFPXXXP 888 P PP PPPP P Sbjct: 106 PRPLPP--PPPPPLHFSSP 122 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP------PXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPP P P P P P PPR PPP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXX 885 P P P P P P PP PP P P P P P PPPP Sbjct: 50 PAPSPEPEDYL-----PLPPPPQT----PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYIT 100 Query: 886 PXPPXP 903 P PP P Sbjct: 101 PSPPPP 106 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +2 Query: 695 PXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXXXPXXXXPXPPXS 874 P P PP P PP P+ P P P P P P PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSP-------EPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Query: 875 PPP 883 PPP Sbjct: 114 PPP 116 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PPPP P P PP P P PPP Sbjct: 52 PSPEPEDYLPL-PPPPQTP---PPPPPPQSLPPPSPSPEPEHYPPPP 94 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/91 (35%), Positives = 32/91 (35%), Gaps = 5/91 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P P PP P P P PP PP P P Sbjct: 279 PSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTP--TLPPIPTIPTLPPL 336 Query: 826 P--PP---XXXPPXXPPPPXFPXXXPXPPXP 903 P PP P PPPP FP P PP P Sbjct: 337 PVLPPVPIVNPPSLPPPPPSFP--VPLPPVP 365 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 8/94 (8%) Frame = +1 Query: 646 PXPPP-PPXP----PXXXPPXPX-PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PP PP P P P P P PP P P P P P PP Sbjct: 293 PSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPP 352 Query: 808 PXXG-PXP-PPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P PP P PP P P P P P Sbjct: 353 PPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIP 386 Score = 43.6 bits (98), Expect = 2e-04 Identities = 33/107 (30%), Positives = 34/107 (31%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX----PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PP P PP PP P P P PP P P P P PP Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPT-----PPTLPTIPLL 316 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P P P PP P + PP P P Sbjct: 317 PTPPTPTLPP-IPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLP 362 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/84 (32%), Positives = 27/84 (32%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P PP P P P PP P P PP PP P Sbjct: 317 PTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLP---PPPPSFPVPLPPVPGLPGI--- 370 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP P PP P P P P Sbjct: 371 -PPVPLIPGIPPAPLIPGIPPLSP 393 Score = 34.3 bits (75), Expect = 0.12 Identities = 34/128 (26%), Positives = 36/128 (28%), Gaps = 3/128 (2%) Frame = +3 Query: 585 KSIMLVNYKSQT---NKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPP 755 KS L N KS + K K PP P P P PP P Sbjct: 235 KSASLHNKKSDSLKDKKTEALKPNFFFPPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPS 294 Query: 756 PPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXX 935 PP P P P P P PP P P PP P Sbjct: 295 PPSLPPIP-LIP--TPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPV-----PIVN 346 Query: 936 XPAXAPPP 959 P+ PPP Sbjct: 347 PPSLPPPP 354 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/82 (34%), Positives = 28/82 (34%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP 792 L I TI P P PP P P P PPPP P P P P G P Sbjct: 324 LPPIPTIPTLPPLPVLPPVPIVNPPSLP---PPPPSFP--------VPLPPVPGLPG-IP 371 Query: 793 PXXXXPXXGPXPPPXXXPPXXP 858 P P P P PP P Sbjct: 372 PVPLIPGIPPAPLIPGIPPLSP 393 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +1 Query: 607 INLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPP-PPXPXXXXXXXXXPRPXPP 771 INL+ + PPP PP P P PP P P P P P Sbjct: 171 INLRGSKPLLPDPSFPPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVP 226 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP PP P P P P P P Sbjct: 186 PPPLQDPPNPSPLPNLPIVPPLPNLP 211 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/75 (36%), Positives = 28/75 (37%), Gaps = 3/75 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PP PP P P P P P PPP P P P PP +G PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP--PPPPMSK 429 Query: 823 XPPPXXXPPXXPPPP 867 PP PP P P Sbjct: 430 KGPP--KPPGNPKGP 442 Score = 45.2 bits (102), Expect = 7e-05 Identities = 32/114 (28%), Positives = 34/114 (29%), Gaps = 7/114 (6%) Frame = +1 Query: 619 QINTIFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX 789 Q++T P PP P P PP P P Sbjct: 312 QLSTSAPSVPLPPGQYTAVNAPFSTSTQPVSLPPGQYMPGNAALSASTPLTPGQFTTANA 371 Query: 790 PPXXXXPXXGPXPPPXXXP----PXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP P PPP P P PPPP P PP P GAG PP Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/76 (35%), Positives = 28/76 (36%), Gaps = 4/76 (5%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG----XXPPXXXXPXXGPXP 828 PP PP P PPPPP P P P PP +G PP GP P Sbjct: 372 PPAPPG---PANQTSPPPPPPPSAAA-----PPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Query: 829 PPXXXPPXXPPPPXFP 876 PP P PP P Sbjct: 424 PPPMSKKGPPKPPGNP 439 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 PP PP PPP PP G P P + P P PP P P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/103 (25%), Positives = 26/103 (25%), Gaps = 3/103 (2%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG---PXP 828 P PP P P P P PP P P P Sbjct: 340 PVSLPPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPP 399 Query: 829 PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P PPPP PP P G PP P Sbjct: 400 PPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/76 (27%), Positives = 21/76 (27%), Gaps = 2/76 (2%) Frame = +3 Query: 645 TXXXPPXPXXXXXXPXXXXXXPPXXP--PXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXR 818 T PP P PP P PP P P PP PG P P Sbjct: 368 TANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPG-KKGAGPPPPPP 426 Query: 819 XXXXXXPXPXXXPPXP 866 P P P P Sbjct: 427 MSKKGPPKPPGNPKGP 442 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 P P P PP PPP P PP P A PP + PPP Sbjct: 372 PPAPPGPANQTSPPPPPPPS--AAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/63 (42%), Positives = 27/63 (42%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GGG G G GG GG G G G GGGGG G GG GG G GG Sbjct: 42 GGGSGDGLGLGLGGGAG---LGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGG 98 Query: 653 GXG 645 G G Sbjct: 99 GAG 101 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = -1 Query: 902 GXGGXGXXXGKX-GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G GG G G GGG GG G G G G GG GG G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGG--------LLG 92 Query: 725 GXGGGGGXGXGXGG 684 G G GGG G G GG Sbjct: 93 GGGFGGGAGGGLGG 106 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/72 (37%), Positives = 27/72 (37%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GGGG G G G G G G G G G G GGGG G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGA-------GIGAGAGLGLGGGGGGLGGGGGGLLGG 93 Query: 686 GXXXGGXGGGGG 651 G GG GGG G Sbjct: 94 GGFGGGAGGGLG 105 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGK-XGGGGXXGGXXXGGGXGPXXG 807 GGG G G G G G GGGG GG GGG G G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 29/74 (39%), Positives = 29/74 (39%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G GG GG GGG G GG GG G G GGG G G G Sbjct: 46 GHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYG 105 Query: 686 GXXXGGXGGGGGXG 645 G GG GGGG G Sbjct: 106 G---GGHHGGGGHG 116 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG GG G GG G GGGG GG GG G G GG Sbjct: 57 GGGGHGHGGHNGGGGHGLDGYGG-GHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGG 112 Score = 33.5 bits (73), Expect = 0.21 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXG 759 GG G GG G G GGG G GGG G G GG GG G Sbjct: 45 GGHGGHGGGGHYGGGGHG--HGGHNGGGGHGLDGYGGGHG---GHYGGGGGHYGGGGGHG 99 Query: 758 RGXXXXXXXXXGXGGGG 708 G G GG G Sbjct: 100 GGGHYGGGGHHGGGGHG 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG GG G G G G GG GG GGG G G GG Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGG-HYGGGGGHYGGGGGHGGGGH 103 Query: 779 RXXGGXGRG 753 GG G Sbjct: 104 YGGGGHHGG 112 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 GGG G G GG G GGGG GG GG G Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGG 114 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 46.8 bits (106), Expect = 2e-05 Identities = 32/111 (28%), Positives = 32/111 (28%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 643 PPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAP 702 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PPP P P P PP P P Sbjct: 703 KPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSP 753 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 241 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSP 300 Query: 817 GPX---PPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 301 KPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPP 335 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSP 677 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 678 KPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPP 712 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 191 PPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSP 250 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 251 KPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPP 285 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 401 KPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPP 435 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 216 PPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 275 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 276 KPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 310 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 316 PPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 375 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 376 KPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPP 410 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 593 PPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTP 652 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 653 KPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 687 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 11/95 (11%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P P PP PPP P PP PP P Sbjct: 291 PPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSP 350 Query: 817 GPX---PPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 351 KPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 385 Score = 42.7 bits (96), Expect = 3e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 266 PPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSP 325 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 326 KPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPP 360 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/100 (29%), Positives = 31/100 (31%), Gaps = 9/100 (9%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 ++ P PP P P P P P PPP P PP PP Sbjct: 563 VYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPY 622 Query: 802 XXPXXGP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P P PPP PPP P P PP P Sbjct: 623 YSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPP 662 Score = 41.9 bits (94), Expect = 6e-04 Identities = 31/108 (28%), Positives = 32/108 (29%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 366 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPP----PYY 421 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P PPP + P P PP PP Sbjct: 422 SPSPKPSYKSP--PPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPP 467 Score = 41.9 bits (94), Expect = 6e-04 Identities = 32/113 (28%), Positives = 34/113 (30%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPXXXXPX 813 P PP P P P PP P PPP P + P PP PP P Sbjct: 718 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPS 777 Query: 814 XG---PXPPPXXXPPXXPPPPXF-PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP + P P PP P P Sbjct: 778 PKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSP 830 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 141 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 200 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 201 KPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP P PP PP P Sbjct: 116 PPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 175 Query: 817 G---PXPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 PPP PPP P P PP P Sbjct: 176 KVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPP 210 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 166 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSP 225 Query: 817 GP---XPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 P PPP PPP P P PP P Sbjct: 226 KPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPP 260 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 125 Query: 817 GP---XPPP-----XXXPPXXPPPPXFPXXXPXPP 897 P PPP PP P P P PP Sbjct: 126 KPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 160 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P PP P PPP PP PP P Sbjct: 416 PPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSP 475 Query: 817 G---PXPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 PPP PPP P P PP P Sbjct: 476 KVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPP 510 Score = 36.7 bits (81), Expect = 0.023 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 10/96 (10%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP P P PP P PPP P PP PP P Sbjct: 40 PPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPS 99 Query: 814 XG---PXPPPXXXPPXXPPPPXFPXXXP---XPPXP 903 PPP PPP P P PP P Sbjct: 100 PKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPP 135 Score = 36.7 bits (81), Expect = 0.023 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 8/89 (8%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXG 819 PP P PP P P P P P PP P P Sbjct: 558 PPTPYVYHSPPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNS 617 Query: 820 PXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP P P PPP + P PP Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPP 646 Score = 36.3 bits (80), Expect = 0.030 Identities = 33/122 (27%), Positives = 35/122 (28%), Gaps = 19/122 (15%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P P P P PPPP P PP PP P Sbjct: 14 PPPPLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSP 73 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP----XPXXXXGAGXXXPPRRXXP 954 P PP PP P P P PP P + P + P Sbjct: 74 SPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPP 133 Query: 955 PP 960 PP Sbjct: 134 PP 135 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/90 (28%), Positives = 27/90 (30%), Gaps = 9/90 (10%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXG 819 PPPP PP P P P P P PP P P Sbjct: 684 PPPPYV-YSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSS 742 Query: 820 PXPPPXXXP----PXXPPPPXFPXXXPXPP 897 P PPP P PPP + P PP Sbjct: 743 PPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 772 Score = 35.1 bits (77), Expect = 0.070 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP PP P P P P P PP P P Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSS 768 Query: 838 XXPPXXPPPPXFPXXXPXPP 897 PP P P P PP Sbjct: 769 PPPPYYSPSPKVEYKSPPPP 788 Score = 34.3 bits (75), Expect = 0.12 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 7/81 (8%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P P P PPP P PP PP P Sbjct: 441 PPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 500 Query: 817 GP--XPPPXXXPPXXPPPPXF 873 P PP PPPP + Sbjct: 501 KPSYKSPPPPYVYNSPPPPYY 521 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/106 (28%), Positives = 31/106 (29%), Gaps = 10/106 (9%) Frame = +1 Query: 652 PPP-----PPXPPXXXP-PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPP PP PP P P PPPP P P PP Sbjct: 786 PPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVY-- 843 Query: 814 XGPXPPPXXXPPXX----PPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P PP P PPP + P PP A PP Sbjct: 844 NSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPP 889 Score = 33.9 bits (74), Expect = 0.16 Identities = 25/97 (25%), Positives = 26/97 (26%), Gaps = 3/97 (3%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXP-PXXPPXXXXPPPPXPPXX 776 Y S YY K T PP P P P PP PP P Sbjct: 615 YNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYS 674 Query: 777 PGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P P P + PP Sbjct: 675 PSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPP 711 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/88 (28%), Positives = 27/88 (30%), Gaps = 7/88 (7%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPP---XXX 804 P PP P P PP P PPP P + P PP PP Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSP 828 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXP 888 P PP PPPP + P Sbjct: 829 SPKVEYKSPPPPYVYNSPPPPAYYSPSP 856 Score = 33.1 bits (72), Expect = 0.28 Identities = 29/121 (23%), Positives = 30/121 (24%), Gaps = 3/121 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXP-PXXPPXXXXPPPPXPPXX 776 Y S YY K T PP P P P PP PP P Sbjct: 188 YNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYS 247 Query: 777 PGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPP 956 P P P P P P P + PP PA P Sbjct: 248 PSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSP 307 Query: 957 P 959 P Sbjct: 308 P 308 Score = 33.1 bits (72), Expect = 0.28 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 5/79 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 466 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSP 525 Query: 817 GP--XPPPXXXPPXXPPPP 867 PP PPPP Sbjct: 526 KVIYKSPPHPHVCVCPPPP 544 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 4/98 (4%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXP-PXXPPXXXXPPPPXPPXX 776 Y S YY K T PP P P P PP PP P Sbjct: 665 YSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYS 724 Query: 777 PGXXPXXXXPXPXRXXXXXXPXPXXXP-PXPPFPXXPP 887 P P P P P P P P + PP Sbjct: 725 PSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPP 762 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/88 (27%), Positives = 27/88 (30%), Gaps = 7/88 (7%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP- 795 ++ P PP P P PP P PPPP P PP PP Sbjct: 790 VYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP 849 Query: 796 --XXXXPXXGPXPPPXXXPPXXPPPPXF 873 P PP PPPP + Sbjct: 850 AYYSPSPKIEYKSPPPPYVYSSPPPPSY 877 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 Y S YY K T PP P P PP P P PPPP P Sbjct: 690 YSSPPPPYYSPAPKPTYKSPPPPYVYSSPP------PPYYSPSPKPTYKSPPPPYVYSSP 743 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP+ P Sbjct: 744 -PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 778 Score = 32.3 bits (70), Expect = 0.49 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 Y S YY K T PP P P PP P P PPPP P Sbjct: 363 YSSPPPPYYSPSPKPTYKSPPPPYVYSSPP------PPYYSPSPKPVYKSPPPPYIYNSP 416 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP+ P Sbjct: 417 --PPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSP 450 Score = 31.5 bits (68), Expect = 0.86 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 5/87 (5%) Frame = +1 Query: 652 PPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P PP P P PP P P PP P Sbjct: 811 PPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNS------PPPPAYYSPSPKIEYKSPP 864 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP P P P PP Sbjct: 865 PPYVYSSPPPPSYSPSPKAEYKSPPPP 891 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/96 (27%), Positives = 27/96 (28%), Gaps = 2/96 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 Y S YY K PP P P PP P P PPPP P Sbjct: 388 YSSPPPPYYSPSPKPVYKSPPPPYIYNSPP------PPYYSPSPKPSYKSPPPPYVYSSP 441 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP+ P Sbjct: 442 --PPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSP 475 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 7/81 (8%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P P P P PPPP P PP PP P Sbjct: 820 PPPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPP----P 875 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 P P P PPP + Sbjct: 876 SYSPSPKAEYKSP--PPPSLY 894 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/96 (27%), Positives = 27/96 (28%), Gaps = 2/96 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 Y S YY K PP P P PP P P PPPP P Sbjct: 88 YSSPPPPYYSPSPKVDYKSPPPPYVYSSPP------PPYYSPSPKPTYKSPPPPYVYNSP 141 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP+ P Sbjct: 142 --PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 175 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/97 (23%), Positives = 25/97 (25%), Gaps = 3/97 (3%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXP-PXXPPXXXXPPPPXPPXX 776 Y S YY K + PP P P P PP PP P Sbjct: 413 YNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYS 472 Query: 777 PGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P P + PP Sbjct: 473 PSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPP 509 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 46.8 bits (106), Expect = 2e-05 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G GG G G GGGG G GGG GG P G G G G Sbjct: 406 GDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGG----EQGVTG 461 Query: 722 XGGGGGXGXGXGGXXXGGXGG 660 GGGG G G G GG G Sbjct: 462 SDGGGGRGRGGGKVAGGGKKG 482 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/111 (31%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGX--GXXXGKXGGGGXXGGXXXGGGXGPXX------GX 804 GGG G + G G G G+ G G GGG G G Sbjct: 312 GGGRTGNKGGNGGSIKIGVGTNGITGGTGGGEAGAGMQVMQGWGGGGSGAATQVMQGCGG 371 Query: 803 XXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G G G G GGGGG G G GG G GGGGG Sbjct: 372 GDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGG 422 Score = 41.1 bits (92), Expect = 0.001 Identities = 36/119 (30%), Positives = 39/119 (32%), Gaps = 5/119 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXX-----GGXXXGGGXGPXXGXXXX 795 GGG GG P G GG G GG G G GGG G Sbjct: 256 GGGVIVNGGCETVPP----GRGGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTD 311 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXFXKIVFIC 618 GG GG G G G GG G G G GGGG G +++ C Sbjct: 312 GGGRTGNKGGNG-GSIKIGVGTNGITGGTGGGEAGAGMQVMQGWGGGGSGAATQVMQGC 369 Score = 40.7 bits (91), Expect = 0.001 Identities = 31/96 (32%), Positives = 32/96 (33%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXG 759 GG G GG G G GGGG G GGG G G + G G Sbjct: 386 GGGAGAVTQVMQGCGGGGG--GGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGG 443 Query: 758 RGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GGGGG G GG G GGG Sbjct: 444 GAPLTM------IGGGGGEQGVTGSDGGGGRGRGGG 473 Score = 37.1 bits (82), Expect = 0.017 Identities = 33/115 (28%), Positives = 34/115 (29%), Gaps = 10/115 (8%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG GG GG G GG G G G G G Sbjct: 292 GGGRGAEGGGRGSTGEGVTDGGGRTGNKGGNGGSIKIGVGTNGITGGTGGGEAGAGMQVM 351 Query: 779 RXXGGXGRGXXXXXXXXXGXG----------GGGGXGXGXGGXXXGGXGGGGGXG 645 + GG G G G G G GG G G G GGGGG G Sbjct: 352 QGWGGGGSGAATQVMQGCGGGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGG 406 Score = 28.3 bits (60), Expect = 8.0 Identities = 25/101 (24%), Positives = 25/101 (24%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P PP P PPP G P P R Sbjct: 155 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG-GEPVIPGAPPPKRGGGGEP 213 Query: 837 PXPXXXPPXPPFPXXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P PP P P G G P APPP Sbjct: 214 VIPGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPG-APPP 253 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/97 (34%), Positives = 33/97 (34%), Gaps = 1/97 (1%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGX-GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGX 762 GG P G GG G G GGG G GGG G G GG GG Sbjct: 113 GGASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGAS-GGASGGASGGA 171 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G GGG G GG G GG G Sbjct: 172 SGGASGGGP---GGASGGGPGGASGGGPGGASGGASG 205 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/100 (28%), Positives = 29/100 (29%), Gaps = 1/100 (1%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGG-GGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GG + GG P G G G GG G G GG G G GG Sbjct: 139 GGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGG 198 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG 660 G G G GG G G G GG Sbjct: 199 ASGGASGDKPEGAPGDKPGGAWGGKPGKKPGHKPEGARGG 238 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/98 (29%), Positives = 30/98 (30%), Gaps = 5/98 (5%) Frame = -1 Query: 935 GXXXPAPXXXXGXGGXGXXXGKXGGGGXXG--GXXXGGGXGPXXGXXXXGGXXPRXXGGX 762 G P+ G G G G GGG G G GG G G G G Sbjct: 125 GAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGAS 184 Query: 761 GRGXXXXXXXXXGXGGGGGXG---XGXGGXXXGGXGGG 657 G G G GG G G G GG GG Sbjct: 185 GGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGG 222 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -1 Query: 845 GXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGX 666 G G G G G P G G G GG G GG G Sbjct: 113 GGASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGAS 172 Query: 665 GGGGGXG 645 GG G G Sbjct: 173 GGASGGG 179 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/69 (26%), Positives = 18/69 (26%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 GGG G G G G GG GG G GP G P Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKP 208 Query: 779 RXXGGXGRG 753 G G Sbjct: 209 EGAPGDKPG 217 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/112 (28%), Positives = 33/112 (29%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPPPXPP---------XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 PPPPP PP P P PPPPP P R PP Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPP--- 153 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP PP P PP P + PPP Sbjct: 154 -PPPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTPITNTSDHHQLHPPP 204 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 13/40 (32%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP-------------XPXPXPPPPPXP 726 P PPPPP PP PP P P PPPPP P Sbjct: 122 PPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPP 161 Score = 36.3 bits (80), Expect = 0.030 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +3 Query: 750 PPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXX 929 PPPP PP P P P PP PP P PP P G Sbjct: 122 PPPPPPPPPPTITPPVTTTTAGHHHHRRSP-----PPPPPPPPPPPTITPPVTTTTTGHH 176 Query: 930 XXXPAXAPP 956 P PP Sbjct: 177 HHRPPPPPP 185 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 7/32 (21%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP-------XPPPPP 720 P PPPPP PP PP PPPPP Sbjct: 153 PPPPPPPPPPTITPPVTTTTTGHHHHRPPPPP 184 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +3 Query: 750 PPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXXGXGXX 929 PPPP PP P P P PP PP PP Sbjct: 97 PPPPPPP------PLSAITTTGHHHHRRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRS 150 Query: 930 XXXPAXAPPP 959 P PPP Sbjct: 151 PPPPPPPPPP 160 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 46.0 bits (104), Expect = 4e-05 Identities = 29/87 (33%), Positives = 30/87 (34%), Gaps = 7/87 (8%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXP-----RPXPPXXRGXXPPXXXXPXX 816 PPP P PP P P PPP P P P PP PP Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYK 94 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PPPP + P PP Sbjct: 95 SPPPPPFVY--SSPPPPTYIYNSPPPP 119 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 5/108 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP-----RPXPPXXRGXXPPXXXXPXX 816 PPP P PP P PPP P P P PP PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYN 114 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PP P + P PPP Sbjct: 115 SPPPPPYVYKSV----PRITFIYSSPPPPPYVYNSAPRIPFIYSSPPP 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 33/125 (26%), Positives = 35/125 (28%), Gaps = 10/125 (8%) Frame = +1 Query: 616 KQINTIFXXXPXPPPPPXPPXXXPPXP--XPXPPPPP---XPXXXXXXXXXPRPXPPXXR 780 K + I PPPPP P P PPPPP P PP Sbjct: 124 KSVPRITFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPPPPYVY 183 Query: 781 GXXPPXXXXPXXGPXPPPXXXPPXXPP-----PPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PP P P P PP P P PP P + P Sbjct: 184 NSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPYVYNSAPRVPFIY 243 Query: 946 XXPPP 960 PPP Sbjct: 244 SSPPP 248 Score = 35.9 bits (79), Expect = 0.040 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 5/82 (6%) Frame = +1 Query: 673 PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPX 852 P PP P PP P P P P P PP P PP P Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKS----PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPP 87 Query: 853 XPP-----PPXFPXXXPXPPXP 903 PP PP P PP P Sbjct: 88 RPPYVYKSPPPPPFVYSSPPPP 109 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/69 (28%), Positives = 23/69 (33%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXX 933 P+ PP PP P PPP PPPP + P PP P Sbjct: 32 PQSPPPQPYVYSPPLPS-PYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPP 90 Query: 934 PPRRXXPPP 960 + PPP Sbjct: 91 YVYKSPPPP 99 Score = 34.7 bits (76), Expect = 0.093 Identities = 27/94 (28%), Positives = 28/94 (29%), Gaps = 12/94 (12%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX--PXPPPPP--XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPPP PP PPPPP P PP P Sbjct: 96 PPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPPYVYNSAPRIPFIYSS 155 Query: 820 PXPPPXXXPP--------XXPPPPXFPXXXPXPP 897 P PPP PPPP + P PP Sbjct: 156 PPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPP 189 Score = 34.7 bits (76), Expect = 0.093 Identities = 29/107 (27%), Positives = 30/107 (28%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP----RPXPPXXRGXXPPXXXXPXXG 819 PPPPP P P PPP P P P PP P Sbjct: 226 PPPPPYVYNSAPRVPFIYSSPPPPPYVYKSVPRIPFIYSSPPPPPYVYNSAPRIPF-IYS 284 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P P P PP P + P PPP Sbjct: 285 SLPPP---PYVYNSAPRVPFIYSSPPPPPYVYNSAPRIPFIYSSPPP 328 Score = 33.5 bits (73), Expect = 0.21 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 5/108 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX---PXPPPPP--XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPPP PP P PPPPP P PP P Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYS 134 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P P PP P + PPP Sbjct: 135 SPPPPPY----VYNSAPRIPFIYSSPPPPPYVYNSAPRVLFIYSSPPP 178 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 46.0 bits (104), Expect = 4e-05 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = -1 Query: 872 KXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXG 693 K GG G G G G G GG + GG G GGGGG G Sbjct: 254 KNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAG 313 Query: 692 XGGXXXGGXGGGGGXGXF 639 G GG GG G F Sbjct: 314 KKGNGGGGPMAGGVSGGF 331 Score = 45.6 bits (103), Expect = 5e-05 Identities = 35/102 (34%), Positives = 36/102 (35%), Gaps = 2/102 (1%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXX--GGXXXGGGXGPXXGXXXXGGXX 783 GG + GG PA GG G G GG G GG GGG P G GG Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGG-- 307 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG 657 GG G G GGGG G G GGG Sbjct: 308 ----GGPNAGKK-------GNGGGGPMAGGVSGGFRPMGGGG 338 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/102 (30%), Positives = 33/102 (32%), Gaps = 2/102 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKX--GGGGXXGGXXXGGGXGPXXGXXXXGGX 786 G G +GG GG GK GGGG G GG GP G GG Sbjct: 273 GAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAG-GVSGGF 331 Query: 785 XPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG 660 P GG + G GG G G G GG Sbjct: 332 RPMGGGGP-QNMSMPMGGQMGMGGPMGNMPAVQGLPATGPGG 372 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G GG GGGGG G Sbjct: 103 GGGGGGNNNNNKKGQKNGGGGGGGGGG 129 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 P GG G G G GGG G G GG GGG Sbjct: 252 PAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGG 295 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G GG GGGGG G Sbjct: 104 GGGGGNNNNNKKGQKNGGGGGGGGGGG 130 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -1 Query: 848 GGXXXGGGXG-PXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX-GXGGXXX 675 GG GG G P G GG + GG +G G GGGG G G Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGG--KGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNG--- 304 Query: 674 GGXGGGGG 651 GGGGG Sbjct: 305 ---GGGGG 309 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 46.0 bits (104), Expect = 4e-05 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 7/91 (7%) Frame = -1 Query: 896 GGXGXXXGKXGG----GGXXGGXXXGG-GXGPXXGXXXXGGXXPRXXG-GXGRGXXXXXX 735 GG G GK G GG GG GG G GP G G PR G G G G Sbjct: 8 GGWGDFPGKGVGSCVFGGGGGGPAFGGRGGGPGRGY----GGGPRVHGPGYGIGSRGPDP 63 Query: 734 XXXGXGGGGGXGXGXGGXXXGGXG-GGGGXG 645 GG G G G GG G G GGGG G Sbjct: 64 GPGFFFGGAGPGPGYGGGGGHGPGYGGGGDG 94 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 3/84 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXG-GXXPR-XXGGXGRGXXXXXXXX 729 G GG G G GGG G GP G G P GG G G Sbjct: 24 GGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGG 83 Query: 728 XGXG-GGGGXGXGXGGXXXGGXGG 660 G G GGGG G G G GG G Sbjct: 84 HGPGYGGGGDGRGYGSETGGGNHG 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKX---GGGGXXGGXXXGGGXGPXXGXXXXGG 789 GGG R G G G G G GG G G GGG GP G G Sbjct: 36 GGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGGDGR 95 Query: 788 XXPRXXGGXGRG 753 GG G Sbjct: 96 GYGSETGGGNHG 107 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = -2 Query: 886 GGXXGXGGXGGXXXGXGXXXXXXRXGXGXXXXGXXPGXXGGXGGGGXXXXGGXXGGXXGG 707 GG G GG G G G G G PG GG G G GG G Sbjct: 28 GGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPG 87 Query: 706 XXXXXXGXXXXXXGXGG 656 G GG Sbjct: 88 YGGGGDGRGYGSETGGG 104 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 46.0 bits (104), Expect = 4e-05 Identities = 31/109 (28%), Positives = 33/109 (30%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPP--PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP PP P PP P PP P P P + P P Sbjct: 111 PVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKA 170 Query: 820 PXPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PP PP P P P PP + P Sbjct: 171 PVKPP-TKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTP 218 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/108 (26%), Positives = 31/108 (28%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXP---PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P P P P PP P P P PP P P P + P P Sbjct: 58 PHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAK 117 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P P P P P A P + PP Sbjct: 118 PPVKPPVYPPTKAPVKP--PTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 42.3 bits (95), Expect = 5e-04 Identities = 30/105 (28%), Positives = 31/105 (29%), Gaps = 7/105 (6%) Frame = +1 Query: 646 PXPPP--PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP PP P PP P PP P P P + P P Sbjct: 103 PTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKP 162 Query: 820 PXPPP---XXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP 939 P PP PP PP PP P P P PP Sbjct: 163 PVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPP 207 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/105 (25%), Positives = 30/105 (28%), Gaps = 2/105 (1%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 ++ P PP P PP P PP P P P + P P Sbjct: 92 VYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Query: 811 XXGPXPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP 939 P PP PP PP P P P P PP Sbjct: 152 VKPPTKPP-VKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/105 (24%), Positives = 28/105 (26%), Gaps = 2/105 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P PP P PP P P P + P P P P Sbjct: 95 PTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKP 154 Query: 832 PXXXPPXXP--PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P P + PP Sbjct: 155 PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPP 199 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP P P PP P P PP PP P P Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPP-TKPPVKPPV 144 Query: 826 PPPXXXPPXXP-PPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP P P PP P P P PP Sbjct: 145 YPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 39.5 bits (88), Expect = 0.003 Identities = 32/109 (29%), Positives = 33/109 (30%), Gaps = 4/109 (3%) Frame = +1 Query: 646 PXPPP--PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP PP P PP P PP P P PP PP P Sbjct: 79 PVSPPAKPPVKPPVYPPTKAPVKPPTKPP---VKPPVSPPAKPPVKPPVYPP-TKAPVKP 134 Query: 820 PXPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PP P P P P PP + P Sbjct: 135 PTKPP-VKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKP 182 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 5/86 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP P P P PP P P P + P P P Sbjct: 138 PPVKPPVYPPTKAPVKP-PTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPV 196 Query: 826 PPP---XXXPPXXPP--PPXFPXXXP 888 PP PP PP PP P P Sbjct: 197 YPPTKAPVKPPVSPPTKPPVTPPVYP 222 Score = 36.7 bits (81), Expect = 0.023 Identities = 23/83 (27%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 ++ P PP P PP P P P P P + P P Sbjct: 144 VYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Query: 811 XXGPXPPPXXXPPXXPP--PPXF 873 P PP PP PP PP F Sbjct: 204 VKPPVSPP-TKPPVTPPVYPPKF 225 Score = 35.9 bits (79), Expect = 0.040 Identities = 24/96 (25%), Positives = 27/96 (28%), Gaps = 5/96 (5%) Frame = +1 Query: 631 IFXXXPXPPPPPXPP----XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPX 798 ++ P PP P PP P PP P P P + P Sbjct: 124 VYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Query: 799 XXXPXXGPXPPPXXXPPXXP-PPPXFPXXXPXPPXP 903 P P PP P P PP P P P Sbjct: 184 VSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 4/96 (4%) Frame = +1 Query: 664 PXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P PP P P P PP P PP PP P P PP Sbjct: 50 PHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPP-TKAPVKPPTKPP- 107 Query: 838 XXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP PP PP P P P PP Sbjct: 108 VKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 31.5 bits (68), Expect = 0.86 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 2/92 (2%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P P P P P P P PP PP P P PP PP Sbjct: 34 PSLAPAPAPYHHGHHHPHPPHHHHPHPHPHPHPPAKSPVKPP-VKAPVSPPAKPP-VKPP 91 Query: 850 XXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP P P P P PP Sbjct: 92 VYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 31.5 bits (68), Expect = 0.86 Identities = 26/107 (24%), Positives = 28/107 (26%), Gaps = 2/107 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P P P P P P PP P P P Sbjct: 50 PHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAP--VKPPTKPP 107 Query: 826 PPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP PP +P P PP + P Sbjct: 108 VKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKP 154 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +3 Query: 708 PPXXPPXXPPXXXX-PPPPXPPXXPGXXPXXXXP--XPXRXXXXXXPXPXXXPPXPPFPX 878 PP P PP PP PP P P P P + P PP P P Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKP-PV 124 Query: 879 XPP 887 PP Sbjct: 125 YPP 127 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/77 (23%), Positives = 18/77 (23%) Frame = +2 Query: 659 PXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXXX 838 P P P P PP P P PP P P Sbjct: 50 PHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVK 109 Query: 839 XPXXXXPXPPXSPPPXP 889 P PP PP P Sbjct: 110 PPVSPPAKPPVKPPVYP 126 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 45.2 bits (102), Expect = 7e-05 Identities = 29/86 (33%), Positives = 29/86 (33%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G G G GGG G G P GG G G G Sbjct: 111 GGSGSLPTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPAL------G 164 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG G GGGG G Sbjct: 165 GGAGAGSALGGGGAGAGPALGGGGAG 190 Score = 44.0 bits (99), Expect = 2e-04 Identities = 30/84 (35%), Positives = 30/84 (35%), Gaps = 1/84 (1%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G GGG G GGG G G P GG G G G GG Sbjct: 124 GAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSAL------GGGG 177 Query: 713 -GGGXGXGXGGXXXGGXGGGGGXG 645 G G G GG G GGG G Sbjct: 178 AGAGPALGGGGAGAGPALGGGVAG 201 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G G G G G G G G GP G P G G G Sbjct: 66 GAGSGSSGSGSTGSGLGAGTGSIPSSGSGP--GLLPTASSVPGSLAGGGSGSLPTTGSAT 123 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G GGG G G Sbjct: 124 GAGAGTGSALGGGPGAGSALGGGAGAG 150 Score = 38.7 bits (86), Expect = 0.006 Identities = 30/93 (32%), Positives = 31/93 (33%), Gaps = 3/93 (3%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G GGG G GGG G G GG G G GG Sbjct: 134 GGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAG-SALGGGGAGAGPAL-----GGG 187 Query: 713 GGGXGXGXGGXXXG---GXGGGGGXGXFXKIVF 624 G G G GG G GGG G +VF Sbjct: 188 GAGAGPALGGGVAGSGSALGGGASAGPDNTLVF 220 Score = 35.5 bits (78), Expect = 0.053 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G GGG G G G G P G G G G G G Sbjct: 106 GSLAGGGSGSLPTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGG 165 Query: 695 GXG-GXXXGGXGGGGG 651 G G G GG G G G Sbjct: 166 GAGAGSALGGGGAGAG 181 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = -1 Query: 845 GXXXGGGXG--PXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXG 672 G GGG G P G G G G G GGG G G GG Sbjct: 106 GSLAGGGSGSLPTTGSATGAGAGTGSALGGGPGAGS------ALGGGAGAGPALGGGAGA 159 Query: 671 GXGGGGGXG 645 G GGG G Sbjct: 160 GPALGGGAG 168 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/81 (24%), Positives = 20/81 (24%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G G G P G P G G G G Sbjct: 80 GLGAGTGSIPSSGSGPGLLPTASSVPGSLAGGGSGSLPTTGSATGAGAGTGSALGGGPGA 139 Query: 713 GGGXGXGXGGXXXGGXGGGGG 651 G G G G G G G G Sbjct: 140 GSALGGGAGAGPALGGGAGAG 160 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPR 777 G GG P G G G G G GG G G GP G G Sbjct: 138 GAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGG--GGAGAGPALGGGGAGAGPAL 195 Query: 776 XXGGXGRG 753 G G G Sbjct: 196 GGGVAGSG 203 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G G A G G G G GG G G G G G G Sbjct: 126 GAGTGSALGGGPGAGSALGGGAGAGPALG--GGAGAGPALGGGAGAGSALGGGGAGAGPA 183 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGG 669 GG G G GG G G GG G Sbjct: 184 LGGGGAGAGPAL-------GGGVAGSGSALGGGASAG 213 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 P PPP PP PP P P P PPP P P+ P +G Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQG 310 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PPXXXXPXXG-PXPPPXXXPPXXPPPPXFPXXXPXPP 897 PP P P PPP PP PPPP P P PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P PPP P PPPP P PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQP-PPPPKIARPPPAPP 301 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P PP PP PP P PPPP P P PP Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP P P P PPP P P P PP + PP P P PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQP---------PPPPPPKPQPPPPPKIARPP--PAPPK 302 Query: 835 XXXP 846 P Sbjct: 303 GAAP 306 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 PP PP PPPP P+P PP PP P P PP PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPP-------PQPPPP------PPPKPQP---PPPPKIARPP 297 Query: 850 XXPPPPXFP 876 PP P Sbjct: 298 PAPPKGAAP 306 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 829 PPXXXPPXXPPPPXFPXXXPXP-PXPXXXXGAGXXXPPRRXXPPP 960 PP PP PP P P P P P PP+ PPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXP---RPXPPXXRGXXP 792 PP PP PP P P PPP P P RP P +G P Sbjct: 259 PPGRSAPPP--PPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPP 869 P PP PPPP P P P P + P PP PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPP---PQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 732 PPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 PP P PP P P P P P P PP PP PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPP--------PPPKPQPPPPPKIARPP 297 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 44.8 bits (101), Expect = 9e-05 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P PPPP PP PP P P PP PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 44.8 bits (101), Expect = 9e-05 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P PPPP PP PP P P PP PP P Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP PP PPPP P P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 766 PPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF 873 PP PP P P PPP PP PPPP F Sbjct: 64 PPPPPPTSPPPPSPPP--PSPPPPSPPPPSPPPPAF 97 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PP PPPP P P PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXP 812 PP PP PP PPP PP P P P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSP---PPPSPPPP 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFP 876 PP P PPP PP PPPP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PPPPP P P P PPPP P P P PP Sbjct: 64 PPPPP------PTSPPPPSPPPPSP--PPPSPPPPSPPPP 95 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG 918 P P PP PP PPP P P PP P G Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSP-PPPSPPPPAFAVG 100 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPP 770 P PP PP P PPPP PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPP 770 P PP PP PP PPP PP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAG 924 P PP PP PPP P P P P G Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVG 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFP 876 PP P P PPP PP PPP P Sbjct: 67 PPPTSPPPPSP-PPPSPPPPSPPPPSPPP 94 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 44.8 bits (101), Expect = 9e-05 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P PPP P PP P P P PPPP P P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 622 INTIFXXXPXPPPPPXPPXXXPPXPXPXPPPP-PXPXXXXXXXXXPRPXPP 771 +N I PPPPP PP PP P PPPP P P P P PP Sbjct: 39 VNCIPCLQNQPPPPPSPP---PPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 646 PXPPPPPXPPXXX---PPXPXPXPPPPPXP 726 P PPPP PP PP P P PPPPP P Sbjct: 62 PSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXX 885 PPPPP P P P PP PP P PPP PP PPPP + Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPP------PPKKSSCPPSPLPPP---PP--PPPPNYVFTY 97 Query: 886 P 888 P Sbjct: 98 P 98 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFP 876 P PPP P P P P PP + PP P P PPP PP +P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSP-PPPKKSSCPPSPLPPP--PPPPPPNYVFTYPPGDLYP 104 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPPP P PP P PPP P P PP PP P Sbjct: 53 PSPPPPSCTPSPPPPSP---PPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXX----PPPPXFPXXXPXPP 897 PP P P PPP PP PP P P P PP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFP-XXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PPP P P PP P PP PPP Sbjct: 49 PPP---PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXP 812 P P P PP PP P PP P PP P P P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPP-PKKSSCPPSPLPPPPPPPPPNYVFTYP 98 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 769 PXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF----PXXXPXPPXP 903 P + PP P P P PP PPPP P P PP P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSP---PPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PP PP P PP P PPPP PP Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLP-PPPPPPPPNYVFTYPP 99 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/81 (33%), Positives = 31/81 (38%) Frame = +1 Query: 607 INLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGX 786 ++L I+ + P PPPPP P P PPP P P P PP R Sbjct: 1 MSLVDISGAYSLVPLPPPPP------PLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRR 54 Query: 787 XPPXXXXPXXGPXPPPXXXPP 849 PP P P P P PP Sbjct: 55 APPPPPPP---PLPRPCSRPP 72 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP--XXXPPXXPPPPXF 873 P PPPPP P P P PP R PP P PPP P PPPP Sbjct: 14 PLPPPPP-PLMRRRAPLPPPPPPPLMRRRAPP--------PPPPPLMRRRAPPPPPPPPL 64 Query: 874 PXXXPXPP 897 P PP Sbjct: 65 PRPCSRPP 72 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 5/69 (7%) Frame = +1 Query: 604 IINLKQINTIFXXXPXPPP-----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP 768 ++++ ++ P PPP P PP PP PPPP P P P P Sbjct: 3 LVDISGAYSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Query: 769 PXXRGXXPP 795 P R P Sbjct: 63 PLPRPCSRP 71 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP R P P P P P PPPP P PP P Sbjct: 16 PPPPPPLMRRRAP----LPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPP 61 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +1 Query: 820 PXPPPXXXP----PXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP P PPPP P PP P PP P P Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/91 (38%), Positives = 36/91 (39%), Gaps = 7/91 (7%) Frame = -1 Query: 896 GGXGXXXGKXGGG----GXXG-GXXXGGGXGPXXGXXXXGGXXPRXXGGX-GRGXXXXXX 735 GG G G+ GGG G G G G G G G R GG GRG Sbjct: 8 GGRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDRGRGYSGRGD 67 Query: 734 XXXGXGGGGGXGXGXGGXXXG-GXGGGGGXG 645 G GGGG G G G G G GGGG G Sbjct: 68 GR-GRGGGGDRGRGYSGRGDGHGRGGGGDRG 97 Score = 38.3 bits (85), Expect = 0.008 Identities = 32/96 (33%), Positives = 33/96 (34%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G RG G G G G+ GGGG G G G G G GG Sbjct: 23 GRGYSGRGDGRGRGGDGDRGYSGRGDGHGR-GGGGDRGRGYSGRGDGRGRG---GGGDRG 78 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXG 672 R G G G G GGGG G G G G Sbjct: 79 RGYSGRGDG--------HGRGGGGDRGRGYSGRGRG 106 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP PP P PPP P P P P P P P P Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPK 119 Query: 832 PXXXPPXXPPPPXFPXXXPXP 894 P PP PPP P P Sbjct: 120 PQLPPPSLFPPPSLVNQLPDP 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/80 (31%), Positives = 25/80 (31%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP PP P PPP P PP PP P P PP Sbjct: 43 PPATSPP--SPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPP--PSPPQ 98 Query: 835 XXXPPXXPPPPXFPXXXPXP 894 PP P P P P Sbjct: 99 PQPPPQSTPTGDSPVVIPFP 118 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/90 (28%), Positives = 29/90 (32%), Gaps = 1/90 (1%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF 873 P PP PP P + PP PP P P P P PP PP Sbjct: 44 PATSPPSPPSPDT--------QTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPS 95 Query: 874 PXXXPXPPXPXXXXGAGXXXP-PRRXXPPP 960 P PP + P P+ PPP Sbjct: 96 PPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/92 (28%), Positives = 27/92 (29%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 PP P PP P +P P PP P P PP PP P P Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPT--PPSSP-PPSITPPPSPPQP 99 Query: 865 PXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP Sbjct: 100 QPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPP 131 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 10/91 (10%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP----XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P P PP PP P P P P PP P+P P PP Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQL 137 Query: 814 XGPXP------PPXXXPPXXPPPPXFPXXXP 888 P P P P P PP P P Sbjct: 138 PDPRPNDNNILEPINNPISLPSPPSTPFSPP 168 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPP---XXPGXXPXXXXPXPXRXXXXXXPXPXXXPP 860 PP PP PP PPP PP P P P P P PP Sbjct: 78 PPPTPPSSPPPSIT-PPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPP 130 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/76 (23%), Positives = 18/76 (23%) Frame = +3 Query: 732 PPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXX 911 PP P PP P P P P P PP PP P Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Query: 912 XGXGXXXXXPAXAPPP 959 P P P Sbjct: 103 PQSTPTGDSPVVIPFP 118 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 35/106 (33%), Positives = 35/106 (33%), Gaps = 2/106 (1%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXX-GGGXGPXXGXXXXGGXXP 780 GG GG GG G G GG GG GGG G G GG Sbjct: 47 GGAAGIGGAGGVGAGLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSG 106 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG-XXXGGXGGGGGXG 645 G G G G GG G G GG GG GGG G Sbjct: 107 LGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGGLGGIGGGSDCG 152 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G G GG GG GGGGG G Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGGGGHG 39 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG GGG G G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGG 35 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 G G G G GGG GG GGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G G GG GG GGGGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWG 94 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXG-GXGGGGGXGXFXK 633 GG G G GGGGG G G GG G G GGGGG G + K Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYK 106 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRG 753 G GG G G GGGG GG GGG G GG GG G+G Sbjct: 68 GWGGGGGGGG--GGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRG 753 G GG G G GGGG GG GGG G G + G GRG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G GGGG GG GGG G G GG GG G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGG----GGGWGWGGGGGGGGWYKWGC------ 109 Query: 716 GGGGXGXGXGG 684 GGGG G G G Sbjct: 110 GGGGKGKGREG 120 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXG-GG 657 GG G GG GG G G G GGGGG G G GG G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG-GWYKWGCGGGGKGKGR 118 Query: 656 GGXGXFXK 633 G G F K Sbjct: 119 EGRGEFVK 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 GGG GG G GG G G GGGG GGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGG-GGGGGWYKWGCGGGGKG 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG G GG G G GGGG GGG G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG-GKGKGREGRGEFVK 126 Query: 779 RXXGG-XGRG 753 R GRG Sbjct: 127 REYAECKGRG 136 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 2/84 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PP P PPPP P P P PP PP GP PP Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGP-PRPP------PPAPPPGSGGPKPP 403 Query: 832 PXXXP--PXXPPPPXFPXXXPXPP 897 P P P PPP P PP Sbjct: 404 PPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +1 Query: 646 PXPPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP PP P P P P P P PP G PP P Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Query: 817 GPXPPPXXXPPXXPPPPXFP 876 PPP P P PP P Sbjct: 411 PRPPPPMSLGPKAPRPPSGP 430 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPX 879 P PP PP P PP P P P PP PPPP P Sbjct: 351 PLPPEPPK-FLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP- 408 Query: 880 XXPXPPXP 903 P PP P Sbjct: 409 KGPRPPPP 416 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 4/80 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP----PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P P P P PP P P PPP P P PRP PP G P P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPPPMSLG---PKAPRPP 427 Query: 814 XGPXPPPXXXPPXXPPPPXF 873 GP P P F Sbjct: 428 SGPADALDDDAPKTKLKPFF 447 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/90 (24%), Positives = 24/90 (26%) Frame = +3 Query: 618 TNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXX 797 + K + K P P PP P P PP P PP P Sbjct: 341 SGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGP 400 Query: 798 XXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P P P P Sbjct: 401 KPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFP-XXXPXPPXPXXXXGAGXXXP----PRRXXPP 957 P P P PP PPP P P PP P G P P+ PP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P R PP P P PP PPP Sbjct: 148 PSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 844 PPXXPPPPXFPXXX--PXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P P P PP P G+G PP PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPP----PPP 406 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP---PPPXP 726 PP PP P PP PP PPP P Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 2/84 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PP P PPPP P P P PP PP GP PP Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGP-PRPP------PPAPPPGSGGPKPP 403 Query: 832 PXXXP--PXXPPPPXFPXXXPXPP 897 P P P PPP P PP Sbjct: 404 PPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +1 Query: 646 PXPPPPPX---PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP PP P P P P P P PP G PP P Sbjct: 351 PLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Query: 817 GPXPPPXXXPPXXPPPPXFP 876 PPP P P PP P Sbjct: 411 PRPPPPMSLGPKAPRPPSGP 430 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPX 879 P PP PP P PP P P P PP PPPP P Sbjct: 351 PLPPEPPK-FLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP- 408 Query: 880 XXPXPPXP 903 P PP P Sbjct: 409 KGPRPPPP 416 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 4/80 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP----PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P P P P PP P P PPP P P PRP PP G P P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPPPMSLG---PKAPRPP 427 Query: 814 XGPXPPPXXXPPXXPPPPXF 873 GP P P F Sbjct: 428 SGPADALDDDAPKTKLKPFF 447 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/90 (24%), Positives = 24/90 (26%) Frame = +3 Query: 618 TNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXX 797 + K + K P P PP P P PP P PP P Sbjct: 341 SGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGP 400 Query: 798 XXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P P P P Sbjct: 401 KPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFP-XXXPXPPXPXXXXGAGXXXP----PRRXXPP 957 P P P PP PPP P P PP P G P P+ PP Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P R PP P P PP PPP Sbjct: 148 PSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 844 PPXXPPPPXFPXXX--PXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P P P P PP P G+G PP PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPP----PPP 406 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP---PPPXP 726 PP PP P PP PP PPP P Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/86 (34%), Positives = 31/86 (36%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPP PP P P PP P P P PP + PP P P Sbjct: 112 PSDPPPLGPPQTPGPE-FPVPPSPSPP-------MPDTPNPPTPK--TPPDVVPPIWEPP 161 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP PPP P P P P Sbjct: 162 RPPDIFPPESPPPGIDP---PPPLGP 184 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 2/86 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P PP P P P P P P PP PP P P Sbjct: 105 PPEVTTVPSDPPPLGPPQTPGPEFPVP-------PSPSPPMPDTPNPPTPKTPP--DVVP 155 Query: 832 PXXXPPXXPP--PPXFPXXXPXPPXP 903 P PP P PP P PP P Sbjct: 156 PIWEPPRPPDIFPPESPPPGIDPPPP 181 Score = 34.7 bits (76), Expect = 0.093 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +3 Query: 666 PXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG-XXPXXXXPXPXRXXXXXXPX 842 P P P PP PPP PP PG P P P P Sbjct: 87 PLEVPELPNIPEISPSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPT 146 Query: 843 PXXXPP-XPPF--PXXPPXXXXP 902 P P PP P PP P Sbjct: 147 PKTPPDVVPPIWEPPRPPDIFPP 169 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P PP P PP P P P P P P P PP Sbjct: 97 PEISPSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPP 156 Query: 888 XXXXPXXXXGXGXXXXXPAXAPPP 959 P P PPP Sbjct: 157 IWEPPRPPDIFPPESPPPGIDPPP 180 Score = 31.9 bits (69), Expect = 0.65 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P PP P PP P P PP P P P P Sbjct: 94 PNIPEISPSETPPEVTTVPSDPP-PLGPPQTPGPEFPVPPSPSPPMPDTPNPPT--PKTP 150 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXP 903 P PP PP P P P Sbjct: 151 PDVVPPIWEPPRP-PDIFPPESPP 173 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP-XXPPPPXF--PXXXPXPPXPXXXXGAG 924 P PP +G PP P G PPP PP PPPP P P P P G G Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPGFGGG 85 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +1 Query: 781 GXXPPXXXXPXXGPXPPPXXXPP-XXPPPPXFPXXXPXPPXPXXXXGAGXXXP 936 G P P G PPP PP PPPP PP P AG P Sbjct: 23 GYPPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGP 75 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 709 PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 PPPP P+ PP G PP P G PP P P P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGY-PPAAYPPPPGAYPPAGYPGPSGPRP 80 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 709 PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFP 876 PP P P PP +G PP P PPP PP P P P Sbjct: 25 PPGAYPPPPQGAYPPPGGYPP--QGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPP 860 PP PP PP PP G P P P P P P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP---PPP---XPXXXXXXXXXPRP 762 PPP PP PP P PP PPP P PRP Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -1 Query: 887 GXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGG 711 G G+ G G G G G P G G R G GRG G G G Sbjct: 28 GNMPGESGSGRGPNWEYNWGWGSAPGSGWGYGAGSG-RSPTGWGRGSGYGYGSGSGSGTG 86 Query: 710 GGXGXGXGGXXXGGXGGGGGXG 645 G G G GG GG G G G G Sbjct: 87 YGYGSGGGGARGGGYGYGSGNG 108 Score = 41.5 bits (93), Expect = 8e-04 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 3/87 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXG-GXGRGXXXXXXXXX 726 G G G G G G G G G G G G G Sbjct: 32 GESGSGRGPNWEYNWGWGSAPGSGWGYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYGYGS 91 Query: 725 GXGG--GGGXGXGXGGXXXGGXGGGGG 651 G GG GGG G G G GG GGGGG Sbjct: 92 GGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -1 Query: 845 GXXXGGGXGPXXGXXXXGGXXPRXXG-GXGRGXXXXXXXXXGXGGGGGXGXGXG-GXXXG 672 G G G G G R G G G G G GGGG G G G G G Sbjct: 49 GSAPGSGWGYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNG 108 Query: 671 GXGGGGGXGXF 639 GGGGG G F Sbjct: 109 RSGGGGGGGGF 119 Score = 35.1 bits (77), Expect = 0.070 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G G G G G G G G G GG RG G G Sbjct: 53 GSGWGYGA-GSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSG 111 Query: 713 GGGXGXGXGG 684 GGG G G G Sbjct: 112 GGGGGGGFNG 121 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP---XX 816 P PPP P PP P PPPP P P P PP Sbjct: 51 PADLPPPPTPVYSPP-PADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRK 109 Query: 817 GPXPPPXXXPPXXPPPPXFP 876 P PPP PPPP P Sbjct: 110 SPPPPPSKYGKVYPPPPAKP 129 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/102 (26%), Positives = 28/102 (27%), Gaps = 4/102 (3%) Frame = +1 Query: 610 NLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX 789 N K + T P P P P P P PP P P P Sbjct: 26 NRKLLYTYNNYQPQHSPLPSPVYSSPADLPP-PPTPVYSPPPADLPPPPTPYYSPPADLP 84 Query: 790 PPXXXXPXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXP 903 PP P PPP PPPP PP P Sbjct: 85 PPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPPP 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P P PPP P P PP PP PP Sbjct: 38 PQHSPLPSPVYSSPADLPPPPTPVYSP-PPADLPPPPTPYYSPPADLPPP 86 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/79 (24%), Positives = 19/79 (24%) Frame = +3 Query: 666 PXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P P PP P P PP PP P P P P Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKS 110 Query: 846 XXXPPXPPFPXXPPXXXXP 902 PP PP P Sbjct: 111 PPPPPSKYGKVYPPPPAKP 129 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -1 Query: 833 GGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GGG G GG R G G G G GGGGG G G G GG GGG Sbjct: 558 GGGKNRRSGGRF-GGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGY 616 Query: 653 G 651 G Sbjct: 617 G 617 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = -1 Query: 959 GGGXXRR-GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG RR GG G G G GGGG GG GGG G G GG Sbjct: 558 GGGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYG 617 Query: 782 PRXXGGXG 759 GG G Sbjct: 618 GASSGGYG 625 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/105 (29%), Positives = 31/105 (29%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG G G G G GG G G GG G G GG Sbjct: 221 GVGIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGI 280 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G G G G G G G G Sbjct: 281 GIGEGIGSGSAQPNCGPVTGAPGSGFGEGIGQGSGPGEGIGIGIG 325 Score = 37.5 bits (83), Expect = 0.013 Identities = 28/86 (32%), Positives = 28/86 (32%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G G G GG G G G G G G G G Sbjct: 210 GYGSGGSGVGYGVGIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGS------S 263 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G GG G G G G G Sbjct: 264 GGSGFGEGIGSGGGTGIGIGEGIGSG 289 Score = 35.1 bits (77), Expect = 0.070 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G G G G G G G G G G G G G G G G Sbjct: 206 GVGRGYGSGGSGVGYGVGIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGG 265 Query: 686 GXXXGGXGGGGGXG 645 G G GGG G Sbjct: 266 SGFGEGIGSGGGTG 279 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 8/91 (8%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G GG G G GG G G GG G G G G Sbjct: 219 GYGVGIGSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGT 278 Query: 713 GGGXGXGXG--------GXXXGGXGGGGGXG 645 G G G G G G G G G G G Sbjct: 279 GIGIGEGIGSGSAQPNCGPVTGAPGSGFGEG 309 Score = 32.3 bits (70), Expect = 0.49 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 1/84 (1%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXG-GXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 G G G G G G G GG G G GG G G G G Sbjct: 206 GVGRGYGSGGSGVGYGVGIGSSGGSGFGEGIGSSGG------NGFGEGI--------GSS 251 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G G G G G G G Sbjct: 252 GGSGFGEGIGSSGGSGFGEGIGSG 275 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXP 780 G G GG G G G G GG G G G G G Sbjct: 245 GEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIGSGSAQPNCGPVTGAPGS 304 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGG 708 G G+G G G GG Sbjct: 305 GFGEGIGQGSGPGEGIGIGIGQGG 328 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 4/100 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP--X 825 PPP PP P P PPP P P P G PP P P Sbjct: 101 PPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPP--GLLPPITTPPGLLPPVT 158 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPP 939 PP PP PP P PP P G PP Sbjct: 159 TPPGLLPPVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPP 198 Score = 41.5 bits (93), Expect = 8e-04 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 3/94 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPX---PXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPP PP PP P PP P P PP G PP P G Sbjct: 119 PPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPP---GLLPPVTTPP--GL 173 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAG 924 PP PP PPP PP G G Sbjct: 174 LPPIINPPPVTVPPPSSGYPPYGPPSGGGGGGGG 207 Score = 33.1 bits (72), Expect = 0.28 Identities = 28/103 (27%), Positives = 28/103 (27%), Gaps = 2/103 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP--P 831 PP P P P PPP P PP PP P P P Sbjct: 89 PPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPI---IIPPIQPPPVTTPPGLLP 145 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PP P P PP PPP Sbjct: 146 PITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPP 188 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 P GG G G G GGG G G GGGGG G Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGG 85 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +1 Query: 757 RPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP 936 RP PP + P G PPP PP PP G G P Sbjct: 32 RPHPPVPK--PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSP 89 Query: 937 PRRXXPP 957 P PP Sbjct: 90 PVVRPPP 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 11/92 (11%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPP---------PXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 PP P PP PPP P P G PP Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRP 94 Query: 808 PXXGPXPPPXXXPP--XXPPPPXFPXXXPXPP 897 P PPP PP PPP P PP Sbjct: 95 PPVVVRPPPIIRPPPVVYPPPIVRPPPITRPP 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG-GXXGGXXXGGGXGP 816 GGG GG P P GG G GGG GG GGG P Sbjct: 44 GGGG---GGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSP 89 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 5/87 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPP PP P P PP PP P PP PP Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPP 109 Query: 832 PXXXP-PXXPPP----PXFPXXXPXPP 897 P P PPP P FP PP Sbjct: 110 PYSGNYPTPPPPNPIVPYFPFYYHTPP 136 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P PP PP P PPPP PP G P P P Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPP 97 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFP--XXXPXPPXPXXXXGAGXXXPP 939 P PP PPPP P P P P G+ PP Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPP 84 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 42.3 bits (95), Expect = 5e-04 Identities = 30/98 (30%), Positives = 31/98 (31%), Gaps = 6/98 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP P PP P PPP P P PP Sbjct: 45 PSPPPPPSNPSPPPPSPTTTACPPP-PSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYY 103 Query: 826 PPPXXXP--PXXPPP----PXFPXXXPXPPXPXXXXGA 921 PPP P PPP P FP PP G+ Sbjct: 104 PPPKSGGNYPYTPPPNPIVPYFPFYYYNPPPQSVMSGS 141 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP----PXXXXPXXGPXP 828 P P PP P PPPP P P PP G P P P Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTAC------PPPPSSSGGGPYYYYPPASQSGSYRPP 93 Query: 829 PPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP P P P Sbjct: 94 PSSSSGGYYYPPPKSGGNYPYTPPP 118 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 42.3 bits (95), Expect = 5e-04 Identities = 33/114 (28%), Positives = 33/114 (28%), Gaps = 11/114 (9%) Frame = +1 Query: 652 PPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P PP P P PP P P P G P Sbjct: 176 PPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYS 235 Query: 817 GPXPPPXXXPP-----XXPPPPXFPXXXPXPP-XPXXXXGAGXXXPPRRXXPPP 960 P PPP P PPPP P PP P PP PP Sbjct: 236 SPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPP 289 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/121 (25%), Positives = 34/121 (28%), Gaps = 11/121 (9%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP-- 795 ++ P PP P P PP P PPP P P PP PP Sbjct: 233 VYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPS 292 Query: 796 -XXXXPXXGPXPPPXXXPPXXPPPPXFPXXXP-----XPPXPXXXXGAGXXXPPRRXXPP 957 P PP PPPP + P PP P PP Sbjct: 293 YYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPP 352 Query: 958 P 960 P Sbjct: 353 P 353 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/95 (30%), Positives = 31/95 (32%), Gaps = 7/95 (7%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPP- 795 I+ P PP P P PP P PPP P + P PP PP Sbjct: 155 IYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPP 214 Query: 796 --XXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXP 894 P G PP PPPP P P P Sbjct: 215 PYYSPSPKVGYKSPPAPYVYSSPPPP--PYYSPSP 247 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/94 (30%), Positives = 29/94 (30%), Gaps = 12/94 (12%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P P P P PPPP P PP PP Sbjct: 288 PPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLPPPYV-- 345 Query: 811 XXGPXPPPXXXPP-----XXPPPPXFPXXXPXPP 897 P PPP P PPPP P PP Sbjct: 346 YNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPP 379 Score = 35.9 bits (79), Expect = 0.040 Identities = 29/104 (27%), Positives = 30/104 (28%), Gaps = 3/104 (2%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P P PP P PPP P + PP PP P P P Sbjct: 141 PSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP--PPPYYSPSPKVE 198 Query: 838 XXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR---RXXPPP 960 PPPP P PP G PP PPP Sbjct: 199 Y---KSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPP 239 Score = 35.9 bits (79), Expect = 0.040 Identities = 28/102 (27%), Positives = 31/102 (30%), Gaps = 13/102 (12%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPX 798 ++ P PP P P PP P PPP P + P PP PP Sbjct: 207 VYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPP 266 Query: 799 XXXP-----XXGPXPPPXXXPPXXP----PPPXFPXXXPXPP 897 P P PP P P P P P PP Sbjct: 267 PYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPP 308 Score = 33.1 bits (72), Expect = 0.28 Identities = 31/115 (26%), Positives = 31/115 (26%), Gaps = 13/115 (11%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP PP P P P PP P P P P Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYS 209 Query: 817 GPXPPPXXXPP-----XXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P PPP P PP P P PP P PP PP Sbjct: 210 FPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPP 264 Score = 32.3 bits (70), Expect = 0.49 Identities = 27/102 (26%), Positives = 31/102 (30%), Gaps = 6/102 (5%) Frame = +3 Query: 600 VNYKSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXX-----PPXXXXPPPPX 764 ++YKS Y + PP P P PP PP PP PPP Sbjct: 300 IDYKSPPPPYVYSS-----PPPPTYYSPSPRVDYKSPP--PPYVYNSLPPPYVYNSPPPP 352 Query: 765 PPXXPGXXPXXXXPXPXRXXXXXXPXPXXXP-PXPPFPXXPP 887 P P P P P P P P + PP Sbjct: 353 PYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPP 394 Score = 32.3 bits (70), Expect = 0.49 Identities = 27/92 (29%), Positives = 29/92 (31%), Gaps = 3/92 (3%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 ++ P PP P P PP P PPP P P P PP Sbjct: 345 VYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYY--------SPFPKVEYKSPPP-- 394 Query: 802 XXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PP P P P PP Sbjct: 395 --PYIYNSPPP---PPYYSPSPKITYKSPPPP 421 Score = 31.5 bits (68), Expect = 0.86 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 9/87 (10%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP-----PXXXXPXXGPXP 828 P PP P PPPPP P P P P P P P Sbjct: 41 PYPPKNYSPYLSESPPPPPPQYRRQEPKYTPHPEPNVYDSPTPLPYYFPFPKLDIKSPPP 100 Query: 829 PP--XXXPP--XXPPPPXFPXXXPXPP 897 P PP P P P PP Sbjct: 101 PSVYTFSPPQLYYSPSPKVEYKSPPPP 127 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 42.3 bits (95), Expect = 5e-04 Identities = 33/113 (29%), Positives = 33/113 (29%), Gaps = 9/113 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-- 819 P PPPP PP PP PP P P PP P G Sbjct: 92 PSPPPPTSNESPSPPEDSETPPAPPNESNDN------NPPPSQDLQSPPPSSPSPNVGPT 145 Query: 820 -PXPPPXXXPPXXP------PPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P PP PP P PP P PP P G P PP Sbjct: 146 NPESPPLQSPPAPPASDPTNSPPASPLDPTNPP-PIQPSGPATSPPANPNAPP 197 Score = 37.5 bits (83), Expect = 0.013 Identities = 29/106 (27%), Positives = 30/106 (28%), Gaps = 4/106 (3%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P PP PP P P PP P P Sbjct: 55 PSTPPPDSQLPPLPSILPPLTDSPP-PPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPP 113 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG-AGXXXPPRRXXPPP 960 PP PPP P P P G PP + P P Sbjct: 114 APPNESNDNNPPPSQ-DLQSPPPSSPSPNVGPTNPESPPLQSPPAP 158 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/94 (28%), Positives = 28/94 (29%), Gaps = 10/94 (10%) Frame = +1 Query: 646 PXPPPPPXPPXXXP------PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX 807 P PP PP P P PP PP P PP + P Sbjct: 13 PAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILP 72 Query: 808 PXX-GPXPPPXXXPP---XXPPPPXFPXXXPXPP 897 P P PP PP PPP P PP Sbjct: 73 PLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPP 106 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/99 (24%), Positives = 25/99 (25%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP PP P P P P P P PP P P Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAP-PASDPTNSPPASPLDPTNPPPIQP 182 Query: 838 XXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXP 954 P PP P P P +G P P Sbjct: 183 SGPATSPPANPNAPPSPFPTVPPKTPSSGPVVSPSLTSP 221 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 2/93 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP- 828 P P PP PP P P P P P P P PP P P Sbjct: 144 PTNPESPPLQSPPAP-PASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPT 202 Query: 829 -PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAG 924 PP P P P G G Sbjct: 203 VPPKTPSSGPVVSPSLTSPSKGTPTPNQGNGDG 235 Score = 32.3 bits (70), Expect = 0.49 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 8/108 (7%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP---XXXXPXXGPXP 828 P PP PP PP P P PP PP P P Sbjct: 8 PSSSPPA--PPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLP 65 Query: 829 P-PXXXPP--XXPPPP--XFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P PP PPPP P P P P PP Sbjct: 66 PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPP 113 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPP P P PP P P P PP GP P Sbjct: 133 PPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP---IQPSGPATSP 189 Query: 835 XXXPPXXPPPPXFPXXXPXPP 897 P PP FP P P Sbjct: 190 PANP--NAPPSPFPTVPPKTP 208 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 7/90 (7%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXP---XPXXXPP---XPPF 872 P P PP PPP P P P P P PP PP Sbjct: 8 PSSSPPAPPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPL 67 Query: 873 P-XXPPXXXXPXXXXGXGXXXXXPAXAPPP 959 P PP P PPP Sbjct: 68 PSILPPLTDSPPPPSDSSPPVDSTPSPPPP 97 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 41.9 bits (94), Expect = 6e-04 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 7/89 (7%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPP-PPXPXXXXXXXXXPRPXPPXX---RGXXPPXXXX---P 810 PP PP PP P PP P P P PP RG PP P Sbjct: 162 PPQPPFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPP 221 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 PPP P PP P P P PP Sbjct: 222 SRPGMPPPGGAPMFAPPHPGMP---PAPP 247 Score = 35.9 bits (79), Expect = 0.040 Identities = 30/101 (29%), Positives = 30/101 (29%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP PP PPPP P P PP G P P G P Sbjct: 157 PPGQMPPQ--PPFAGQGGPPPPY----GMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGP 210 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PPP P P GA PP PP Sbjct: 211 PPPHGMQGPPPSRPGMPP-------PGGAPMFAPPHPGMPP 244 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPP P PP P P PP Sbjct: 224 PGMPPPGGAPMFAPPHPGMPPAPP 247 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 41.9 bits (94), Expect = 6e-04 Identities = 30/108 (27%), Positives = 31/108 (28%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP--XPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P P P P PP PPP P P P PP P Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 820 PXP-PPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P P P P PP P + PP PP Sbjct: 65 PPPSPPGSLTPPLPQPSPSAPITPSPPSPTTP--SNPRSPPSPNQGPP 110 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 5/87 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPP P PP P P PP P+P P PP P P Sbjct: 43 PPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSP 102 Query: 829 P-PXXXPPXXP--PPPXFP-XXXPXPP 897 P P PP P P P P PP Sbjct: 103 PSPNQGPPNTPSGSTPRTPSNTKPSPP 129 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPP 720 PPP PP PP P PPPPP Sbjct: 217 PPPKPPS--PPRKPPPPPPPP 235 Score = 32.7 bits (71), Expect = 0.37 Identities = 29/103 (28%), Positives = 30/103 (29%), Gaps = 2/103 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PPP PP P P P P P PP PP P P P Sbjct: 34 PPPTTTPSSPP-PSPSTNSTSPPPSSPLPPSLPPPSPPG--SLTPP---LPQPSPSAPIT 87 Query: 838 XXPPXXPPPPXFPXXXPXP--PXPXXXXGAGXXXPPRRXXPPP 960 PP P P P P P P G+ P PP Sbjct: 88 PSPP-SPTTPSNPRSPPSPNQGPPNTPSGSTPRTPSNTKPSPP 129 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/74 (25%), Positives = 19/74 (25%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P PP P PP P P P P P R P P Sbjct: 56 PSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTPSG 115 Query: 826 PPPXXXPPXXPPPP 867 P P PP Sbjct: 116 STPRTPSNTKPSPP 129 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP 717 PPP P P PP P PPPP Sbjct: 217 PPPKPPSPPRKPP---PPPPPP 235 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXP 726 PP P P PPPPP P Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 41.5 bits (93), Expect = 8e-04 Identities = 27/97 (27%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = +1 Query: 607 INLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGX 786 + L Q+ F P PP PP P PPP P P P Sbjct: 281 LQLPQLPNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQ 340 Query: 787 XPPXXXXP-XXGPXPPPXXXPPXXPPPPXFPXXXPXP 894 PP P P PP P PP P P P Sbjct: 341 PPPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHPPP 377 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 4/87 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPP P PP P PP P P P G P P P Sbjct: 306 PPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPP 365 Query: 829 PPXXXPPXXPPPPXFP--XXXPXPPXP 903 P PP PPP P PP P Sbjct: 366 NPPRQPPSHPPPGSAPSQQYYNAPPTP 392 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/88 (29%), Positives = 28/88 (31%), Gaps = 4/88 (4%) Frame = +1 Query: 646 PXPPPPPXP----PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PPPP P PP P P P P P PP + PP Sbjct: 313 PYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPE-EPPYPQQSYPPNP---- 367 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P + P PP Sbjct: 368 --PRQPPSHPPPGSAPSQQYYNAPPTPP 393 Score = 31.5 bits (68), Expect = 0.86 Identities = 25/105 (23%), Positives = 26/105 (24%), Gaps = 5/105 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP-----PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 P PP P PP PP P P P Sbjct: 244 PQPPASAAAPPSLTQQGLPPQQFIQPPASQHGLSPPSLQLPQLPNQFSPQQEPYFPPSGQ 303 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXP 954 PPP PP PPPP P P PP+ P Sbjct: 304 SQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHP 348 Score = 30.7 bits (66), Expect = 1.5 Identities = 32/122 (26%), Positives = 35/122 (28%), Gaps = 18/122 (14%) Frame = +1 Query: 646 PXPP-----PPPXPPXXXPPXPXPXPP-------PPPXPXXXXXXXXXPRPXP--PXXRG 783 P PP PP PP PP PP P+ P P Sbjct: 244 PQPPASAAAPPSLTQQGLPPQQFIQPPASQHGLSPPSLQLPQLPNQFSPQQEPYFPPSGQ 303 Query: 784 XXPPXXXXPXXGPXPP--PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP--PRRXX 951 PP P P PP PP PPP PP G P P++ Sbjct: 304 SQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSY 363 Query: 952 PP 957 PP Sbjct: 364 PP 365 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 41.5 bits (93), Expect = 8e-04 Identities = 29/97 (29%), Positives = 29/97 (29%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P PP P P P P P P PP PP P PP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHS--PP----PLSQSLSPPPLITV 92 Query: 850 XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPPP F PP P G PP PP Sbjct: 93 IHPPPPRFYYFESTPPPPPLSPD-GKGSPPSVPSSPP 128 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = +1 Query: 628 TIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX--PPXX 801 TI P P P P P P PPPP P PP PP Sbjct: 40 TICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPR 99 Query: 802 XXPXXGPXPPPXXXPPXXPPPPXFPXXXPXP 894 PPP P PP P P P Sbjct: 100 FYYFESTPPPPPLSPDGKGSPPSVPSSPPSP 130 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P PP PPP PP PPP P P P +G P P Sbjct: 69 PPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSP- 127 Query: 814 XGPXPPPXXXPPXXPPPPXFP 876 P P PP P FP Sbjct: 128 --PSPKGQSQGQQQPPYP-FP 145 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 41.5 bits (93), Expect = 8e-04 Identities = 28/105 (26%), Positives = 29/105 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P PP PP P Sbjct: 70 PNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSP----- 124 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP P PP P + PP P Sbjct: 125 PPPDLDTTTAPPPPSTDIPIP-PPPPAPVSASPPLTPPSSVVTSP 168 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PPPP PP P P P P PP P P P PP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 37.1 bits (82), Expect = 0.017 Identities = 29/103 (28%), Positives = 30/103 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP P P P P P PP R G PP Sbjct: 90 PPPLPENRAATAGQP-PSPSPDNHRHHRRTTTAAVAGQPPHHRRTTAAAGTTTIAGQPPP 148 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP PPP P PP P + PP PPP Sbjct: 149 PESPPPESLPPP--SPESPSPPSPEPPPPSSLEPPP----PPP 185 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P P P PP PP P PPPP P Sbjct: 159 PPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP 768 P P PPP PP P PPPPP P P P P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P PPPPP PP P PPPP P P P PP Sbjct: 241 PTPPPPPPPPI---PVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 PPPP PP P P PPPPP + PP RG Sbjct: 259 PPPPPPPKLKNNGPSP-PPPPPLKKTAALSSSASKKPPPAPRG 300 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPP 869 PP PP PPPP PP P P P + PP P Sbjct: 245 PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP PP P P PP P G PP PPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPP----PPP 279 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +1 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P P P PPPP P PP P PPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPP 296 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 P P PPPPP P P P PP + P P PPP Sbjct: 239 PDPTPPPPPPPPIP--VKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPP 296 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Frame = +1 Query: 652 PPPPPXP---------PXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 PPPPP P P PP PPPPP P P P PP RG Sbjct: 233 PPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 285 Score = 41.1 bits (92), Expect = 0.001 Identities = 33/103 (32%), Positives = 33/103 (32%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP PP P PP P P PP PP P Sbjct: 194 PPPPP------PPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPP---PPLPMAVRK 244 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPP P PP P G G PP PPP Sbjct: 245 GVAAPPL--PPPGTAALPPPPPLP-MAAGKGVAAPP---PPPP 281 Score = 36.3 bits (80), Expect = 0.030 Identities = 32/104 (30%), Positives = 32/104 (30%), Gaps = 11/104 (10%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP---XX 816 P PPP PP P PP P P PP R PP P Sbjct: 194 PPPPP--------PPGNAAIPVEPPLTMSAEKESYAPLP-PPPGRAALPPPPPLPMAVRK 244 Query: 817 GPXPPPXXXP--PXXPPPPXFP------XXXPXPPXPXXXXGAG 924 G PP P PPPP P P PP P G G Sbjct: 245 GVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARGGLG 288 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP----XPPPPPXP 726 P PPPPP PP P P P PPPPP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPX-----PXPPPPPXP 726 P PPPPP P PP P P PPPPP P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXX 885 P PPP R PP + PP P PPP P PPPP Sbjct: 283 PKPPPKRSISLGDSTENRADPPPQKSIPPPPP------PPPPPLLQQP--PPPPSVSKAP 334 Query: 886 PXPPXP 903 P PP P Sbjct: 335 PPPPPP 340 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +1 Query: 646 PXPPP----PPXPPXXXPPXPXPXPPPPP 720 P PPP PP PP P P PPPPP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PP PP PP P PPP P P P PP Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PPP P PP P P PP P P P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP P PPPP P PP P PP PPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP----SVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 P P P P P PP PPP PP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P P PPP PP PP PP Sbjct: 27 PLPLPPPPPPPLKPPSSGSATTKPP 51 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXP 806 P PP PP P PPPP P P P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 27.9 bits (59), Expect(2) = 1.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 688 PXPXPXPPPPPXP 726 P P P PPPPP P Sbjct: 25 PSPLPLPPPPPPP 37 Score = 21.4 bits (43), Expect(2) = 1.4 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PPP PP P P P Sbjct: 32 PPPPPPLKPPSSGSATTKPPINPSKP 57 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 PP P P PPPPP P P PP G PP PP PPP Sbjct: 68 PPSPSPPPPPPPRP-----------PPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Query: 865 P 867 P Sbjct: 117 P 117 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP P PP PP P P P P PP PP P P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPP------PPPPPPPPPPPSSTW 121 Query: 835 XXXPPXXPPPP 867 P PPPP Sbjct: 122 DFWDPFIPPPP 132 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 625 NTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPP 720 +++ P PPPPP PP P PPPP Sbjct: 101 SSVLPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP PP PPPP P PP PPP Sbjct: 69 PSPSPPPPP---PPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXP 866 P PP P PP PP PP PG P P PP P Sbjct: 61 PLHLHHNPPSPSPPPPPPPR---PPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +1 Query: 652 PPPPPXPPXXX--PPXPXPXPPPPP 720 PPPPP PP PP P P PPPPP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 793 PXXXXPXXGPXPPPXXX--PPXXPPPPXFPXXXPXPP 897 P P P PPP PP PPPP P P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P P PPPPP P P P PP + P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP----XPXPXPPPPPXP 726 P PP PP P P P PPPPP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP PPPP P PP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPP 29 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP-XPXP 708 P PPPPP PP P P P P Sbjct: 24 PLPPPPPPPPPQLPFGPKLPFP 45 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 769 PXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P R PP P PP PP PPPP P P P P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPP--PPPPQLP-FGPKLPFP 45 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 647 PXXPPXPXXXXXXPXXPXPXPPXXPXXP 730 P PP P P P P PP P P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPPQLP 37 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 2/88 (2%) Frame = +1 Query: 646 PXPPPPPX-PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PP P PP P P P P P P P PP P P Sbjct: 149 PKPPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPP 208 Query: 823 XPPPXXXPPXXPPPP-XFPXXXPXPPXP 903 P PP PP P PP P Sbjct: 209 LVPVINLPPVTSPPQFKLPPLPQIPPMP 236 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/84 (26%), Positives = 22/84 (26%), Gaps = 2/84 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPP--XXXXPPPPXPPXXPGXXPXXXXPXPXRXXXX 830 P P P PP P PP P P P P P P P Sbjct: 141 PVQPSSFCPKPPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISP--DPPATLPPPKVPVIS 198 Query: 831 XXPXPXXXPPXPPFPXXPPXXXXP 902 P PP P PP P Sbjct: 199 PDPPTTLPPPLVPVINLPPVTSPP 222 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 6/105 (5%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX----GPXPP 831 P P PP PPPP P P PP + PP P PP Sbjct: 6 PPPQYLRPPS---GPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPP 62 Query: 832 PXXXPPXXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P +P P P P PPP Sbjct: 63 PPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPP 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 9/81 (11%) Frame = +1 Query: 646 PXPPPPPXPP-------XXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXPPX 798 P PPPP P PP P P P PP P P PP PP Sbjct: 14 PSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPS 73 Query: 799 XXXPXXGPXPPPXXXPPXXPP 861 P P P PP PP Sbjct: 74 PHYPQGQPYSSP-AYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP-XPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPPPP PP PP P P P P P PP G Sbjct: 59 PSPPPPP-PPQWGPPSPHYPQGQPYSSP-------AYPPHQPPFNAGAN-------GNSQ 103 Query: 823 XPPPXXXPPXXPPPP 867 PPP P PP P Sbjct: 104 FPPPSTGAPIPPPYP 118 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 41.1 bits (92), Expect = 0.001 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 6/105 (5%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX----GPXPP 831 P P PP PPPP P P PP + PP P PP Sbjct: 6 PPPQYLRPPS---GPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPP 62 Query: 832 PXXXPPXXPPPPXFPXXXP--XPPXPXXXXGAGXXXPPRRXXPPP 960 P P PP P +P P P P PPP Sbjct: 63 PPPPPQWGPPSPHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPP 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 9/81 (11%) Frame = +1 Query: 646 PXPPPPPXPP-------XXXPPXPXPXPP--PPPXPXXXXXXXXXPRPXPPXXRGXXPPX 798 P PPPP P PP P P P PP P P PP PP Sbjct: 14 PSGPPPPTDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPPQWGPPS 73 Query: 799 XXXPXXGPXPPPXXXPPXXPP 861 P P P PP PP Sbjct: 74 PHYPQGQPYSSP-AYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXP-XPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPPPP PP PP P P P P P PP G Sbjct: 59 PSPPPPP-PPQWGPPSPHYPQGQPYSSP-------AYPPHQPPFNAGAN-------GNSQ 103 Query: 823 XPPPXXXPPXXPPPP 867 PPP P PP P Sbjct: 104 FPPPSTGAPIPPPYP 118 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -1 Query: 848 GGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGG 669 GG G P G G P G G G G GGGGG G G GG Sbjct: 72 GGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTG-AGAGGGG 130 Query: 668 XGGGGGXG 645 GGGG G Sbjct: 131 YGGGGDTG 138 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGX-GRGXXXXXXXXXGXGGGGGXGXGX 690 GG G GG P G GG GG G G G G G G G Sbjct: 72 GGYPPLDGTTPTGGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGY 131 Query: 689 GGXXXGGXGGGGGXG 645 GG G GGG G G Sbjct: 132 GGGGDTGAGGGVGSG 146 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXG 807 GGG GG G GG G GGGG GG G G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGGX---GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 GG G P G GG G G GGGG G GGG G GG Sbjct: 84 GGYPPLYGTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 40.7 bits (91), Expect = 0.001 Identities = 33/124 (26%), Positives = 36/124 (29%), Gaps = 10/124 (8%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXPPXXXPPXPX----------PXPPPPPXPXXXXXXXXXPRP 762 LK + + P PPPPP P P P PPPPP P P Sbjct: 562 LKPLRILSRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSP 621 Query: 763 XPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR 942 PP PP P PPP PPP P + PP Sbjct: 622 LPPPL----PPKKLLATTNPPPPP--------PPPLHSNSRMGAPTSSLVLKSPPVPPPP 669 Query: 943 RXXP 954 P Sbjct: 670 APAP 673 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP-- 828 P PP P P P PPPPP +G PP P Sbjct: 558 PLPPLKPLRILSRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSAL 617 Query: 829 PPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP P PP P Sbjct: 618 SSSPLPPPLPPKKLLATTNPPPPPP 642 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/91 (27%), Positives = 25/91 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP P PPP P P P PP Sbjct: 603 PPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKS 662 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG 918 PP PP P P PP P G Sbjct: 663 PP--VPPPPAPAPLSRSHNGNIPPVPGPPLG 691 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P PP P P PPP P P P P PP P PPP Sbjct: 55 PSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSP-PSSSPSSAPPSSLSPSS---PPPL 110 Query: 838 XXPPXXPPPPXFPXXXP 888 P PPPP P P Sbjct: 111 SLSPSSPPPPP-PSSSP 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = +1 Query: 655 PPPPXPPXXXPPX---PXPXPPPPPXPXXXXXXXXXPRPXPPXXR-GXXPPXXXXPXXGP 822 PP P PP P PPPPP P PP PP P Sbjct: 49 PPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSP---S 105 Query: 823 XPPPXXXPPXXPPPP 867 PPP P PPPP Sbjct: 106 SPPPLSLSPSSPPPP 120 Score = 36.7 bits (81), Expect = 0.023 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 8/92 (8%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP- 828 P P PP P P P P P P PP P P P P Sbjct: 34 PSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP---SSSPLSSLSPSLSPSPP 90 Query: 829 -------PPXXXPPXXPPPPXFPXXXPXPPXP 903 PP P PPP P PP P Sbjct: 91 SSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPPPP P PP P P PP P P PP Sbjct: 68 PPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSP------PPLSLSPSSPPPPP 121 Query: 832 PXXXP 846 P P Sbjct: 122 PSSSP 126 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/59 (25%), Positives = 15/59 (25%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPPP P PP P P PP P P P Sbjct: 68 PPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 126 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 40.3 bits (90), Expect = 0.002 Identities = 35/108 (32%), Positives = 35/108 (32%), Gaps = 1/108 (0%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGG-GXXGGXXXGGGXGPXXGXXXXGGXX 783 G G RG P GG G G GGG G GG G G Sbjct: 113 GSGFGGRG-FGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSY 171 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GG G G G GGG G G GG G GG GG F Sbjct: 172 GGNAGGYG-GNPPYSGNAVGGGGGYGSNFG-GGGGYGVAGGVGGSENF 217 Score = 39.9 bits (89), Expect = 0.002 Identities = 33/109 (30%), Positives = 33/109 (30%), Gaps = 4/109 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXG----KXGGGGXXGGXXXGGGXGPXXGXXXXG 792 GG GG PA G GG G GGGG G GG G G Sbjct: 126 GGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYS 185 Query: 791 GXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG G G GGG G G GG G G Sbjct: 186 GNAVGGGGGYGSN--------FGGGGGYGVAGGVGGSENFAQGSSTNAG 226 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 758 RGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 RG G GGG G G G GG GGG G Sbjct: 112 RGSGFGGRGFGGPGGGYGASDGGYGAPAGGYGGGAG 147 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/90 (31%), Positives = 29/90 (32%), Gaps = 3/90 (3%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXG---GXXXGGGXGPXXGXXXXGG 789 GGG G + G GG G GG G G G GG G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGR 64 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGGGGXG 699 R GG GRG G G G G G Sbjct: 65 GDGRGIGGGGRGRGRIPAAFMGRGRGRGRG 94 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GGG G GG G G GG G G G G G G G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGS-GSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 Query: 686 GXXXGGXGGGG 654 G GGGG Sbjct: 64 RGDGRGIGGGG 74 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 1/87 (1%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G G GG G GG G G G R G GRG G Sbjct: 12 GSGSGGSVSGGSGSGGSGSGGSGSGGSG-SGGRANGRGNGGR---GSGRGGGRGDGRGDG 67 Query: 722 XG-GGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G G G G G G G Sbjct: 68 RGIGGGGRGRGRIPAAFMGRGRGRGRG 94 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/60 (33%), Positives = 24/60 (40%) Frame = +1 Query: 616 KQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 +++ T + P PPP PP PP P PPPPP P P P PP Sbjct: 27 RKLLTSYKYSPPPPPVYSPPISPPP---PPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPP 83 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PPP PP PPPP P PP P A P PPP Sbjct: 37 PPPPPVYSPPISPPPP------PPPPPPQSHAAAYKRYSP---PPPP 74 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP 762 PPPPP PP PPP P P P Sbjct: 50 PPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 9/47 (19%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPP---------XXPPPPXFPXXXPXPPXP 903 PP P P PPP PP PPPP PP P Sbjct: 39 PPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 646 PXPPPPPX--PPXXXPPXPXPXPPPPP 720 P PPPP PP PP P P PPPPP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP 897 GP PPP PP PPP P P PP Sbjct: 19 GP-PPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXP 726 P P PP PP P PPPPP P Sbjct: 17 PQGPPPPVGVPPQYYP-PPPPPPP 39 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXP 779 P P PP PPPP PP P Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P PP P PPP PP PPPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPP--PPPP 44 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 660 PXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPG 782 P P P PP P PP PPPP PP G Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPP---PPPPPPPRKVG 48 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 7/34 (20%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP-------XPXPXPPPPPXP 726 P P P P PP P P PPPPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 808 PXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP PP PP +P P PP P Sbjct: 13 PGNYPQGPP---PPVGVPPQYYPPPPPPPPPP 41 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPP--XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 P PP P P P PPPPP P R P P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKPRRTHRSVRNRDLQENAKRSETKFKRTFQPPPSP 300 Query: 835 XXXPPXXPPPPXFPXXXPXPP 897 PP PPPP P PP Sbjct: 301 ---PPPPPPPPPQPLIAATPP 318 Score = 34.3 bits (75), Expect = 0.12 Identities = 26/103 (25%), Positives = 27/103 (26%), Gaps = 2/103 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 PP PP P P PPPPP P P P P Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYT 432 Query: 838 XXPPXXPPPPXFPXXXPXPPXP--XXXXGAGXXXPPRRXXPPP 960 P PP P P P G P + PPP Sbjct: 433 QFDPQTPPRRVKSGRPPRPTKPKNFNEENNGQGSPLIQITPPP 475 Score = 33.5 bits (73), Expect = 0.21 Identities = 28/99 (28%), Positives = 30/99 (30%), Gaps = 23/99 (23%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX-----------------PXPXPPPPPXPXXXXXXXXXPRPXPPX 774 P PPPPP PP P PPPPP P P+ P Sbjct: 386 PPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYTQFD---PQTPPRR 442 Query: 775 XRGXXPPXXXXPXX------GPXPPPXXXPPXXPPPPXF 873 + PP P G P P PPPP F Sbjct: 443 VKSGRPPRPTKPKNFNEENNGQGSPLIQITPPPPPPPPF 481 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 6/65 (9%) Frame = +1 Query: 688 PXPXPXPPP------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P P P PPP P P PRP P P PPP PP Sbjct: 421 PAPPPPPPPRYTQFDPQTPPRRVKSGRPPRPTKPKNFNEENNGQGSPLIQITPPPPPPPP 480 Query: 850 XXPPP 864 PP Sbjct: 481 FRVPP 485 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 610 NLKQINTIFXXXPXPPP-PPXPPXXXPPXPXPXPPPP 717 N K+ T F PPP PP PP PP P PP Sbjct: 282 NAKRSETKFKRTFQPPPSPPPPPPPPPPQPLIAATPP 318 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPPP P P PP P+ G P P Sbjct: 421 PAPPPPPPPRY---TQFDPQTPPRRVKSGRPPRPTKPKNFNEENNGQGSPLIQITPPPPP 477 Query: 826 PPPXXXPP 849 PPP PP Sbjct: 478 PPPFRVPP 485 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPR 759 P P P PPPPP P PR Sbjct: 296 PPPSPPPPPPPPPPQPLIAATPPR 319 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 1/81 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP-XXXXPXXGPXPPP 834 PPP P P P PPPP P P +G PP P G PPP Sbjct: 111 PPPGVPQMMAPPGAPLPPPP-----QNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPP 165 Query: 835 XXXPPXXPPPPXFPXXXPXPP 897 PPPP + PP Sbjct: 166 NYN--GLPPPPPYHTNPAAPP 184 Score = 36.7 bits (81), Expect = 0.023 Identities = 31/104 (29%), Positives = 31/104 (29%), Gaps = 5/104 (4%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX---PXXGPXPPP 834 P PP PP P PP PRP P PP P P PPP Sbjct: 79 PRPPMMLPPGSMPMGMRPPV---------LPRPMMPPQGYMPPPGVPQMMAPPGAPLPPP 129 Query: 835 XXXPPXXPPP-PXFPXXXPXPPXPXXXXGAGXXXPPR-RXXPPP 960 PP P PP G G PP PPP Sbjct: 130 PQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPP 173 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 7/32 (21%) Frame = +1 Query: 652 PPPPPXPP-------XXXPPXPXPXPPPPPXP 726 PPPPP PP PP P P PPPPP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPP 39 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPP 720 PPP PP PP P P PPPPP Sbjct: 25 PPPQPP---PPPPPPPPPPPP 42 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 9/38 (23%) Frame = +1 Query: 634 FXXXPXPPP-PPX--------PPXXXPPXPXPXPPPPP 720 F P PPP PP PP PP P P PPPPP Sbjct: 4 FGTIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPP 41 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR 759 PPP P PP PP P P PPP P PR Sbjct: 25 PPPQPPPP---PPPPPPPPPPRLGPRLRLRLLPPPR 57 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPP 770 PP P PP PP PP PPPP PP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPP---PPPPPPPP 42 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPPPP PP P PPP Sbjct: 33 PPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P P PPP PP P P PPPP Sbjct: 25 PPPQPPP------PPPPPPPPPPP 42 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXP 708 P PPPP PP PP P P Sbjct: 26 PPQPPPPPPPPPPPPPPRLGP 46 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 PPPPP P P R PP P PPP PP PPPP Sbjct: 8 PPPPPLP-----------PRLELRRQRAPP--------PQPPPPPPPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPPP PP P PPP Sbjct: 32 PPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PPP PP PPPP P PP PPR+ Sbjct: 25 PPPQPPPPPPPPPP------PPPPRLGPRLRLRLLPPPRQ 58 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 4/87 (4%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXG--GXGRGXXXXXXXXXGX 720 G G G G GG G G GP G G G G +G G Sbjct: 246 GRGGYDGPQGRGGYDGPQGRRGYDGPPQGRGGYDGPSQGRGGYDGPSQGRGGYDGPSQGR 305 Query: 719 GG-GGGXGXGXG-GXXXGGXGGGGGXG 645 GG G G G G G GG G GGG G Sbjct: 306 GGYDGPQGRGRGRGRGRGGRGRGGGRG 332 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 4/78 (5%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXX-PRPX---PPXXRGXXPPXXXXPX 813 P PP P PP P PP P PRP PP G P P Sbjct: 601 PGPPGHPQMMMNRPPQMQPGMHVPPPPGSQFAHHMQIPRPYGQLPPSAMGMMQPPPM-PG 659 Query: 814 XGPXPPPXXXPPXXPPPP 867 P PPP PP P P Sbjct: 660 MAPPPPPEEAPPPLPEEP 677 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +3 Query: 720 PPXXPPXXXXPPPPXPPXXPGXX---PXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPX 890 PP P PPPP P P P P PP PP PP Sbjct: 614 PPQMQPGMHVPPPPGSQFAHHMQIPRPYGQLPPSAMGMMQPPPMPGMAPPPPPEEAPPPL 673 Query: 891 XXXP 902 P Sbjct: 674 PEEP 677 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 PPPPP P PP R PP P PPP PP PPPP Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRS--PPPLQTP-----PPPPPPPPLAPPPP 393 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP--PPXP 726 P PPP PP P P P PPP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP 717 PPP PP PP P PPPP Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 757 RPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP---XXPPPPXFPXXXPXPP 897 +P PP R P PPP PP PPPP P P PP Sbjct: 346 QPPPPPNRAAFQAITQEK--SPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPP 720 PPP P PP P PPPPP Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPP 394 Score = 31.9 bits (69), Expect = 0.65 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXP 708 PPPPP PP PP P P Sbjct: 380 PPPPPPPPLAPPPPPQKRP 398 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP 711 PPPPP PP PP P P Sbjct: 379 PPPPPPPPPLAPPPPPQKRP 398 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +3 Query: 627 YYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXP 806 Y K PP P P PP P PPP PP P P Sbjct: 337 YSQNKPKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQK 396 Query: 807 XP 812 P Sbjct: 397 RP 398 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +3 Query: 732 PPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXP 902 P PPPP P R P PP PP PP P Sbjct: 342 PKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = +1 Query: 652 PPPPPXPPXXXP-PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PP PP P P PP PP P P PP G PP P P Sbjct: 181 PPLPPLPDGDNALSASLPLPPLPPLPPTTGLTLPHS-PFPPPPPG-PPPKEQDFVRPPLP 238 Query: 829 PPXXXPPXXPPPP 867 PP P PPP Sbjct: 239 PPPQLPQSSQPPP 251 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 625 NTIFXXXPXPPPPPXPPXXX---PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 N + P PP PP PP P P P PPP P P P P + PP Sbjct: 191 NALSASLPLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPP 250 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 4/72 (5%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXP-PXXRGXXPPXXXXPXXGPXPPPXXXP---PXXPP 861 P P PP P P P P G P P P PPP P PP Sbjct: 180 PPPLPPLPDGDNALSASLPLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPP 239 Query: 862 PPXFPXXXPXPP 897 PP P PP Sbjct: 240 PPQLPQSSQPPP 251 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP P P PP P P PP PP P P PPP Sbjct: 348 PPPGMLRFPPPPPPLDMHPPHPGMFVGHLI---PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 760 PXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXP 936 P PP PP P P PP PPP P P PP G P Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPPGPPPSSFQDGQAMIRP 414 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP 714 P PPP PP PP P P PPP Sbjct: 381 PYGPPPGPPPMMRPPLP-PGPPP 402 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P PP PP PP P PP P P RP P Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPPSSFQDGQAMIRPYVP 417 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPX---PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P P PPP P P PP P P Sbjct: 33 PTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENP-- 90 Query: 817 GPXPPPXXXPPXXPPPPXFP----XXXPXPPXP 903 P P P P PP P P PP P Sbjct: 91 SPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/100 (25%), Positives = 26/100 (26%), Gaps = 5/100 (5%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPP---PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 P P PP P PP P P P PP P P Sbjct: 10 PAPETSNGTPPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAP-PTQETSP 68 Query: 829 P--PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR 942 P P PP P P PP P PP+ Sbjct: 69 PTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPPQ 108 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 39.1 bits (87), Expect = 0.004 Identities = 33/90 (36%), Positives = 33/90 (36%), Gaps = 7/90 (7%) Frame = -1 Query: 893 GXGXXXGKXGG--GGXXGGXXXGGGXGPXX---GXXXXGGXXPRXXGGXGRGXXXXXXXX 729 G G G GG GG GG G G P G GG GG G G Sbjct: 290 GGGFPGGMPGGFPGGMPGGFPGGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGG 349 Query: 728 XGXGGGGGXGXGXGGXXXGGXGGG--GGXG 645 G GGG G GG G GGG GG G Sbjct: 350 M-PGMGGGMPAGMGGGGMPGAGGGMPGGGG 378 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/83 (31%), Positives = 28/83 (33%), Gaps = 4/83 (4%) Frame = +1 Query: 652 PPPPPXPP-XXXPPXPXPXP---PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP PP P P PPP P P P +G P P Sbjct: 495 PPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQG-YPAQGYPPPQY 553 Query: 820 PXPPPXXXPPXXPPPPXFPXXXP 888 P P P PPPP + P Sbjct: 554 PQGHPPQYPYQGPPPPHYGQAPP 576 Score = 29.1 bits (62), Expect = 4.6 Identities = 20/83 (24%), Positives = 22/83 (26%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPX 890 P P PP PP P P P P + P PP + P Sbjct: 488 PQHPVSAPPPQGYPPKEGYP--PAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPA 545 Query: 891 XXXPXXXXGXGXXXXXPAXAPPP 959 P G P PPP Sbjct: 546 QGYPPPQYPQGHPPQYPYQGPPP 568 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P G P P PPP P P G G P + PP Sbjct: 496 PPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPP 551 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPP PP PP P PPPP P P P PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPPGELYP 142 Score = 35.1 bits (77), Expect = 0.070 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPP PP P P PP PP Sbjct: 94 PSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P PPPP PP P P PP PP P Sbjct: 93 PPSPPPPSPP--PPSQACPPPPLPPSP 117 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PPP PP PPP P PP P Sbjct: 81 PIKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 687 PXXXXXXPPXXPP--XXPPXXXXPPPPXPPXXP 779 P PP PP PP PPPP PP P Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXP 846 P P PPPP P P P P + PP PP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPPGELYP 142 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 PP P P P PP PP P P PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 6/86 (6%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPP---PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG--- 819 PPP P P P PP P P P + PP P Sbjct: 825 PPPVHPVSQPQGPQVQQFDQLYPPPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQAL 884 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P P PP PPPP P P P Sbjct: 885 PPPLPHSHPPLVPPPPFSPLLSPRLP 910 Score = 34.7 bits (76), Expect = 0.093 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +1 Query: 652 PPPP---PXPPXXXPPX-PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPP P PP P PP PP P P P PP P Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLS 906 Query: 820 PXPPP 834 P PP Sbjct: 907 PRLPP 911 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 P PP PP PP P PPP P P P P PP Sbjct: 865 PQSQPPEPPPEMMPPPPQALPPPLP---HSHPPLVPPPPFSPLLSPRLPP 911 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PP P PPP PP P P P PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPGNLYP 112 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXP 768 PPPP PP PP P PP P P P P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPPP PP PP P PPPP Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPP 85 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPP PP P P PPPPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPPPP 85 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 793 PXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P P PPP PP PPPP P PP P + PP Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP P P PP PP PPPP PP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP 762 P PP PP P P P P PPP P P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PPP PP PPPP P P PP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALP---PPPP 85 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P PP P P PPP PPPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 735 PXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P PPPP PP P P P + P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 39.1 bits (87), Expect = 0.004 Identities = 34/115 (29%), Positives = 34/115 (29%), Gaps = 13/115 (11%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP----PPXPXXXXXXXXXPRP-----XPPXXRGXXPPXXXX 807 PPPP PP PPP PP P P P PP PP Sbjct: 34 PPPPVK-HYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHY 92 Query: 808 PXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PPPP PP P PP PPP Sbjct: 93 VYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 143 Score = 37.5 bits (83), Expect = 0.013 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 15/118 (12%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP--XPPP----PPXPXXXXXXXXXPRP-----XPPXXRGXXPPX 798 PPP PP P PPP PP P P P PP PP Sbjct: 58 PPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 117 Query: 799 XXXPXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PPPP PP P PP PPP Sbjct: 118 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 171 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 15/118 (12%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP--XPPP----PPXPXXXXXXXXXPRP-----XPPXXRGXXPPX 798 PPP PP P PPP PP P P P PP PP Sbjct: 170 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 229 Query: 799 XXXPXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PPPP PP P PP PPP Sbjct: 230 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 283 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 15/118 (12%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP--XPPP----PPXPXXXXXXXXXPRP-----XPPXXRGXXPPX 798 PPP PP P PPP PP P P P PP PP Sbjct: 282 PPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPK 341 Query: 799 XXXPXXGPXPPPXXXPP----XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P PPPP PP P PP PPP Sbjct: 342 KHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 395 Score = 35.9 bits (79), Expect = 0.040 Identities = 29/110 (26%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 321 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 380 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P + P PPP Sbjct: 381 VKHYSPPPVYH---SPPPPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPP 427 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 97 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 156 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 157 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 199 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 125 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 184 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 185 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 227 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 153 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 212 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 213 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 255 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 209 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 268 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 269 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 311 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 237 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 296 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 297 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 339 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 8/110 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP PP PPP PP P PP + P Sbjct: 265 PPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 324 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPPP PP P PP PPP Sbjct: 325 VKHYSPPPVYH---SPPPPKKHYVYKSPPPPVKHYS----PPPVYHSPPP 367 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/113 (28%), Positives = 34/113 (30%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP G PP P Sbjct: 235 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSP 294 Query: 811 XXGPXPPPXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPPP + P P P G+ PP P P Sbjct: 295 KVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGS---PPPPYYSPSP 344 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 160 PPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 219 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 220 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 254 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 335 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSP 394 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 395 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 429 Score = 36.3 bits (80), Expect = 0.030 Identities = 32/115 (27%), Positives = 33/115 (28%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P PP P PPPP P P PP P Sbjct: 451 PPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPP----PYV 506 Query: 817 GPXPPPXXXPPXXP-----PPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 PPP P PPP + P PP P PP PP Sbjct: 507 YSFPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 561 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 510 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 569 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 570 KVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPP 604 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 135 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSP 194 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 195 KVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 229 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 210 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 269 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 270 KVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 304 Score = 35.9 bits (79), Expect = 0.040 Identities = 24/88 (27%), Positives = 26/88 (29%), Gaps = 6/88 (6%) Frame = +1 Query: 652 PPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXX-RGXXPPXXXXPX 813 PPPP P PP P PPP P P + PP Sbjct: 401 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYVYSSP 460 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PPPP + P PP Sbjct: 461 PPPYYSPSPKVDYKPPPPPYVYSSPPPP 488 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 460 PPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSP 519 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 520 KVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 554 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 310 PPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 369 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 370 KVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPP 404 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 560 PPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSP 619 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 620 KVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 654 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 185 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPP----PYY 240 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P P PP + P PP P PP PP Sbjct: 241 SPSPKVDYKSP----PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 286 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 585 PPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 644 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 645 KVNYKSPPPPYVYSSPPPPYY 665 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P P P PPP P PP PP P Sbjct: 110 PPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 169 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 170 KGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 204 Score = 32.3 bits (70), Expect = 0.49 Identities = 29/110 (26%), Positives = 31/110 (28%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP-P-XXXXPXXG 819 P P P PP P PPP P PP P P P Sbjct: 388 PYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVD 447 Query: 820 PXPPPXXXPPXXPPPPXF---PXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PPPP + P PP P + PP P P Sbjct: 448 YKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSS---PPPPYYSPSP 494 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPPP P PP PP P Sbjct: 485 PPPPYYSPSPKVDYKSPPPPYVYSFPPPP--YYSPSPKVDYKSPPPPYVYSSPPPPYYSP 542 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 543 SPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 579 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 4/87 (4%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 610 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSP-- 667 Query: 817 GPXPPPXXXPPXXP-PPPXFPXXXPXP 894 P PP P P P P Sbjct: 668 SPKVDYKSSPPQYVYSSPPTPYYSPSP 694 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G GG GG GGG G G GG GR GGGG Sbjct: 45 GDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGR-----------YQGGGGRYQ 93 Query: 695 GXGGXXXGGXG--GGGGXG 645 G GG GG G GGGG G Sbjct: 94 GGGGRYQGGGGRQGGGGSG 112 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/71 (32%), Positives = 25/71 (35%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G G G GGG G GG + GG +G G GGG G Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGG 102 Query: 686 GXXXGGXGGGG 654 G GG G GG Sbjct: 103 GGRQGGGGSGG 113 Score = 36.3 bits (80), Expect = 0.030 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGR--GXXXXXXXX 729 G G G GG GG GGG G G R GG GR G Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGG 102 Query: 728 XGXGGGGGXG 699 G GGGG G Sbjct: 103 GGRQGGGGSG 112 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXX---GGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G G GGGG GG GGG G G R GG GR Sbjct: 49 GNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGR--YQGGGGRQ 106 Query: 725 GXGGGGG 705 G GG GG Sbjct: 107 GGGGSGG 113 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = -1 Query: 956 GGXXRRGGXXXPAPXXXXGXGG--XGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GG GG G GG G GGGG G GGG G GG Sbjct: 48 GGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQG---GGGRYQGGGGRYQGGGG 104 Query: 782 PRXXGGXG 759 + GG G Sbjct: 105 RQGGGGSG 112 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 38.3 bits (85), Expect = 0.008 Identities = 24/99 (24%), Positives = 28/99 (28%), Gaps = 2/99 (2%) Frame = +1 Query: 604 IINLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 I+ + + +F P P PP P P P P P P P Sbjct: 5 IVQVFLMLALFATSALAQAPAPTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAA 64 Query: 784 XXPPXXXXPXXGPXPP--PXXXPPXXPPPPXFPXXXPXP 894 P P P P P PP P P P P Sbjct: 65 TPAPATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPGP 103 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 1/60 (1%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXP-PXPPFPXXP 884 P PP P PPP P P P P P P P PP P P Sbjct: 34 PATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGP 93 Score = 31.9 bits (69), Expect = 0.65 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 5/79 (6%) Frame = +1 Query: 646 PXPPPP--PXPPXXXPPX---PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PPP PP PP P P PPP P P PP P Sbjct: 34 PATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGP 93 Query: 811 XXGPXPPPXXXPPXXPPPP 867 P P P P P Sbjct: 94 TVSPSSAP--GPSDASPAP 110 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PP P PP P PPP P PP Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPP 73 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 38.3 bits (85), Expect = 0.008 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 857 GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXX 678 G GG G G G G P G G G G G GGG G G GG Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGP--GGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGL 94 Query: 677 XGGXGGGGG 651 GG G G G Sbjct: 95 GGGSGIGAG 103 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXG-GXGRGXXXXXXXXXGXG 717 G G G G G GG GP G GG G G G G G G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPG-GNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Query: 716 GGGGXGXGXGGXXXGG 669 GG G G G G GG Sbjct: 96 GGSGIGAGTSGGSTGG 111 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = -1 Query: 863 GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 GGG G G G G G G G G G G G G G G G Sbjct: 39 GGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGS 98 Query: 683 XXXGGXGGGGGXG 645 G GG G Sbjct: 99 GIGAGTSGGSTGG 111 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 4/73 (5%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXG----GGGXXGGXXXGGGXGPXXGXXXXG 792 GGG G P G G G G G GGG GG G G G G Sbjct: 39 GGGYSGVGDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGS 98 Query: 791 GXXPRXXGGXGRG 753 G GG G Sbjct: 99 GIGAGTSGGSTGG 111 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/80 (36%), Positives = 29/80 (36%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 G G G G GG GG GG G G GG GG GRG G Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGR--------GPP 58 Query: 716 GGGGXGXGXGGXXXGGXGGG 657 GG G G G GG GG Sbjct: 59 RGGARG-GRGPAGRGGMKGG 77 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G GG G GG G G R GG G G G G G G G Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGG--RGGGGRGGGRGFSDRGGRGRGRGPPRGGARG 64 Query: 686 GXXXGGXGGGGG 651 G G GG G Sbjct: 65 GRGPAGRGGMKG 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXG--GGXGPXXGXXXXGGXXPRXXGGXG 759 G G G G GGGG GG GG G G G R G G Sbjct: 23 GGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRG 72 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = -1 Query: 830 GGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGG------GGXGXGXGGXXXGG 669 G G G GG GG G G G GGG GG G G G G Sbjct: 7 GSGGGFSGGRGRGGYS----GGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGA 62 Query: 668 XGGGGGXG 645 GG G G Sbjct: 63 RGGRGPAG 70 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G G G G GG GGG G G GG G Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFGDNSDNNSVSSDS 75 Query: 722 XGGGGGXGXGXG 687 GGG G G G Sbjct: 76 SGGGSRDGGGSG 87 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGG 651 G GGGGG G G G GG G GGG Sbjct: 17 GSGGGGGSGDGSGSGDGGGSGDGGG 41 Score = 34.7 bits (76), Expect = 0.093 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGR----GXXXXXXXXX 726 G G G GG G G GGG G G G GG G G Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFGDNSDNNSVS 72 Query: 725 GXGGGGGXGXGXGGXXXGGXGGG 657 GGG G G G G Sbjct: 73 SDSSGGGSRDGGGSGDNGNTDDG 95 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G G G GGG G G Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGGSGDG 39 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G G G G GGG G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSG 37 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -1 Query: 863 GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 G G GG GGG G G GG GG G G GG G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSG--DGGGSRDSDGSGDSSGGGSGDSGGFGDNSDN 68 Query: 683 XXXGGXGGGGG 651 GGG Sbjct: 69 NSVSSDSSGGG 79 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G G G G GGG G Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSG 57 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GGG G G GG G GG G Sbjct: 22 GGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G G G G G G G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGG 41 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = -1 Query: 887 GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGG 708 G G GGG GG G G G G GG R G G G G Sbjct: 11 GSGDGGGSGGG--GGSGDGSGSGDGGGSGDGGG--SRDSDGSGDSSGGGSGDSGGFGDNS 66 Query: 707 GXGXGXGGXXXGGXGGGGGXG 645 GG GGG G Sbjct: 67 DNNSVSSDSSGGGSRDGGGSG 87 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPPP PP P PPPPP Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 610 NLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXP 726 N I T F PPPPP PP PPPPP P Sbjct: 31 NPSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 35.1 bits (77), Expect = 0.070 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P P P P P PPPPP P P P PP Sbjct: 32 PSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPP 69 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +3 Query: 708 PPXXPPXXPPXXXX----PPPPXPPXXP 779 PP PP PP PPPP PP P Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPPHLP 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP PP PPP F PP P Sbjct: 42 PHPPPP--PPPPPPPLYFSYFSLPPPPP 67 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPP-XPXPXPPPPP 720 P PPPPP P P P P PPPPP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPPPPP 77 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 633 FXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPP 770 + T PP P P PP PP PP PPPP PP Sbjct: 151 YCNNTDLPPPSPDFPPFSPSIPPPSPPYFPP-EPPSIPPPPPPSPP 195 Score = 35.9 bits (79), Expect = 0.040 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXP 726 PPP PP P P PPPPP P Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSP 194 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXF-PXXXPXPPXPXXXXGAG 924 PP P P PP P P PP P P PP G+G Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASGRGSG 204 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXP 812 P P PP PPP PP P P P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPP 191 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPP-PPXPXXXXXXXXXPRPXPP 771 PP P PP P P P PP PP P P P PP Sbjct: 159 PPSPDFPP-FSPSIPPPSPPYFPPEP---PSIPPPPPPSPP 195 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 711 PXXPPXXPPXXXXPPPPXPPXXPGXXP 791 P PP PP PP PP P P Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPPPSPP 195 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP----XPPPPPXP 726 P PPPPP P P P P PPPPP P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 34.7 bits (76), Expect = 0.093 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 4/72 (5%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP----XXXPPXXPP 861 P P PP P P P G P P PPP PP PP Sbjct: 596 PPSIPRPPSRPRYACCRIPAVNPPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPP 655 Query: 862 PPXFPXXXPXPP 897 PP PP Sbjct: 656 PPMLVASRTAPP 667 Score = 32.7 bits (71), Expect = 0.37 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPX 837 P P PP P P PPPP P P P G P P Sbjct: 638 PSPPPPSMSGGAPPPPPPPP------MLVASRTAPPPHLSHVRSIPFQTRLVMGTSPLPL 691 Query: 838 XXPPXXPPP--PXFPXXXPXPPXP 903 PPP P P PP P Sbjct: 692 LVREGAPPPTLPSMSGGAPPPPPP 715 Score = 31.5 bits (68), Expect = 0.86 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXP 702 P PPPPP P PP P P Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 847 PXXPPPPXFPXXXPXPPXP 903 P PPPP P P PP P Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 29.1 bits (62), Expect = 4.6 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 2/71 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXP--PPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 PPPPP PP P P P P R PP G Sbjct: 650 PPPPPPPPMLVASRTAPPPHLSHVRSIPFQTRLVMGTSPLPLLVREGAPPPTLPSMSGGA 709 Query: 826 PPPXXXPPXXP 858 PPP PP P Sbjct: 710 PPP---PPPLP 717 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP P PPP PPP P PP P Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPP 52 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP-XXXXGAG 924 P P P PPP PPP P PP P GAG Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKGAG 61 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P PP P PP P P PP P P P P Sbjct: 590 PSRIRPPPSIPRPPSRPR----YACCRIPAVNPP------PRLVCGPY--PLPRLVRVGS 637 Query: 850 XXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 PPPP P PP P A PP Sbjct: 638 PSPPPPSMSGGAPPPPPPPPMLVASRTAPP 667 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPP 861 P P PP R P P G PPP PP P Sbjct: 25 PPPPPPMRRSAPSPP---PMSGRVPPPPPPPPMFDP 57 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGG 654 GGGGG G G GG GG GGGG Sbjct: 131 GGGGGYGGGGGGYGGGGDGGGG 152 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G GG GG GGG G G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGG 146 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGG 651 GGGG G G GG GG G GGG Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGG 151 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXG-GGGGXG 645 G GGG G G GG GG G GGGG G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDG 149 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGG 651 GGGGG G GG GG GGGG Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGGG 152 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 920 APXXXXGXGGX---GXXXGKXGGGGXXGGXXXGGG 825 AP G GG G G GGGG GG GGG Sbjct: 117 APRAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -1 Query: 896 GGXGXXXGKXGGG-GXXGGXXXGGGXG 819 GG G G GGG G GG GGG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDG 149 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXG-GGGGXG 645 GGGGG G G GG GG G GGGG G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGGDG 154 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGG 654 GGGGG G G GG GG GGGG Sbjct: 136 GGGGGYGGGGGGYGGGGDGGGG 157 Score = 36.7 bits (81), Expect = 0.023 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 PR GG G G GGGGG G GG GG GGGG Sbjct: 118 PRAYGGGG----GYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GGGGG G GG GG G GGG G + Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGY 148 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -1 Query: 725 GXGG--GGGXGXGXGGXXXGGXGGGGGXG 645 G GG GGG G G GG GG GGG G G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGG 151 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 917 PXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 P GG G G GGG GG GGG G G GG Sbjct: 115 PSAPRAYGGGGGYSG-GGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGG 825 G GG G G GGGG GG GGG Sbjct: 133 GYGGGGGGYG-GGGGGYGGGGDGGGG 157 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGG 855 GGG GG G GG G G GGGG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGG 651 GGGGG G G G GG GGGGG Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGG 233 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G GG GGGGG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGG 233 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGG 654 G GGG G G G GG GG GG Sbjct: 215 GLGGGNGSGGGGGGGGGGGRISGG 238 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 866 GGGGXXGG-XXXGGGXGPXXGXXXXGGXXPR 777 GGGG GG GGG G G GG PR Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGGSSPR 242 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG-GXXGGXXXGGGXGP 816 G GG G G GGG G GG GG P Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGGSSP 241 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P PPPPP PP P PPPP P RP PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGF----RPMPP 268 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPX 879 P P P P P P PP PP P P PPP P PPP Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPP------PPHQAQP---PPPPPSGLFPPPPPPMANNG 262 Query: 880 XXPXPP 897 P PP Sbjct: 263 FRPMPP 268 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG 918 P PPP PPPP P PP P G Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNG 262 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P PPPPP +P PP G P P Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPPP--------PHQAQPPPPPPSGLFP---------PP 254 Query: 826 PPPXXXPPXXPPPP 867 PPP P PP Sbjct: 255 PPPMANNGFRPMPP 268 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 G PPP P PPP P PP P PP Sbjct: 228 GLPPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/71 (36%), Positives = 26/71 (36%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G GG G GGG G GG G G G GGGG G G G Sbjct: 830 GSGGFAGAAPGGGGGG-------FGGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFG-GFG 881 Query: 686 GXXXGGXGGGG 654 G G GGGG Sbjct: 882 GQAQGQAGGGG 892 Score = 31.5 bits (68), Expect = 0.86 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -1 Query: 893 GXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGG 714 G G G GGG G G G G G G G G G G Sbjct: 830 GSGGFAGAAPGGGGGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAG 889 Query: 713 GGGXGXGXGGXXXGG 669 GGG G G Sbjct: 890 GGGFSAFGGNSGATG 904 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G GG GG G GGG G Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G G GG GGGGG G Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G GG GG GGGGG G Sbjct: 59 GGGDGGGDGGGDGGG--GGCGGGGGCG 83 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 G G G G GGGG GG GGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 G GGG GG GGG G G GG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPP PP P P PPPPP Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPP 243 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 652 PPPPPXPPXXXP-PXPXPXPPPP 717 PPPPP P P P P PPPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPPP 244 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 37.1 bits (82), Expect = 0.017 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP 717 P PPP PP P P P PPPP Sbjct: 347 PSPPPPPPVIQPELPQPQPPPP 368 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PP P PP P P PPP P P+P PP Sbjct: 329 PPQPTLPPQLVEPSRVQSPSPPPPPPVIQPELPQPQPPPP 368 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P PPP PP P P PPPPP P Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPPPRP 183 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPP 770 P PP PP PP PPP PP Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPPPP 181 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 779 RXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGG 657 R GG G G GGGG G G GG GG GGG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG GRG GGGGG G GG GG GGGG Sbjct: 90 GGGGRGGSGGGYRS---GGGGGYSGGGGGGYSGGGGGGG 125 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGG--GGXG 645 G GGGGG G GG G GGG GG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGG 114 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 767 GXGRGXXXXXXXXXGXGGGGGXG-XGXGGXXXGGXGGGGG 651 G G G G GGG G G GG G GGGGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGG--GGXG 645 G GGG G GG GG GGG GG G Sbjct: 96 GSGGGYRSGGGGGYSGGGGGGYSGGGG 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG GG GG G GGGG G Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSG 119 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 G GG G G GG GG GGG G G GG Sbjct: 90 GGGGRGGSGGGYRSGG--GGGYSGGGGGGYSGGGGGGG 125 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -1 Query: 725 GXGGGG-GXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G GG GGGG G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/127 (26%), Positives = 35/127 (27%), Gaps = 22/127 (17%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 142 PPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 201 Query: 811 ---XXGPXPPPXXXPPXXP------------PPPXFPXXXPXPP--XPXXXXGAGXXXPP 939 P PP P P PPP + P PP P PP Sbjct: 202 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 261 Query: 940 RRXXPPP 960 PPP Sbjct: 262 YYRSPPP 268 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/94 (28%), Positives = 27/94 (28%), Gaps = 10/94 (10%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 192 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 251 Query: 811 ---XXGPXPP--PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 252 KVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPP 285 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 117 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSP 176 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 177 KVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPP 211 Score = 35.9 bits (79), Expect = 0.040 Identities = 32/123 (26%), Positives = 35/123 (28%), Gaps = 5/123 (4%) Frame = +1 Query: 607 INLKQINTIFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXX 777 +N K + P PP P P PP P PPP P PP Sbjct: 253 VNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 312 Query: 778 RGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXX 951 PP P P P P PP + P PP P PP Sbjct: 313 YSSPPP----PYYSPTPKVDYKSP----PPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYS 364 Query: 952 PPP 960 PP Sbjct: 365 SPP 367 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 316 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 375 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 376 KVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 410 Score = 35.1 bits (77), Expect = 0.070 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 366 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPPP----PYY 421 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPP + P P PP PP Sbjct: 422 SPSPKVNYKTP--PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 467 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/111 (27%), Positives = 32/111 (28%), Gaps = 8/111 (7%) Frame = +1 Query: 652 PPPP-----PXPPXXXP-PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 PPPP P PP P P PPPP P P + PP Sbjct: 233 PPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDY-KSPPPPYVYSSP 291 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P PPP + P PP P PP PP Sbjct: 292 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 342 Score = 33.9 bits (74), Expect = 0.16 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 3/101 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 391 PPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPPP----PYY 446 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P P P PP + P PP PP Sbjct: 447 SPSPKVNYKSP----PPPYVYSSPPPPYYSPSPNVDYKSPP 483 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXPX--PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P P P PPP P PP PP P Sbjct: 92 PPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 151 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 152 KGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 186 Score = 32.3 bits (70), Expect = 0.49 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 9/95 (9%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 416 PPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSP 475 Query: 817 G---PXPPPXXXPPXXPPP---PXFPXXXPXPPXP 903 PPP P P P PP P Sbjct: 476 NVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPP 510 Score = 31.5 bits (68), Expect = 0.86 Identities = 24/98 (24%), Positives = 25/98 (25%), Gaps = 2/98 (2%) Frame = +3 Query: 600 VNYKSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPP--XXPPXXXXPPPPXPPX 773 VNYKS YY P P P PP P PP P Sbjct: 253 VNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV 312 Query: 774 XPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP+ P Sbjct: 313 YSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSP 350 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 15/97 (15%) Frame = +1 Query: 652 PPPP---PXPPXXXPPXPXP----XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P P P P PPPP P PP PP P Sbjct: 391 PPPPYYSPSPKVDYKSPPPPYIYNSPPPP--YYSPSPKVNYKTPPPPYVYSSPPPPYYSP 448 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 449 SPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPP 485 Score = 28.3 bits (60), Expect = 8.0 Identities = 22/96 (22%), Positives = 23/96 (23%), Gaps = 2/96 (2%) Frame = +3 Query: 606 YKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXP 779 Y S YY K PP P P P PP PP P P Sbjct: 239 YSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 298 Query: 780 GXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P + PP Sbjct: 299 SPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPP 334 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 105 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSP 164 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 165 KVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 199 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 214 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 215 KVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 249 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 264 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 265 KVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 299 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 314 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 315 KVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 349 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSP 364 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 365 KVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 399 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 355 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSP 414 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 415 KVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 449 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 697 PPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 756 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP P PPP + P PP Sbjct: 757 KVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPP 791 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 489 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 490 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 524 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 872 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 873 KVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPP 907 Score = 35.9 bits (79), Expect = 0.040 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 8/92 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP----- 810 P P P PP P PPP P PP PP P Sbjct: 58 PTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVE 117 Query: 811 XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 118 YKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 149 Score = 35.9 bits (79), Expect = 0.040 Identities = 28/95 (29%), Positives = 29/95 (30%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P PP PP P Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 539 Query: 817 G---PXPPPXXXPP-----XXPPPPXFPXXXPXPP 897 PPP P PPP + P PP Sbjct: 540 KVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 574 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/100 (27%), Positives = 29/100 (29%), Gaps = 11/100 (11%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXX 801 ++ P PP P P PP P PPP P PP PP Sbjct: 541 VYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPY 600 Query: 802 XXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P P PP PP P P P PP Sbjct: 601 HSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 640 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 763 PPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 822 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 823 KVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 857 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 405 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSP 464 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 465 KVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 499 Score = 35.5 bits (78), Expect = 0.053 Identities = 29/111 (26%), Positives = 29/111 (26%), Gaps = 6/111 (5%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 655 Query: 817 G---PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PPP P P PP P P Sbjct: 656 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSP 706 Score = 35.1 bits (77), Expect = 0.070 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 6/83 (7%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 863 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSP 922 Query: 817 G---PXPPPXXXPPXXPPPPXFP 876 PPP PPP P Sbjct: 923 KVEYKSPPPPYVYKSPPPPSYSP 945 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/112 (26%), Positives = 32/112 (28%), Gaps = 7/112 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP----PYY 893 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP----RRXXPPP 960 P P PPP + P PP PP + PPP Sbjct: 894 SPSP----VVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPP 941 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 14/96 (14%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPXXXXP- 810 PPPP P P PP P PPP P + P PP PP P Sbjct: 671 PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPS 730 Query: 811 ----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 731 PKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 766 Score = 32.3 bits (70), Expect = 0.49 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 22/104 (21%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXP-----XPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXX 789 PPPP PP P P P PP PPP P PP Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 130 Query: 790 PPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 131 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 174 Score = 32.3 bits (70), Expect = 0.49 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 22/104 (21%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXP-----XPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXX 789 PPPP PP P P P PP PPP P PP Sbjct: 121 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 180 Query: 790 PPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 181 PPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 224 Score = 32.3 bits (70), Expect = 0.49 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 22/104 (21%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXP-----XPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXX 789 PPPP PP P P P PP PPP P PP Sbjct: 321 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 380 Query: 790 PPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 381 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 424 Score = 32.3 bits (70), Expect = 0.49 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 22/104 (21%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXP-----XPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXX 789 PPPP PP P P P PP PPP P PP Sbjct: 371 PPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSP 430 Query: 790 PPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 431 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 474 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPP P P PP PP P + PP P Sbjct: 722 PPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPP 781 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP P P P PP Sbjct: 782 PYVYSSPPPPYYSPSPKVHYKSPPPP 807 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPP----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPP P P PP PP P + PP P Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPP 564 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP P P P PP Sbjct: 565 PYVYSSPPPPYYSPSPKVYYKSPPPP 590 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 9/91 (9%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPPP PP P P PP P P + PP P Sbjct: 562 PPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPP---PPYVY 618 Query: 820 PXPPPXXXPP-----XXPPPPXFPXXXPXPP 897 PPP P PPP + P PP Sbjct: 619 SSPPPPYYSPSPKVYYKSPPPPYVYSSPPPP 649 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPPP P PP PP P Sbjct: 180 PPPPTYSPSPKVEYKSPPPPYVYSSPPPP--YYSPSPKVEYKSPPPPYVYSSPPPPTYSP 237 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 238 SPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 274 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPPP P PP PP P Sbjct: 230 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP--YYSPSPKVEYKSPPPPYVYSSPPPPTYSP 287 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 288 SPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 324 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPPP P PP PP P Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPP--YYSPSPKVDYKSPPPPYVYSSPPPPTYSP 337 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 338 SPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 374 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSP 973 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP P PPP + P PP Sbjct: 974 KVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPP 1008 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTP 331 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 332 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 366 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 923 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 924 KVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPP 958 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 147 PPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 206 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 207 KVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 241 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 197 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 256 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 257 KIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 291 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSP 281 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 282 KVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 316 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 322 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 381 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 382 KIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPP 416 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 397 PPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 456 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 457 KVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 491 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSP 531 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 532 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 566 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 814 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 873 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 874 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 908 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 481 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 482 KVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPP 516 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 664 PPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 723 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 724 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 758 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 714 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 773 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 774 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 808 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 764 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 823 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 824 KVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 858 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 372 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSP 431 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 432 KVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPP 466 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 72 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSP 131 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 132 KVDYKSPPPPYVYSSPPPPYY 152 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 522 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 581 Query: 817 GP--XPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 582 KVVYKSPPPPYVYSSPPPPYY 602 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 5/87 (5%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P PP PP P Sbjct: 497 PPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPP----PYY 552 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P P PP + P PP Sbjct: 553 SPSPKVVYKSP----PPPYVYSSPPPP 575 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 8/89 (8%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPPP----PYY 152 Query: 817 GPXPPPXXXPPXXP-----PPPXFPXXXP 888 P P P P PPP + P Sbjct: 153 SPSPKVEYKSPPSPYVYNSPPPSYYSPSP 181 Score = 31.9 bits (69), Expect = 0.65 Identities = 27/105 (25%), Positives = 29/105 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P PPP P + PP PP P P Sbjct: 616 PYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPP---PPYHSPS 672 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P PPP + P P PP PP Sbjct: 673 PKVHYKSP--PPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 715 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/104 (26%), Positives = 29/104 (27%), Gaps = 2/104 (1%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP P PPPP P PP PP P P P Sbjct: 55 PPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSP--PPPYVYNSPPP----PYYSPSPKV 108 Query: 835 XXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P PP + P PP P PP PP Sbjct: 109 DYKSP----PPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPP 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 3/86 (3%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 547 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSP 606 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXP 894 P P P P P Sbjct: 607 KVYYKSPPSPYHAPSPKVLYKSPPHP 632 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/84 (23%), Positives = 21/84 (25%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P PPP + PP P P Sbjct: 33 PYSVPLPKVEYKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPPYYSPSPKVEYKSPPPPY 92 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP P P P PP Sbjct: 93 VYNSPPPPYYSPSPKVDYKSPPPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 27/98 (27%), Positives = 29/98 (29%), Gaps = 2/98 (2%) Frame = +3 Query: 600 VNYKSQTNKYYFX--KXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPX 773 V+YKS YY K PP P P PP P PPPP Sbjct: 67 VDYKSPPPPYYSPSPKVEYKSPPPPYVYNSPP------PPYYSPSPKVDYKSPPPPYVYS 120 Query: 774 XPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P P PP+ P Sbjct: 121 SP--PPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 156 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 5/58 (8%) Frame = +1 Query: 652 PPPP-----PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P PP P PPP P PP PP P Sbjct: 955 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSP 1012 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 37.1 bits (82), Expect = 0.017 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 4/97 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRP-XPPXXRGXXP---PXXXXPX 813 P P P PP PP P P P P PP G P P Sbjct: 288 PPPSHPQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPPYQMQS 347 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAG 924 P PP P P F P P P GAG Sbjct: 348 YPPNPPRQQPPAGSTPSQQF--YNPPQPQPSMYDGAG 382 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/82 (25%), Positives = 21/82 (25%), Gaps = 1/82 (1%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP- 810 F P PP P PP P P P P PP P Sbjct: 248 FPLTSFPQPPSSTAAPSQPPSSQLPPQLPTQFSSQQEPYCPPPSHPQPPPSNPPPYQAPQ 307 Query: 811 XXGPXPPPXXXPPXXPPPPXFP 876 P P PP P P P Sbjct: 308 TQTPHQPSYQSPPQQPQYPQQP 329 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/82 (24%), Positives = 21/82 (25%) Frame = +1 Query: 712 PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPX 891 P P P P+P PP P P P PPP P P Sbjct: 240 PAPVPMQQFPLTSFPQPPSSTAAPSQPPSSQLPPQLPTQFSSQQEPYC-PPPSHPQPPPS 298 Query: 892 PPXPXXXXGAGXXXPPRRXXPP 957 P P P PP Sbjct: 299 NPPPYQAPQTQTPHQPSYQSPP 320 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-PXPP 831 PP P PP P P PP P P P P G P PP Sbjct: 99 PPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPP 158 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P P P G PP PP Sbjct: 159 VVGPNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPP 200 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/104 (25%), Positives = 28/104 (26%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P P P P P P P + PP Sbjct: 41 PKAPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVP----KL 96 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P PP P+ PP Sbjct: 97 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPP 140 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-PXPP 831 PP P PP P P PP P P P P G P PP Sbjct: 99 PPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLPIPP 158 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P P P G PP PP Sbjct: 159 VVGPNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPP 200 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/104 (25%), Positives = 28/104 (26%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P P P P P P P + PP Sbjct: 41 PKAPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVP----KL 96 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P P P PP P PP P+ PP Sbjct: 97 PVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPP 140 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/115 (29%), Positives = 36/115 (31%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P P PPPP P PP PP P Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKYYSPPPVYKSP--- 94 Query: 820 PXPPPXXXPPXXP-----PPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 PPP P P PPP + P PP PP + PPP Sbjct: 95 --PPPVYKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 36.7 bits (81), Expect = 0.023 Identities = 33/115 (28%), Positives = 36/115 (31%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P P PPPP P PP + PP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPV-KYYSPPPVYKSPPPPVYKSPPPPVKHY---- 109 Query: 820 PXPPPXXXPPXXP-----PPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 PPP P P PPP + P PP PP + PPP Sbjct: 110 -SPPPVYKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/88 (26%), Positives = 25/88 (28%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXX 803 K+Y PP P P PP PP PPP P P Sbjct: 35 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP-PVKYYSPPPVYKS 93 Query: 804 PXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P PP P + PP Sbjct: 94 PPPPVYKSPPPPVKHYSPP-PVYKSPPP 120 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/93 (24%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPP-----XPPXXPGXX 788 K+Y PP P P PP PP PPP PP Sbjct: 51 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYS 110 Query: 789 PXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXX 803 KYY PP P P P PP PPPP P P Sbjct: 83 KYYSPPPVYKSPPPPVYKSPPPPVKHYSP-------PPVYKSPPPPVKHYSP--PPVYKS 133 Query: 804 PXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P Sbjct: 134 PPP--PVKHYSPPPVYKSPPPPVKHYSP 159 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 37.1 bits (82), Expect = 0.017 Identities = 34/115 (29%), Positives = 36/115 (31%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P P PPPP P PP PP P Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPV-KHYSPPPVYKSPPPPVKYYSPPPVYKSP--- 94 Query: 820 PXPPPXXXPPXXP-----PPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 PPP P P PPP + P PP PP + PPP Sbjct: 95 --PPPVYKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 36.7 bits (81), Expect = 0.023 Identities = 33/115 (28%), Positives = 36/115 (31%), Gaps = 12/115 (10%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P P PPPP P PP + PP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPV-KYYSPPPVYKSPPPPVYKSPPPPVKHY---- 109 Query: 820 PXPPPXXXPPXXP-----PPPXFPXXXPXPPXPXXXXGAGXXXPP---RRXXPPP 960 PPP P P PPP + P PP PP + PPP Sbjct: 110 -SPPPVYKSPPPPVKHYSPPPVY--KSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/88 (26%), Positives = 25/88 (28%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXX 803 K+Y PP P P PP PP PPP P P Sbjct: 35 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP-PVKYYSPPPVYKS 93 Query: 804 PXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P PP P + PP Sbjct: 94 PPPPVYKSPPPPVKHYSPP-PVYKSPPP 120 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/93 (24%), Positives = 24/93 (25%), Gaps = 5/93 (5%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPP-----XPPXXPGXX 788 K+Y PP P P PP PP PPP PP Sbjct: 51 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYS 110 Query: 789 PXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = +3 Query: 624 KYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXX 803 KYY PP P P P PP PPPP P P Sbjct: 83 KYYSPPPVYKSPPPPVYKSPPPPVKHYSP-------PPVYKSPPPPVKHYSP--PPVYKS 133 Query: 804 PXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P P PP P Sbjct: 134 PPP--PVKHYSPPPVYKSPPPPVKHYSP 159 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 37.1 bits (82), Expect = 0.017 Identities = 31/111 (27%), Positives = 33/111 (29%), Gaps = 9/111 (8%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXG---GGXGPXXGXXXXGG 789 G G GG + G G G + GG G G GG G GG Sbjct: 1522 GWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGG 1581 Query: 788 XXPRXXGGXGRGXXXXXXXXXGXGGG------GGXGXGXGGXXXGGXGGGG 654 GG G G GG GG G GG G GG G Sbjct: 1582 KKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGGWGSESGGKKSDGEGGWG 1632 Score = 36.7 bits (81), Expect = 0.023 Identities = 28/98 (28%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = -1 Query: 923 PAPXXXXGXGGXGXXXGKXG--GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGX 750 PA G G G + G G G GG G PR GG GRG Sbjct: 1433 PADHGSSGGSGWGSSQSEGGWKGNSDRSGSGRGGEYRNGGGRDGHPSGAPRPYGGRGRGR 1492 Query: 749 XXXXXXXXGXG---GGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG G GG G Sbjct: 1493 GRGRRDDMNSDRQDGNGDWGNNDTGTADGGWGNSGGGG 1530 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXG 717 GG G G G G G GGG G GG G G G G Sbjct: 1521 GGWGNSGG-GGWGSESAGKKTGGGSTGGWGSES-GGNKSDGAGSWGSGSGGGGSGGWGND 1578 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GG GG G GGG G Sbjct: 1579 SGGKKSSEDGGFGSGSGGGGSDWG 1602 Score = 33.1 bits (72), Expect = 0.28 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 3/89 (3%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGG-GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXX 726 G G GG G GG G G G GG G G Sbjct: 1509 GDWGNNDTGTADGGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSG 1568 Query: 725 GXGGGG--GXGXGXGGXXXGGXGGGGGXG 645 G G GG G GG G G G G Sbjct: 1569 GGGSGGWGNDSGGKKSSEDGGFGSGSGGG 1597 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/75 (26%), Positives = 21/75 (28%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G G G GG G G + GG G G G G Sbjct: 1507 GNGDWGNNDTG-TADGGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGS 1565 Query: 695 GXGGXXXGGXGGGGG 651 G GG GG G G Sbjct: 1566 GSGGGGSGGWGNDSG 1580 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 36.7 bits (81), Expect = 0.023 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP------PX 798 P PP P P PP P PPP P PP P P Sbjct: 207 PSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPS 266 Query: 799 XXXPXXGPXPPPXXXP----PXXPPPPXFPXXXPXPP 897 P PPP P PPP F P PP Sbjct: 267 PEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPP 303 Score = 34.7 bits (76), Expect = 0.093 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 132 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSP 191 Query: 817 GP----XPPP----XXXPPXXPPPPXFPXXXPXPP 897 PPP PP P P P PP Sbjct: 192 KVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPP 226 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 82 PPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 141 Query: 817 GP--XPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 142 KVEYKSPPPPYVYNSPPPPYY 162 Score = 30.7 bits (66), Expect = 1.5 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P P P P P P PP PP P Sbjct: 182 PPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYVYNSPPP----PYF 237 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPP P PP PP PPP Sbjct: 238 SPSPKVDYKSP---PPPYVYSSPPPPPYYSPSPEVSYKSPP----PPP 278 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 5/74 (6%) Frame = +1 Query: 652 PPP-----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPP PP PP P PPP P + PP PP P Sbjct: 249 PPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPP--PPPFY 306 Query: 817 GPXPPPXXXPPXXP 858 P P P P Sbjct: 307 SPSPKVSYKSPPAP 320 Score = 29.9 bits (64), Expect = 2.6 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPPP-----PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 PPPP P PP P PPPP P P + PP Sbjct: 148 PPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDY-KFSPPPYVYNS 206 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P PPP + P PP P PP PP Sbjct: 207 PSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPP 258 Score = 29.5 bits (63), Expect = 3.5 Identities = 26/105 (24%), Positives = 29/105 (27%), Gaps = 11/105 (10%) Frame = +1 Query: 616 KQINTIFXXXPXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGX 786 K+ + + P PP P P P PPP P PP Sbjct: 47 KKYSPYYSASPLPPLQYRRQGPKYTPHPKPYLFNSPPPPYYSPSPKEDYKSPPPPYVYNS 106 Query: 787 XPPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 151 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G G GG GG GGGG G Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG GGGG G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCG 169 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXG 819 GG G GGGG GG GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCG 169 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGG 825 G G G G GGGG GG GGG Sbjct: 146 GSHGHGCGGGGGGGGGGLGGGGCGGG 171 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGG G G GG GG GGGG G Sbjct: 144 GGGSHGHGCGGG--GGGGGGGLGG 165 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 36.7 bits (81), Expect = 0.023 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGX--GXGXGGXXXGGXGGGGGXG 645 GG G G GGGGG G G GG GG G GGG G Sbjct: 38 GGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 36.3 bits (80), Expect = 0.030 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGG-XXXGGXGGGGGXG 645 GG G G GGGGG G GG GG GGGG G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEG 77 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXG 819 GG G G GG G G+ GGG GG GGG G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGG 789 G G G G GGGG GG GGG G GG Sbjct: 44 GAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRG 753 G G G G GGG GG GGG G G GG G G G Sbjct: 35 GGAGGGEWGGAEGGGAWGGG---GGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = -1 Query: 857 GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 G G GG G G GG GG G GGG G G G G Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 F P P P P P P P P P P P P P PP Sbjct: 289 FAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 P P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P P P P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPA--------PAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 F P P P P P P P P P P P P P PP Sbjct: 289 FAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP 795 P P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 P P P P P P P P P P P P P P PP Sbjct: 291 PLPAPTPAPAPA--------PAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 36.7 bits (81), Expect = 0.023 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 2/90 (2%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF 873 P P PP PP P P PP P P P P P P Sbjct: 12 PAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLPENS 71 Query: 874 P--XXXPXPPXPXXXXGAGXXXPPRRXXPP 957 PP P PP PP Sbjct: 72 SDGSSSSSPPPPSDSSSQSQSPPPPSTSPP 101 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 PPPP P PP PPPP P P PP P P Sbjct: 44 PPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSPPPPSDSSSQSQSPPPPSTSP 100 Score = 31.9 bits (69), Expect = 0.65 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 4/90 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PPPP PP PPP P PP PP P Sbjct: 11 PPAPPPPSPPSPPSSNDQQTTSPPP-----SDNQETTSPPPPSSPDIAPPPQQQQESPPP 65 Query: 826 PPP----XXXPPXXPPPPXFPXXXPXPPXP 903 P P PPPP P P Sbjct: 66 PLPENSSDGSSSSSPPPPSDSSSQSQSPPP 95 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/86 (24%), Positives = 22/86 (25%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP PP PP P PP + P P Sbjct: 14 PPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLPENSSD 73 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PPP PP P Sbjct: 74 GSSSSSP---PPPSDSSSQSQSPPPP 96 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 257 PPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 316 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 317 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 351 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 307 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 366 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 367 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 401 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 357 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 416 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 417 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 451 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 407 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 466 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 467 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 501 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 457 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 516 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 517 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 551 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 57 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSP 116 Query: 811 ---XXGPXPPPXXXPPXXP---PPPXFPXXXPXPP 897 P PP P P P P P PP Sbjct: 117 KIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPP 151 Score = 35.1 bits (77), Expect = 0.070 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 8/92 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP----- 810 P P P PP P PPP P PP PP P Sbjct: 135 PYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVD 194 Query: 811 XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 195 YKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 226 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 157 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP----PYY 212 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P P PP + P PP P PP PP Sbjct: 213 SPSPKVDYKSP----PPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 258 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 182 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTP 241 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 242 KVDYKSPPPPYVYSSPPPPYY 262 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 207 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSP 266 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 267 KVDYKSPPLPYVYSSPPPPYY 287 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 482 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPP----PYY 537 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P P PP + P PP P PP PP Sbjct: 538 SPSPKVDYKSP----PPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 583 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 507 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 566 Query: 811 XXGPXPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 567 KVDYKSPPPPYVYSSPPPPYY 587 Score = 32.3 bits (70), Expect = 0.49 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P P PP P Sbjct: 232 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSP 291 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 292 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 326 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPP P PP PP P Sbjct: 532 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSP 589 >At5g21160.1 68418.m02528 La domain-containing protein / proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965, PF05383: La domain Length = 826 Score = 36.3 bits (80), Expect = 0.030 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 1/82 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP-PXXXXPXXGPXP 828 P P P PP P P P P P G P GP P Sbjct: 64 PAPAPAPPSKNIPTSIPIPTPAVTGQAKSKGGGKANPGHKNPSGRHSKPGPRSNQNGPPP 123 Query: 829 PPXXXPPXXPPPPXFPXXXPXP 894 PP PP FP P P Sbjct: 124 PPYLVHAVPYHPPPFPPMVPLP 145 Score = 30.7 bits (66), Expect = 1.5 Identities = 31/107 (28%), Positives = 32/107 (29%), Gaps = 4/107 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXP----PXXXXPXXG 819 PPPPP P P P PP P P P PP P Sbjct: 121 PPPPPYLVHAVPYHPPPFPPMVPLPHAAGPDFPY-APYPPYPVPVPPVTESGNEKQVQAS 179 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P PP P P P +P P GAG PR PP Sbjct: 180 PLPPVLPAPQGDPGKP-WPHQRGFDPR-NMPQGAG----PRNFGRPP 220 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PPP PP PP P P P P P PP P P Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALPPSSITRPSMPSHP 1193 Query: 832 PXXXPPXXPPP 864 P PP Sbjct: 1194 SLPLQPGFAPP 1204 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/78 (26%), Positives = 21/78 (26%), Gaps = 2/78 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPP--PPXPPXXPGXXPXXXXPXPXRXXXX 830 P P P PP PP PP PP P PP P P Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIA 1178 Query: 831 XXPXPXXXPPXPPFPXXP 884 P P P P P Sbjct: 1179 LPPSSITRPSMPSHPSLP 1196 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG-PXP 828 PP P P PP P PPPP P P P P P P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSP-----PQLAPAPPPSDHCLPPPTAPLAPAQSIALP 1180 Query: 829 PPXXXPPXXPPPPXFP 876 P P P P P Sbjct: 1181 PSSITRPSMPSHPSLP 1196 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P P P PPP P P PP P P P Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSP-PPPSSPPQLAPAPPPSDHCLPPPTAP 1170 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 112 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 171 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 172 KVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPP 206 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 287 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 346 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 347 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 381 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 337 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSP 396 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 397 KVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPP 431 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 412 PPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 471 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 472 KVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 506 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 462 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSP 521 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 522 KVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPP 556 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 162 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSP 221 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 222 KVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 256 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 212 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSP 271 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 272 KVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPP 306 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 237 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSP 296 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 297 KVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 331 Score = 34.7 bits (76), Expect = 0.093 Identities = 27/96 (28%), Positives = 27/96 (28%), Gaps = 12/96 (12%) Frame = +1 Query: 646 PXPP----PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP- 810 P PP P P PP P PPP P PP PP P Sbjct: 86 PPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPS 145 Query: 811 ----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 146 PKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 181 Score = 34.7 bits (76), Expect = 0.093 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 3/101 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 437 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPP----PYY 492 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 P P P PP + P PP PP Sbjct: 493 SPSPKVEYKSP----PPPYVYSSPPPPYHSPSPKVNYKSPP 529 Score = 34.7 bits (76), Expect = 0.093 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 487 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHPP----PYY 542 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPPRRXXPPP 960 P P P PP + P PP P PP PP Sbjct: 543 SPSPKVNYKSP----PPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 588 Score = 34.3 bits (75), Expect = 0.12 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 8/88 (9%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXGP 822 P P PP P PPP P PP PP P P Sbjct: 394 PSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 453 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP PP P P P PP Sbjct: 454 PPPYVYSSPPPPYYSPSPKVEYKSPPPP 481 Score = 31.5 bits (68), Expect = 0.86 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 F P P P PP P PPP P PP PP P Sbjct: 611 FPPLPYYSPSPKVDYKSPPLPYVYSSPPPLYYSPSPKVHYKSPPPPYVYNSPPP----PY 666 Query: 814 XGPXPPPXXXPPXXPPP 864 P P P PPP Sbjct: 667 YSPSPKVTYKSP--PPP 681 Score = 31.1 bits (67), Expect = 1.1 Identities = 30/104 (28%), Positives = 30/104 (28%), Gaps = 22/104 (21%) Frame = +1 Query: 652 PPPP----PXPPXXXPPXP-----XPXPP-----PPPXPXXXXXXXXXPRPXPPXXRGXX 789 PPPP PP P P P PP PPP P PP Sbjct: 478 PPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSH 537 Query: 790 PPXXXXP-----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP P P PP PP P P P PP Sbjct: 538 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 581 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 3/86 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP P PPP P PP PP P P Sbjct: 540 PYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPPP----PYYSPS 595 Query: 826 PP---PXXXPPXXPPPPXFPXXXPXP 894 P PP P P P P Sbjct: 596 PMVDYKSTPPPYVYSFPPLPYYSPSP 621 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 36.3 bits (80), Expect = 0.030 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -1 Query: 893 GXGXXXGKX--GGGGXXGGXXXGGGXGPXXGXXXXGGXXP-RXXGGXGRGXXXXXXXXXG 723 G G GK GGGG G GG G G GG P G GRG Sbjct: 1285 GGGSSWGKQDGGGGGSSWGKQNDGGGGSSWGKQGDGGSKPWNEHSGGGRGFGERR----- 1339 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGG 651 GGGG G GG GG Sbjct: 1340 --GGGGFRGGRNQSGRGGRSFDGG 1361 Score = 34.7 bits (76), Expect = 0.093 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 3/87 (3%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXG---GXGRGXXXXXXXXX 726 GG GGG G GGG G G GG G G Sbjct: 1225 GGSSWGKQSDAGGGSSWGKQDGGGGGSSWGKQDGGGGSGSAWGKQNETSNGSSWGKQNDS 1284 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G GG G GG G Sbjct: 1285 GGGSSWGKQDGGGGGSSWGKQNDGGGG 1311 Score = 32.3 bits (70), Expect = 0.49 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 6/86 (6%) Frame = -1 Query: 893 GXGXXXGKX---GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G GK GGG G GGG G G G G Sbjct: 1236 GGGSSWGKQDGGGGGSSWGKQDGGGGSGSAWGKQNETSNGSSWGKQNDSGGGSSWGKQDG 1295 Query: 722 XGGGGGXG---XGXGGXXXGGXGGGG 654 GGG G G GG G G GG Sbjct: 1296 GGGGSSWGKQNDGGGGSSWGKQGDGG 1321 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 4/88 (4%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXG---GXXXGGGXGPXXGXXXX-GGXXPRXXGGXGRGXXXXXXXX 729 GG G GK GGG G G G G GG G G Sbjct: 1247 GGGGSSWGKQDGGGGSGSAWGKQNETSNGSSWGKQNDSGGGSSWGKQDGGGGGSSWGKQN 1306 Query: 728 XGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG G GG GGG G Sbjct: 1307 DGGGGSSWGKQGDGGSKPWNEHSGGGRG 1334 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 2/100 (2%) Frame = -1 Query: 938 GGXXXPAPXXXXGXGGX-GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGX 762 G PAP G G G GG GGG G + G Sbjct: 1115 GNSEDPAPWSKPSGGSSWGKQDGDGGGSSWGKENDAGGGSSWGKQDNGVGSSWGKQNDGS 1174 Query: 761 GRGXXXXXXXXXGXGGG-GGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G G G GGG G Sbjct: 1175 GGGSSWGKQNDAGGGSSWGKQDSGGDGSSWGKQDGGGDSG 1214 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXGXF 639 GGGGG G G GG GG GGG G + Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSY 98 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -1 Query: 725 GXGGGGGX-GXGXGGXXXGGXGGGGG 651 G GGGG G G GG G GGGGG Sbjct: 78 GYGGGGRREGGGYGGGDGGSYGGGGG 103 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXG 792 G GG G G GGGG G GGG G G G Sbjct: 69 GSGGGGGGRG-YGGGGRREGGGYGGGDGGSYGGGGGG 104 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 36.3 bits (80), Expect = 0.030 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP 849 PP P P PPPP P +P PP PP P PP Sbjct: 378 PPYTYSPPPYAYSPPPPCPDVY-------KP-PPYVYSSPPPYVYNPPPSSPPPSPSYSY 429 Query: 850 XXPPPPXF 873 PPPP + Sbjct: 430 SSPPPPIY 437 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/94 (25%), Positives = 25/94 (26%) Frame = +3 Query: 606 YKSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGX 785 YKS Y PP P PP PP PPPP P Sbjct: 343 YKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPP 402 Query: 786 XPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P PP P + P Sbjct: 403 PYVYSSPPP----YVYNPPPSSPPPSPSYSYSSP 432 Score = 33.1 bits (72), Expect = 0.28 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 6/90 (6%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP-----PXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPP P PP P PP P P P PP PP P Sbjct: 353 PPPYAYSP---PPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPP----PYV 405 Query: 817 GPXPPPXXX-PPXXPPPPXFPXXXPXPPXP 903 PPP PP PPP PP P Sbjct: 406 YSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435 Score = 32.7 bits (71), Expect = 0.37 Identities = 31/114 (27%), Positives = 31/114 (27%), Gaps = 11/114 (9%) Frame = +1 Query: 652 PPPPPX----PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP--- 810 PPP P PP P PPP P PP PP P Sbjct: 98 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPPYAYSPPPY 157 Query: 811 XXGPXPPP--XXXPP--XXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP PPP P P PP PPP Sbjct: 158 AYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 211 Score = 32.3 bits (70), Expect = 0.49 Identities = 27/105 (25%), Positives = 27/105 (25%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP P P P P PPP P P PP P Sbjct: 29 PYSPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPP---YAYSPPPSPYVYKSPP 85 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP PP P PP PP PPP Sbjct: 86 YVYSSPPPYAYSPPPSPYVYKSPPY------VYSSPPPYAYSPPP 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/112 (24%), Positives = 29/112 (25%), Gaps = 9/112 (8%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P PPP P P P + P Sbjct: 178 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYA 237 Query: 820 PXPPPXXXPPXXPP-----PPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PPP PP PP + P P PP PP Sbjct: 238 YSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPP 289 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P PP PP P P + P P P P Sbjct: 217 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP----PYVYSSPPPYAYSPPPSPYVYK 272 Query: 836 XXPXXXXPXPP--XSPPPXP 889 P PP SPPP P Sbjct: 273 SPPYVYSSPPPYAYSPPPSP 292 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P PP PP P P + P P P P Sbjct: 241 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP----PYVYSSPPPYAYSPPPSPYVYK 296 Query: 836 XXPXXXXPXPP--XSPPPXP 889 P PP SPPP P Sbjct: 297 SPPYVYSSPPPYAYSPPPSP 316 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P PP PP P P + P P P P Sbjct: 265 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP----PYVYSSPPPYAYSPPPSPYVYK 320 Query: 836 XXPXXXXPXPP--XSPPPXP 889 P PP SPPP P Sbjct: 321 SPPYVYSSPPPYAYSPPPSP 340 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 656 PPXPXXXXXXPXXPXPXPPXXPXXPPXXXXXXXPAXXPPXXGAXXXPXXXXPXPXPXXXX 835 PP P P PP PP P P + P P P P Sbjct: 289 PPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSP----PYVYSSPPPYAYSPPPSPYVYK 344 Query: 836 XXPXXXXPXPP--XSPPPXP 889 P PP SPPP P Sbjct: 345 SPPYVYSSPPPYAYSPPPSP 364 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/83 (24%), Positives = 22/83 (26%), Gaps = 4/83 (4%) Frame = +1 Query: 652 PPP----PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG 819 PPP PP P P PPP + P P P Sbjct: 329 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYA 388 Query: 820 PXPPPXXXPPXXPPPPXFPXXXP 888 PPP PPP + P Sbjct: 389 YSPPPPCPDVYKPPPYVYSSPPP 411 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/99 (24%), Positives = 25/99 (25%), Gaps = 5/99 (5%) Frame = +3 Query: 606 YKSQTNKYYFXKXTXXXPPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPP-----PXPP 770 YKS Y PP P PP PP PPP PP Sbjct: 168 YKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPP 227 Query: 771 XXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPP 887 P P P P PP+ PP Sbjct: 228 YVYSSPPPYAYSPPPSPYVYKSP-PYVYSSPPPYAYSPP 265 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 189 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 190 KVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 224 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 239 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 240 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 274 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 289 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 290 KVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 324 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 339 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 340 KVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 374 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 389 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 390 KVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPP 424 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 439 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 440 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 474 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 105 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 164 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 165 KVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 199 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/92 (27%), Positives = 25/92 (27%), Gaps = 8/92 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP----- 810 P P P PP P PPP P PP PP P Sbjct: 58 PTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVD 117 Query: 811 XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 118 YKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 149 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 455 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 514 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 515 KVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 549 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 539 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 540 KVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 574 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 530 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSP 589 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 590 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 624 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 430 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 489 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 490 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 524 Score = 34.3 bits (75), Expect = 0.12 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 564 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 565 KVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 599 Score = 34.3 bits (75), Expect = 0.12 Identities = 24/93 (25%), Positives = 27/93 (29%), Gaps = 4/93 (4%) Frame = +1 Query: 631 IFXXXPXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPX 798 ++ P PP P P PP P PPP P + P PP PP Sbjct: 641 VYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYNSPPPP 700 Query: 799 XXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P P P P PP Sbjct: 701 YYSPSPKVYYKSPPPPSYYSPSPKVEYKSPPPP 733 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 14/96 (14%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P PP PP P Sbjct: 580 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 639 Query: 817 G---PXPPPXXXPP------XXPPPPXFPXXXPXPP 897 PPP P PP P P PP Sbjct: 640 KVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 675 Score = 30.3 bits (65), Expect = 2.0 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 13/97 (13%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPX--PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP P P PP P PPPP P PP PP P Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPP--YYSPSPKVDYKSPPPPYVYSSPPPPTYSP 362 Query: 811 -----XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 363 SPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPP 399 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 36.3 bits (80), Expect = 0.030 Identities = 31/96 (32%), Positives = 32/96 (33%), Gaps = 3/96 (3%) Frame = -1 Query: 923 PAPXXXXGXG-GXGXXXGKXGGG-GXXGGXXXGGGXG-PXXGXXXXGGXXPRXXGGXGRG 753 PA G G G G + GGG GG GG P G G GG G G Sbjct: 238 PASRYAGGYGYGRGSVGPEFGGGYNNYGGGSLGGYRNEPPLGYSSRFGPYGSGFGGEGYG 297 Query: 752 XXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GGG G GG GG GG G Sbjct: 298 RGGEGAYLGYPRGGGEGYGGYGGPGYGGAYESGGPG 333 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRG 753 G GG G G GGG G G G G GG G GRG Sbjct: 297 GRGGEGAYLGYPRGGGEGYGGYGGPGYGGAYESGGPGGSYEGAGGPYGRG 346 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 36.3 bits (80), Expect = 0.030 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PP PP PP P P P P PP Sbjct: 74 PKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXPPXXXPPXPX-PXPPPPPXP 726 +KQ I P PP PP PP PP P P PPP P P Sbjct: 61 IKQKPVIISVGP-PPKPPEPPK--PPEPEKPKPPPAPEP 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPP 771 P P PP PP P P P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPPXP 903 PPP P PP P P P P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 36.3 bits (80), Expect = 0.030 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 10/78 (12%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP------XXRGXXPPXXXXPXXGP- 822 P P PP P PPPPP PRP PP G PP GP Sbjct: 283 PPPMQFRPPQGMP-PPPPPQFLNHQQGFGGPRPPPPPQAMGMHQHGGWPPQHMQQQGGPP 341 Query: 823 ---XPPPXXXPPXXPPPP 867 PP PPPP Sbjct: 342 QQQQPPYQHHHMSMPPPP 359 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/93 (30%), Positives = 28/93 (30%), Gaps = 6/93 (6%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPXXXXPXXGPXPPP 834 P P P P P P PP P P P P PP PP Sbjct: 238 PRPFANGSMQPVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPM------QFRPP 291 Query: 835 XXXPPXXPPPPXF-----PXXXPXPPXPXXXXG 918 PP PPPP F P PP P G Sbjct: 292 QGMPP--PPPPQFLNHQQGFGGPRPPPPPQAMG 322 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P P PPPP P P PP P G PPP P Sbjct: 250 PIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPP--PPQFLNHQQ 307 Query: 868 XFPXXXPXPPXPXXXXGAGXXXPPR 942 F P PP PP+ Sbjct: 308 GFGGPRPPPPPQAMGMHQHGGWPPQ 332 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G G GG GG GGG G Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGGGG 90 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXG----XXXXGGXXPRXXGGXGRG 753 GG G G+ GGG GG GGG G GG P GG G G Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHTGG-GNG 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 872 KXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXG 693 K GGGG GG GG GG RG GG G G G Sbjct: 63 KKGGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGGVVPIHT--GGGNGSLGGG 120 Query: 692 XGG 684 G Sbjct: 121 SAG 123 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXP 726 P PPPPP P P P PPPPP P Sbjct: 100 PQPPPPPQPLNLFSPPP---PPPPPDP 123 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 613 LKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXP 726 LKQ PPP PP P PPPPP P Sbjct: 84 LKQHRASMRQATRIPPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP 720 P PPPP P P P PPP P Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXP 779 P PP P PPPP PP P Sbjct: 100 PQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPP 771 P P PPPPP P P P P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGGG G GG GGGGG G Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGG 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGGG G GG GGGGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGG 133 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G GGGGG G G GG GGGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGG------GGGGGGGG 139 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGP 816 GGGG GG GGG GP Sbjct: 124 GGGGGGGGGGGGGGGGP 140 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = -1 Query: 902 GXGGXGXXXG----KXGGGGXXGGXXXGGGXG 819 G GG G K GGGG GG GGG G Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -1 Query: 872 KXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXG 693 K GGGG GG GG GG GG G G GGG Sbjct: 37 KGGGGGAHGG----GGV-----HVSVGGAHASVGGGHASGGGGHASVGGGHASGGGGHAV 87 Query: 692 XGGXXXGGXGGGGG 651 GG GG GGG G Sbjct: 88 EGGGHAGGGGGGHG 101 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 35.9 bits (79), Expect = 0.040 Identities = 34/113 (30%), Positives = 34/113 (30%), Gaps = 11/113 (9%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXP---XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP- 822 PPP PP PP P PPPP P PP P GP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPP-------HMGGSAPPPPHMGQNYGPPPPNNMGGPR 293 Query: 823 XPPPXXXPP----XXPPPPXFPXXXPXP---PXPXXXXGAGXXXPPRRXXPPP 960 PPP PP P PP P P P G P PPP Sbjct: 294 HPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPP 346 Score = 33.9 bits (74), Expect = 0.16 Identities = 31/109 (28%), Positives = 32/109 (29%), Gaps = 6/109 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG--XXPPXXXXP----X 813 PPPPP PP P PP P P PP G PP P Sbjct: 251 PPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYG----PPPPNNMGGPRHPPPYGAPPQNNM 306 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 GP PP P P P G G PP+ PP Sbjct: 307 GGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGG--PPPQYGAVPP 353 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/103 (23%), Positives = 25/103 (24%), Gaps = 3/103 (2%) Frame = +3 Query: 657 PPXPXXXXXXPXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXX 836 PP P P PP PPPP P P P Sbjct: 252 PPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRP 311 Query: 837 PXPXXXPPXPPFPXXPP---XXXXPXXXXGXGXXXXXPAXAPP 956 P P P + PP P G G A PP Sbjct: 312 PQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPPQYGAVPPP 354 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/94 (27%), Positives = 27/94 (28%) Frame = +1 Query: 661 PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXX 840 P P P P PPP P P P G PP P P P Sbjct: 46 PFTPSASQPTRPFTASGPPPAPPVGTMRPGQPSPFVSQIPGSRPP---PPSSNSFPSPAY 102 Query: 841 XPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPR 942 PP P F P PP P PP+ Sbjct: 103 GPPGGAPFQRF----PSPPFPTTQNPPQGPPPPQ 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/88 (26%), Positives = 23/88 (26%), Gaps = 7/88 (7%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP-- 828 P P PP P P P RP PP P P P Sbjct: 54 PTRPFTASGPPPAPPVGTMRPGQPSPFVSQIPGSRPPPPSSNSFPSPAYGPPGGAPFQRF 113 Query: 829 -----PPXXXPPXXPPPPXFPXXXPXPP 897 P PP PPPP PP Sbjct: 114 PSPPFPTTQNPPQGPPPPQTLAGHLSPP 141 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 7/98 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P P P P PP P Sbjct: 62 PYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPS 121 Query: 826 PPPXXXPPXXP-------PPPXFPXXXPXPPXPXXXXG 918 P P P PPP P PP P G Sbjct: 122 TPSHPTPSHPPSGGYYSSPPPRTPVVV-TPPSPIVDPG 158 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/97 (24%), Positives = 24/97 (24%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP P P P P P P P P P P Sbjct: 48 PPSHTPPSSNCGSP-PYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCN 106 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PP P P P P G PP R Sbjct: 107 CGSPPSHPSTPSHPSTPSHPTPSHPPSGGYYSSPPPR 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 2/85 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX-PXPXPPPPPXPXXXXXXXXXPRPXP-PXXRGXXPPXXXXPXXG 819 P PP PP P P P P P P P P P P Sbjct: 48 PPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNC 107 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP 894 PP P P P P P Sbjct: 108 GSPPSHPSTPSHPSTPSHPTPSHPP 132 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 766 PPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP P PP P P P P P P P Sbjct: 40 PPSGSHGTPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTP 85 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 35.9 bits (79), Expect = 0.040 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 7/98 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P PP P P P P P P PP P Sbjct: 62 PYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPPSHPSTPSHPS 121 Query: 826 PPPXXXPPXXP-------PPPXFPXXXPXPPXPXXXXG 918 P P P PPP P PP P G Sbjct: 122 TPSHPTPSHPPSGGYYSSPPPRTPVVV-TPPSPIVDPG 158 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/97 (24%), Positives = 24/97 (24%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PP PP P P P P P P P P P P Sbjct: 48 PPSHTPPSSNCGSP-PYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCN 106 Query: 835 XXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRR 945 PP P P P P G PP R Sbjct: 107 CGSPPSHPSTPSHPSTPSHPTPSHPPSGGYYSSPPPR 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 2/85 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPX-PXPXPPPPPXPXXXXXXXXXPRPXP-PXXRGXXPPXXXXPXXG 819 P PP PP P P P P P P P P P P Sbjct: 48 PPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNC 107 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXP 894 PP P P P P P Sbjct: 108 GSPPSHPSTPSHPSTPSHPTPSHPP 132 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +1 Query: 766 PPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 PP PP P PP P P P P P P P Sbjct: 40 PPSGSHGTPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTP 85 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 35.9 bits (79), Expect = 0.040 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 82 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 141 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 142 KVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPP 176 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 157 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 216 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 217 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 251 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 132 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 191 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 192 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 226 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 207 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 266 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 267 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 301 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 232 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 291 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 292 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 326 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 257 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 316 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 317 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 351 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 282 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 341 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 342 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 376 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 307 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 366 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 367 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 401 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 357 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSP 416 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 417 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 451 Score = 34.3 bits (75), Expect = 0.12 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 332 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 391 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 392 KVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 426 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 8/88 (9%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXGP 822 P P PP P PPP P PP PP P P Sbjct: 64 PSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 123 Query: 823 XPP---PXXXPPXXPPPPXFPXXXPXPP 897 PP PP P P P PP Sbjct: 124 PPPYVYSSPPPPYYSPSPKVDYKSPPPP 151 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 7/81 (8%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P PP PP P Sbjct: 407 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 466 Query: 817 GP--XPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 467 KVYYKSPPPSYVYSSPPPPYY 487 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 7/81 (8%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P PP PP P Sbjct: 382 PPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 441 Query: 817 GP--XPPPXXXPPXXPPPPXF 873 PP PPPP + Sbjct: 442 KVYYKSPPPPYVYSSPPPPYY 462 Score = 30.7 bits (66), Expect = 1.5 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 PPPP P P PP P PPP P P PP P Sbjct: 432 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSP 491 Query: 817 G---PXPPP-----XXXPPXXPPPPXFPXXXPXPP 897 PPP PP P P P PP Sbjct: 492 KVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPP 526 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/84 (26%), Positives = 22/84 (26%), Gaps = 8/84 (9%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXGPXPP- 831 P P P PPP P PP PP P P PP Sbjct: 43 PKYAPHPKPYVKSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPY 102 Query: 832 --PXXXPPXXPPPPXFPXXXPXPP 897 PP P P P PP Sbjct: 103 VYSSPPPPYYSPSPKVDYKSPPPP 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP PPP P P PP P Sbjct: 457 PPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSP 516 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 517 KVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPP 551 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 35.9 bits (79), Expect = 0.040 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR----PXPPXXRGXXPPXXXXPXXG 819 PP P PP P P PP P P PP P Sbjct: 69 PPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPNPPVTV 128 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP P P P P PP Sbjct: 129 PNPPESSSNPNPPDSSSNPNSNPNPP 154 Score = 35.9 bits (79), Expect = 0.040 Identities = 30/110 (27%), Positives = 30/110 (27%), Gaps = 5/110 (4%) Frame = +1 Query: 646 PXPPPP---PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPP--XXXXP 810 P PP P PP P P P P P PP PP P Sbjct: 151 PNPPESSSNPNPPVTVPNPPESSSNPNPPESSSNPNPPITIPYPPESSSPNPPEIVPSPP 210 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 G P P PP P P P P P PP P P Sbjct: 211 ESGYTPGPVLGPPYSEPGPSTPTG--SIPSPSSGFLPPIVYPPPMAPPSP 258 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/98 (24%), Positives = 25/98 (25%), Gaps = 2/98 (2%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP PP P P PP P P P P P PP Sbjct: 44 PPYVSLPPLSVPGNAPPFCINPPNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPP 103 Query: 832 PXXXPPXXPPPPXFPXXXPXPP--XPXXXXGAGXXXPP 939 P P P P PP P + PP Sbjct: 104 ESSSNPNPPDSSSNPNSNPNPPVTVPNPPESSSNPNPP 141 Score = 31.9 bits (69), Expect = 0.65 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 5/87 (5%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR----PXPPXXRGXXPPXXXXPXXG 819 P PP PP P PP P P P P P P Sbjct: 176 PNPPESSSNPNPPITIPYPPESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPGPSTPTGS 235 Query: 820 -PXPPPXXXPPXXPPPPXFPXXXPXPP 897 P P PP PPP P P Sbjct: 236 IPSPSSGFLPPIVYPPPMAPPSPSVTP 262 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/101 (22%), Positives = 23/101 (22%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PP PP P P P P P P P PP Sbjct: 129 PNPPESSSNPNPPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNPPESSSNPNPP 188 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXP 954 P P P P PP G P P Sbjct: 189 ITIPYPPESSSPNPPEIVPSPPESGYTPGPVLGPPYSEPGP 229 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGG 651 G GGGGG G GG G GGGGG Sbjct: 193 GGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G G G G G GGG G Sbjct: 193 GGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -1 Query: 725 GXGG--GGGXGXGXGGXXXGGXGGG-GGXGXFXK 633 G GG GGG G G G GG G G GG G F K Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAGAGSGGGGGFSK 220 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGG 654 GGGGG G GG G GGGG Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGG 207 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G GG G GGGG G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAG 209 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -1 Query: 725 GXGGGG-GXGXGXGGXXXGGXGGGGGXG 645 G GGG G G G G GG G G G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSG 213 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGG 825 GG G G GGGG G GGG Sbjct: 194 GGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXG 807 G GG G GG G GG G G G G Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 P PP P P PP P PPP P PP PP P Sbjct: 338 PPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSP 397 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 398 KVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPP 432 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 288 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 347 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 348 NVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 382 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 313 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSP 372 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 373 KVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 407 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 113 PPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 172 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 173 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 207 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 163 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 222 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 223 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 257 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 188 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 247 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 248 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 282 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 213 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 272 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 273 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 307 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 238 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 297 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 298 KVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 332 Score = 34.7 bits (76), Expect = 0.093 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 13/95 (13%) Frame = +1 Query: 652 PPPP---PXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-- 810 PPPP P P PP P PPP P PP PP P Sbjct: 263 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSP 322 Query: 811 ---XXGPXPP---PXXXPPXXPPPPXFPXXXPXPP 897 P PP PP P P P PP Sbjct: 323 KVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPP 357 Score = 33.5 bits (73), Expect = 0.21 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 3/108 (2%) Frame = +1 Query: 646 PXPP---PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXX 816 P PP P P PP P PPP P PP PP P Sbjct: 63 PPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPPP----PYY 118 Query: 817 GPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PPP + P P PP PP Sbjct: 119 SPSPKVYYKSP--PPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPP 164 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/84 (26%), Positives = 22/84 (26%), Gaps = 8/84 (9%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP-----XXGPXPP- 831 P P P PPP P PP PP P P PP Sbjct: 49 PKYAPHPKPYVYSSPPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPY 108 Query: 832 --PXXXPPXXPPPPXFPXXXPXPP 897 PP P P P PP Sbjct: 109 VYSSPPPPYYSPSPKVYYKSPPPP 132 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG R G G G GGGGG G G GG GGGG G Sbjct: 548 GGGKKRSGGRFG-GRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GGG G GG G GG GG G G GGGG G G G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGG----GGGGGGSDYY-------GGGGYGGGGYG 596 Query: 686 GXXXGGXGGG 657 G GG G G Sbjct: 597 GAPSGGYGAG 606 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -1 Query: 827 GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG--GG 654 G G GG R G RG G GGGG G GG GG GG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGG------GGGGGGSDYYGGGGYGGGGYGGAPSG 601 Query: 653 GXG 645 G G Sbjct: 602 GYG 604 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGG--XXGGXXXGGGXG 819 GGG R GG G G G GGG GG GGG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG G G GGG G Sbjct: 48 GGQPAGSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGG 89 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 35.5 bits (78), Expect = 0.053 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG R G G G GGGGG G G GG GGGG G Sbjct: 548 GGGKKRSGGRFG-GRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 GGG G GG G GG GG G G GGGG G G G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGG----GGGGGGSDYY-------GGGGYGGGGYG 596 Query: 686 GXXXGGXGGG 657 G GG G G Sbjct: 597 GAPSGGYGAG 606 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -1 Query: 827 GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGG--GG 654 G G GG R G RG G GGGG G GG GG GG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGG------GGGGGGSDYYGGGGYGGGGYGGAPSG 601 Query: 653 GXG 645 G G Sbjct: 602 GYG 604 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGG--XXGGXXXGGGXG 819 GGG R GG G G G GGG GG GGG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYG 596 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG GG G G GGG G Sbjct: 48 GGQPAGSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGG 89 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 685 PPXPXPXPPPPP 720 PP P P PPPPP Sbjct: 6 PPPPPPPPPPPP 17 Score = 28.3 bits (60), Expect(2) = 0.064 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 685 PPXPXPXPPPPP 720 PP P P PPPPP Sbjct: 7 PPPPPPPPPPPP 18 Score = 25.8 bits (54), Expect(2) = 0.064 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 646 PXPPPPPXPP 675 P PPPPP PP Sbjct: 6 PPPPPPPPPP 15 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGG 651 GG G G G GG GG GGGGG Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGG 50 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 713 GGGXGXGXGGXXXGGXGGGGGXG 645 GG G G GG G GGGGG G Sbjct: 28 GGSSGCGAGGGGGGSGGGGGGGG 50 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXG 807 G GG G G GG G GGG G G Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGG 47 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGG G G G G GGGG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGG 41 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G G G G GGGGG G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSG 43 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGG 825 G G G GGGG GG GGG Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGG 50 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 35.1 bits (77), Expect = 0.070 Identities = 26/112 (23%), Positives = 29/112 (25%), Gaps = 2/112 (1%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXX--PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXX 804 ++ PPP PP P P P P P P + PP Sbjct: 60 VYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPPVYTKPTIPPPVY 119 Query: 805 XPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 P P P PP P P P P PP P P Sbjct: 120 TPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSPPPPYVPKP 171 Score = 32.3 bits (70), Expect = 0.49 Identities = 30/108 (27%), Positives = 34/108 (31%), Gaps = 10/108 (9%) Frame = +1 Query: 604 IINLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPP------PXPXXXXXXXXXPRPX 765 I++L I T P PP P P P P PP P P Sbjct: 13 ILSLVTITTADYYSPSSPPVYKSPEHKPTLPSPVYTPPVYKPTLSPPVYTKPTIPPPVYT 72 Query: 766 PPXXR-GXXPPXXXXPXXGPXPPPXXXPPXXPP---PPXFPXXXPXPP 897 PP + PP P PPP PP P PP + PP Sbjct: 73 PPVYKHTPSPPVYTKP---TIPPPVYTPPVYKPTLSPPVYTKPTIPPP 117 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 1/85 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP- 822 P PP P PP P PP P P PP P P Sbjct: 45 PVYTPPVYKPTLSPPV-YTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPT 103 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPP 897 PP P PPP P P Sbjct: 104 LSPPVYTKPTIPPPVYTPPVYKPTP 128 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 35.1 bits (77), Expect = 0.070 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 P PPP P PPPP P P PP + P P P PP Sbjct: 121 PSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITP--SPPPP 178 Query: 832 PXXXP 846 P Sbjct: 179 SKILP 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 P P PP P P PPPPP P P PP Sbjct: 135 PITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPPPP P PPPP Sbjct: 155 PPPPPPPSKTHEPSRRITPSPPPP 178 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXF 873 P P PP P P PP PP P PP PP P Sbjct: 116 PLAITPSPPPPSKTHERSRPITPSPP------PPSKTHEPSRPNTPPPPPPPSKTHEPS- 168 Query: 874 PXXXPXPPXP 903 P PP P Sbjct: 169 RRITPSPPPP 178 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 35.1 bits (77), Expect = 0.070 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = -1 Query: 863 GGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGG 684 G G G GGG G G R GG G G GG G G Sbjct: 501 GVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSS 560 Query: 683 XXXGGXGGGGGXGXF 639 GG G G F Sbjct: 561 RYSGGSDRSSGFGSF 575 Score = 33.1 bits (72), Expect = 0.28 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXG 723 G G G GGG G G GG R GG G Sbjct: 503 GARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGG-SYGGSGGSSSR 561 Query: 722 XGGGGGXGXGXGGXXXGGXGGGGG 651 GG G G GG GG G Sbjct: 562 YSGGSDRSSGFGSFGSGGSSGGFG 585 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 35.1 bits (77), Expect = 0.070 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP-XPXXXXXXXXXPRPXPP 771 P P PP PP PP P PPP P P P PP Sbjct: 170 PSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPP 212 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP---XPPPPP 720 PPPP PP P P PPPPP Sbjct: 19 PPPPAAVSSAAPPHPPPIHHHPPPPP 44 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 646 PXPPP-PPXPPXXXPPXPXPXPPPPPXP 726 P PPP P PP P P PPP P Sbjct: 190 PAPPPYDPYAGYHAPPVPMPTPPPIAAP 217 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 35.1 bits (77), Expect = 0.070 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGX 696 G GG G G GG G G GG RG G GG Sbjct: 205 GGRGGRGGARGGRGGGARGGRGGSRDFGGGGRDFGSSSDRGGRSGGRDFGGRRGGASTS- 263 Query: 695 GXGGXXXGGXGGG 657 GG GG GGG Sbjct: 264 SRGGKRGGGRGGG 276 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = -1 Query: 902 GXGGXGXXXGKXGGG---GXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXX 732 G GG G G GGG G G GGG GG G RG Sbjct: 206 GRGGRGGARGGRGGGARGGRGGSRDFGGGGRDFGSSSDRGGRSGGRDFGGRRGGASTSSR 265 Query: 731 XXGXGGGGGXG 699 GGG G G Sbjct: 266 GGKRGGGRGGG 276 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXP 726 PPP P P PP P P PP PP P Sbjct: 21 PPPAPPPESSSPPTP-PEPPDPPDP 44 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 5/81 (6%) Frame = +1 Query: 670 PPXXXPPXPXPXPPPPP--XPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP---PP 834 PP P P PPP P P P PP P P P P P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPD 109 Query: 835 XXXPPXXPPPPXFPXXXPXPP 897 PP P P PP Sbjct: 110 MPSPPMPSGMESSPSPGPMPP 130 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 4/88 (4%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPP----PPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPX 813 P P P P PP P PP PPP P P P P P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPD 109 Query: 814 XGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 P PP P P P P Sbjct: 110 M-PSPPMPSGMESSPSPGPMPPAMAASP 136 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PPP P P P P PPP P PP P P PP Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPP-----------MPMTPPPM------PMAPPPMPMASPP 92 Query: 832 PXXXPPXXPPPPXFPXXXPXPPXP 903 P P P P PP P Sbjct: 93 MMPMTPSTSPSPLTVPDMPSPPMP 116 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 1/71 (1%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPXXXXPXXGPXPPP 834 P P P P P PP P P P P PP P G Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSE 182 Query: 835 XXXPPXXPPPP 867 PP P PP Sbjct: 183 TLTPPPAPLPP 193 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P P P P P PP P P P G P P Sbjct: 132 PSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPL 191 Query: 826 PP 831 PP Sbjct: 192 PP 193 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP-XP 828 PP P P P P P PP P P PP PP P P Sbjct: 131 PPSTPSTPSSPPSTPS-TPSSPPSPPSPPSPSLPPSSLPP---SASPPTNGTPDSETLTP 186 Query: 829 PPXXXPPXXPP 861 PP PP P Sbjct: 187 PPAPLPPSLSP 197 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/75 (25%), Positives = 19/75 (25%) Frame = +3 Query: 735 PXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPFPXXPPXXXXPXXXX 914 P P P P P P P P PP PP P PP P Sbjct: 117 PVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPS---PPSPPSPSLPPSSLPPSASP 173 Query: 915 GXGXXXXXPAXAPPP 959 PPP Sbjct: 174 PTNGTPDSETLTPPP 188 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 34.7 bits (76), Expect = 0.093 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 PP PP PP P P PPP P P P PP +G Sbjct: 22 PPEKPPSPEPP-PSPEPPPSPEKPTSPEQPSSPEP-PPHCQG 61 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P P PPP RP P PP P P P P P PP Sbjct: 2 PSPEPPPHCRGFHCHRSNHRP-PEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 706 PPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXX 885 P P P P PP P P P PPP P P P P Sbjct: 2 PSPEPPPHCRGFHCHRSNHRPPEK-----PPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Query: 886 P 888 P Sbjct: 57 P 57 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXG 918 P PPP PP P P P P P G Sbjct: 29 PEPPPSPEPPPSPEKPTSPEQPSSPEPPPHCQG 61 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP RG P PP PP P PP P P P Sbjct: 4 PEP-PPHCRGFH--CHRSNHRPPEKPPSPEPPPSPEPPPSPEKPTSPEQP 50 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGG 651 G GGG G G G GG GGGGG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGGG 216 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G GG GG GGGGG G Sbjct: 194 GDGGGF----GGGGSGFGGGGGGGGGG 216 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 1/78 (1%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXX 843 P PP P P PPPP P P P P PP P P Sbjct: 42 PPPPQVFVPEPLFSEPPPP-PKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQ 100 Query: 844 PPXXPP-PPXFPXXXPXP 894 P P P F P P Sbjct: 101 EPTTPTMTPGFSLSPPSP 118 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PPPPP P P PPPP P R PP Sbjct: 57 PPPPPKAPVNVSLSP---PPPPRSPSTSTPPRLGNRNPPP 93 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPP 720 PPPP P PP PPPP Sbjct: 72 PPPPRSPSTSTPPRLGNRNPPPP 94 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 34.7 bits (76), Expect = 0.093 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGG-GGXG 645 G GGGG G GG GG GGG GG G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSG 88 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGGXG 645 GGGG G G GG GG GGG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGG 35 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G G GG GGGG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GGG G G GG G GGGG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 34.7 bits (76), Expect = 0.093 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 10/86 (11%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPP-XPXXXXXXXXXPRPXPPXXRGXXPPXXXXP---- 810 P PPP PP P PPPP P P PP G PP P Sbjct: 8 PESYPPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYP---PPQPYGGYPPPSSRPYEGG 64 Query: 811 -----XXGPXPPPXXXPPXXPPPPXF 873 G P PP PPP + Sbjct: 65 YQGYFAGGGYPHQHHGPPPPPPPQNY 90 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 844 PPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP--RRXXPPP 960 PP PPP + P P P G PP PPP Sbjct: 7 PPESYPPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPP 47 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G GG G G G GG GGGGG G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDG 104 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 34.3 bits (75), Expect = 0.12 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 2/103 (1%) Frame = -1 Query: 959 GGGXXRR-GGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXX 783 GGG RR GG G GGGG GG GGG G GG Sbjct: 545 GGGKNRRSGGRFGGRDFRRESFSRGGGGADYYGGGGGYGGVP-GGGYG-----AMPGGYG 598 Query: 782 PRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXG-GXGGG 657 P GG G G GGG G G G G G G Sbjct: 599 PVPGGGYG-NVPGGGYAPYGRGGGAYYGPGGYGTVPNQGYGPG 640 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 GG R GG G GGGG G GG G GGG G Sbjct: 545 GGGKNRRSGGRF-GGRDFRRESFSRGGGGADYYGGGGGYGGVPGGGYG 591 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGG 651 GGGG G G GG GG G GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGG 45 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGG 654 GGGGG G G G G GGGG Sbjct: 25 GGGGGHGGGGHGRGGHGRGGGG 46 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 652 PPPPPXPPXXXPP----XPXPXPPPPPXPXXXXXXXXXPRPXPP 771 PPPPP PP P P PPP P P P PP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPPP 55 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP PP P P PP P P PP PP P PP Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 646 PXPPP--PPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXP 810 P PP PP P PP P PP P P PP + P P Sbjct: 28 PSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 766 PPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPP--PPXFPXXXPXPPXPXXXXGAGXXXPP 939 PP PP P P P PP PP PP P P P P PP Sbjct: 27 PPSQPPSHPPIQ--PSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 687 PXXXXXXPPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXP 845 P PP PP PP PP P P P P P P P Sbjct: 44 PTQPPSQPPTQPPTQPPSH--PPTQPPTPPPSQSPSQPSPLPPNIACKSTPYP 94 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 685 PPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPP 864 P P PP P P PP PP P P PPP P P Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHP-PTQPPTPPPSQSPSQPSPL 82 Query: 865 P 867 P Sbjct: 83 P 83 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +1 Query: 760 PXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P + P P P PP P P PP P P P P Sbjct: 36 PIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPP--PSQSPSQPSP 81 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXP 696 F P PPPPP PP PP P Sbjct: 221 FKFSPPPPPPPSPPQSSPPSP 241 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPP 867 P PPP P PP P Sbjct: 226 PPPPPPSPPQSSPPSP 241 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 700 PXPPPPPXP 726 P PPPPP P Sbjct: 225 PPPPPPPSP 233 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 634 FXXXPXPPPPPXPPXXXPPXP 696 F P PPPPP PP PP P Sbjct: 221 FKFSPPPPPPPSPPQSSPPSP 241 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 820 PXPPPXXXPPXXPPPP 867 P PPP P PP P Sbjct: 226 PPPPPPSPPQSSPPSP 241 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 700 PXPPPPPXP 726 P PPPPP P Sbjct: 225 PPPPPPPSP 233 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPP 714 PPPPP PP P P PPP Sbjct: 9 PPPPPPPPPSFRSIPRPPPPP 29 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +1 Query: 631 IFXXXPXPPPPPXPPXXXPPXPXPXPP----PPPXPXXXXXXXXXPRPXPP 771 I P PPPPP P P P P P PP P P PP Sbjct: 4 ILSFTPPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPP 54 Score = 32.3 bits (70), Expect = 0.49 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPX 879 P PPPPP P PRP PP PP P PPPP P Sbjct: 9 PPPPPPPPPSFRSI----PRPPPPPSFRSIPPRRHFFKKKSKSLP-------PPPPPLPP 57 Query: 880 XXPXPP 897 P P Sbjct: 58 ARPFGP 63 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXPPF-PXXP 884 PP PP P P PP PP P + P P PP PF P P Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRRH--FFKKKSKSLPPPPPPLPPARPFGPILP 66 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 33.9 bits (74), Expect = 0.16 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPP 834 PPPP P P P P P PRP P G PP P PP Sbjct: 48 PPPPMPGSGPRPSPPFGQSPQSFP---QQQQQQPRPSPMARPGPPPP---AAMARPGGPP 101 Query: 835 XXXPPXXPPPPXFPXXXPXPPXP 903 P PP P P P Sbjct: 102 QVSQPGGFPPVGRPVAPPSNQPP 124 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/106 (26%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXX-PPXXXXPXXGP 822 P PP P PP P PP P P P G P P GP Sbjct: 97 PGGPPQVSQPGGFPPVGRPVAPPSNQPPFGGR----PSTGPLVGGGSSFPQPGGFPASGP 152 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPPP 960 PP P F P P +G P PPP Sbjct: 153 PGGVPSGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPP 198 Score = 30.7 bits (66), Expect = 1.5 Identities = 32/113 (28%), Positives = 32/113 (28%), Gaps = 8/113 (7%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P P P PP PP P PP RP P PP P GP Sbjct: 80 PSPMARPGPP---PPAAMARPGGPPQVSQPGGFPPVGRPVAPPSN--QPPFGGRPSTGPL 134 Query: 826 PPPXXXPPXXPPPPXFPXXXP------XPPXPXXXXGAGXXXP--PRRXXPPP 960 P P FP P PP G G P P PPP Sbjct: 135 ---VGGGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGSPPPMGPGMSMPPP 184 Score = 28.7 bits (61), Expect = 6.1 Identities = 26/105 (24%), Positives = 26/105 (24%), Gaps = 2/105 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPX 825 P PP PP P P P PP PP P Sbjct: 115 PVAPPSNQPPFGGRPSTGPLVG---GGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGS 171 Query: 826 PPPXXXPPXXPPPPXFP--XXXPXPPXPXXXXGAGXXXPPRRXXP 954 PPP PPP P PP G PP P Sbjct: 172 PPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMP 216 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG G G G GGGGG G Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYG 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGG 651 G GGGG G GG GG GGG G Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYG 85 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGGXG 645 GGGGG GG G GGGG G Sbjct: 62 GGGGGSIGNHGGGSGSGGGGGGYGG 86 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GRG GGGG G GG G GG G Sbjct: 75 GGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRG 116 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 716 GGGGXGXGXGGXXXGGXGGGGG 651 GGGG G G GG GG GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGG 94 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -1 Query: 872 KXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXG 693 K GGGG GG GGG G GG R GG GGGG G Sbjct: 72 KGGGGGGRGGGGFGGGGRSFGG----GGSSSRGGGGSS-----------SRGGGGSSSRG 116 Query: 692 XGGXXXGGXGGG 657 G GGG Sbjct: 117 GGLRPIPIYGGG 128 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = -1 Query: 887 GXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGG-XGRGXXXXXXXXXGXGGG 711 G G+ GGG GG GGG G GG R GG RG G G Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRG---GGGSSSRGGGGSSSRGGGLRPIPIYGGGTH 130 Query: 710 GGXGXGXGG 684 GG Sbjct: 131 RSGHHSSGG 139 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 GG G G G GGG GG GGGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 652 PPPPPXPPXXXPP---XPXPXPPPPP 720 PPPPP PP PP P PPP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTP 218 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPP P PP P P P PP Sbjct: 196 PPPPPTPRPPRLLSSQPAPPPTPP 219 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXP 726 PPPPP P P P PPP P Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTP 218 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 694 PXPXPPPPPXPXXXXXXXXXPRPXPP 771 P P PPP P P P P PP Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPP 219 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXGXFXKIVF 624 G G GGG GG GG GG GG G ++F Sbjct: 74 GGGDGGGCDGDAGGGDGGGCGGCGGCGVCGFVIF 107 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGG-GGXGXFXKIVFICLRFII 603 G GGGG G G G GG GGG GG G F+ I+ Sbjct: 70 GGCGGGGDGGGCDGDAGGGDGGGCGGCGGCGVCGFVIFPSIV 111 >At5g28480.1 68418.m03462 hypothetical protein Length = 1230 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG G G GG GG G G G Sbjct: 423 GGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEG 464 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GG G G GG GG GG G G Sbjct: 417 GEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEG 455 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 827 GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G G GG GG G G G GG G G G GG G G Sbjct: 417 GEGGPSGGDGEGGPS----GGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGADG 471 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 625 NTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXP 726 N + P PPPPP P PP P P P P P Sbjct: 81 NNVDPASPQPPPPP-PIENLPPPPPPLPKFSPSP 113 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 616 KQINTIFXXXPXPPPPPXPPXXXPPXPXP---XPPPPPXP 726 K+++++ P PPPP P P P PPPPP P Sbjct: 397 KKLDSVKPLLPTLPPPPVIEITRDPSPPPSPVQPPPPPSP 436 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP 714 P PPP P P PP P P P P Sbjct: 421 PSPPPSPVQP---PPPPSPPPQP 440 >At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; glycine-rich protein 17 (GRP17) PMID:11431566; function: pollen recognition (PMID:10655594) Length = 543 Score = 33.5 bits (73), Expect = 0.21 Identities = 28/110 (25%), Positives = 30/110 (27%), Gaps = 5/110 (4%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXX-----GGGXGPXXGXXXX 795 GG ++ G GG G GGG GG GG G G Sbjct: 430 GGKFGKKRGMSGSGGGMSGSEGGVSGSEGSMSGGGMSGGSGSKHKIGGGKHGGLRGKFGK 489 Query: 794 GGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG GGG G G GG GGG G Sbjct: 490 KRGMSGSEGGMSGSEGGMSESGMSGSGGGKHKIGGGKHKFGGGKHGGGGG 539 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 901 GXXXXGGXXGXGGXGGXXXGXGXXXXXXRXGXGXXXXGXXPGXXGGXGGG 752 G GG GG G G G G G G PG GG GGG Sbjct: 96 GLRRFGGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGGG 145 Score = 31.9 bits (69), Expect = 0.65 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -2 Query: 883 GXXGXGGXGGXXXGXGXXXXXXRXGXGXXXXGXXPGXXGGXGGGGXXXXGGXXGGXXGG 707 G GG G + G G G PG GG GGGG G GG GG Sbjct: 90 GRRRFGGLRRFGGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLP---GGLGGLGGG 145 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -1 Query: 779 RXXGGXGR-GXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 R GG R G G GGGG G G GG GGGG G Sbjct: 92 RRFGGLRRFGGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPG 137 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 959 GGGXXRRGGXXXPAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGP 816 GGG G P G G G G GGG G GGG P Sbjct: 101 GGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGGGENP 148 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG G G GG GG G G G Sbjct: 436 GGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEG 477 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GG G G GG GG GG G G Sbjct: 430 GEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEG 468 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 827 GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G G GG GG G G G GG G G G GG G G Sbjct: 430 GEGGPSGGDGEGGPS----GGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGADG 484 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 33.5 bits (73), Expect = 0.21 Identities = 28/94 (29%), Positives = 28/94 (29%), Gaps = 18/94 (19%) Frame = +1 Query: 646 PXPPPPPXPP---------------XXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXR 780 P PPPPP PP P P P PPPP R P R Sbjct: 365 PPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPPERRYESRASTSKLRKAPVESR 424 Query: 781 --GXXPPXXXXPXXGPXPPPXXXP-PXXPPPPXF 873 PP G P P PPPP F Sbjct: 425 TSKPNPPAKVTQYVGTGSESPLMPIPPPPPPPPF 458 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 732 PPXXXXPPPPXPPXXPGXXPXXXXPXPXRXXXXXXPXPXXXPPXP 866 PP PPPP PP P P P PP P Sbjct: 359 PPLVYSPPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPP 403 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 P P P PP P P PPPPP +P P RG Sbjct: 252 PTPSPPPPIKKGSSPSP-PPPPPVKKVGALSSSASKPPPAPVRG 294 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP 822 P PPP PP P P PPP P P P P G P P Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPP-PIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 700 PXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPP 867 P PPPPP P P PP +G P P PP P Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPP 717 P PPPPP P P PPPP Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPPP 259 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 6/62 (9%) Frame = +1 Query: 790 PPXXXXPXXGPXPPPXXX------PPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXX 951 PP P PPP P PPPP P PP P G Sbjct: 228 PPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKP 287 Query: 952 PP 957 PP Sbjct: 288 PP 289 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGG 657 G GGGG G G GG GG GGG Sbjct: 793 GGGGGGCGGCGGGGCGGGGDGGG 815 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 719 GGGGGXGXGXGGXXXGGXGGGGG 651 GGGGG G GG GG G GGG Sbjct: 793 GGGGGGCGGCGGGGCGGGGDGGG 815 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -1 Query: 725 GXGGG--GGXGXGXGGXXXGGXGG-GGGXGXFXKIV 627 G GGG GG G G GG GG GG G G G + V Sbjct: 786 GCGGGHHGGGGGGCGGCGGGGCGGGGDGGGMTSRAV 821 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 896 GGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPR 777 GG G G GGGG G GGG G G GG R Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCG---GGGDGGGMTSR 819 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 725 GXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G GGG G GG G GGG G G Sbjct: 784 GGGCGGGHHGGGGGGCGGCGGGGCGGG 810 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -1 Query: 719 GGGGGXG--XGXGGXXXGGXGGGGGXG 645 GGGG G G GG GG GGGG G Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGCGG 809 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 875 GKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGG 765 G GGGG GG GGG G G GG GG Sbjct: 780 GHHGGGGCGGGHHGGGGGG--CGGCGGGGCGGGGDGG 814 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -1 Query: 902 GXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRG 753 G GG G G+ G GG G G G G GG R G GRG Sbjct: 487 GGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRG-RFGSGGGRG 535 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 809 GXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G GG R G G G G G GG GG G GGG G Sbjct: 483 GDSSGGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRGRFGSGGGRG 535 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 866 GGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXG 687 G GG G G G G R G GRG G GGG G G G Sbjct: 483 GDSSGGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRG-RDGGRGRFGSGGGRGSDRGRG 541 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 770 GGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 GG G G G GG G G GG GG G G G Sbjct: 427 GGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEG 468 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 761 GRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGGXG 645 G G G GG G G GG GG GG G G Sbjct: 421 GEGGPSGGDGEGGPSGGDGEGGPSGGDGEGGPSGGDGEG 459 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 827 GXGPXXGXXXXGGXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGGG 651 G G G GG GG G G G GG G G G GG G G Sbjct: 421 GEGGPSGGDGEGGPS----GGDGEGGPSGGDGEGGPSGGDGEGGPNGADGEGGPNGADG 475 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 791 GXXPRXXGGXGRGXXXXXXXXXGXGGGGGXGXGXGGXXXGGXGGGG 654 G P GG G G G GGG G G GG GG GGGG Sbjct: 108 GVHPADSGGGGGGGGFARRG--GYGGGRG-GYARGGFGRGGFGGGG 150 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/98 (25%), Positives = 29/98 (29%) Frame = +1 Query: 664 PXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPPPXXX 843 P P P P PPPP P PP P P GP PP Sbjct: 735 PYPSVHQPTASSP-PPPPETQNPSHPHPHAPYYRPPEQMSR--PGYSIPPYGPPPP--YH 789 Query: 844 PPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPPRRXXPP 957 P P +P P P G+ ++ PP Sbjct: 790 TPHGQAPQPYPPQAQQQPHPSWQQGSYYDPQGQQPRPP 827 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP 717 PP P PP PP P P P PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPPPP 720 PP PP PP P P PP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 708 PPXXPPXXPPXXXXPPPPXPPXXP 779 PP PP PP PPPP PP P Sbjct: 262 PPNRPP--PPSSPPPPPPPPPTPP 283 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 658 PPPXPPXXXPPXPXPXPPPPPXP 726 PP PP P P P PPPPP P Sbjct: 262 PPNRPPP--PSSPPPPPPPPPTP 282 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFP 876 PPP PP PPPP P Sbjct: 266 PPPPSSPPPPPPPPPTP 282 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 844 PPXXPPPPXFPXXXPXPP 897 PP PPPP P P PP Sbjct: 262 PPNRPPPPSSPPPPPPPP 279 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 826 PPPXXXPPXXPPPPXFPXXXPXPP 897 PP PP PPPP P P PP Sbjct: 262 PPNRPPPPSSPPPP--PPPPPTPP 283 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 33.1 bits (72), Expect = 0.28 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXPXPPPP 717 PP PP PP P P P PPP Sbjct: 307 PPLPPPPPTLTQPHPKPLTPPP 328 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 33.1 bits (72), Expect = 0.28 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +1 Query: 688 PXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXX--PXXGPXPPPXXXPPXXPP 861 P P PP P P PP G PP P P PPP PP Sbjct: 150 PPPSQPSPPSPMEEVPIDFPFFFAP-PPQNIGASPPTETQVIPNPSPVPPPPAQPPPAQT 208 Query: 862 PP 867 PP Sbjct: 209 PP 210 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPR-PXPPXXRGXXPPXXXXPXXGP 822 P PPP PP P P PP P P+ P + PP P Sbjct: 165 PLPPPLNLPPLTFPKIKKPCPPIYKPPVVIPKKPCPPKIAHKPIYK---PPVPIYKPPVP 221 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P PP PP P Sbjct: 222 IYKPPVVIPKKPCPPKIHKPIYKPPVP 248 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 3/89 (3%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGP- 822 P P P P PP P P PP P PP P P P Sbjct: 212 PVPIYKPPVPIYKPPVVIPKKPCPPKIHKPIYKPPVPIYKPPV---VIPKKTFPPLHKPI 268 Query: 823 --XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P P PP P P PP P Sbjct: 269 YKHPVPIYKPIFKPPVVVIP-KKPCPPLP 296 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 4/87 (4%) Frame = +1 Query: 655 PPPPXPPXXXPPXPXPXPPP--PPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXG--P 822 PP P PP P PP P P P PP P P Sbjct: 235 PPKIHKPIYKPPVPIYKPPVVIPKKTFPPLHKPIYKHPVPIYKPIFKPPVVVIPKKPCPP 294 Query: 823 XPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P PP P P F P P P Sbjct: 295 LPKFPHFPPKYIPHPKFGKWPPFPSHP 321 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = -1 Query: 923 PAPXXXXGXGGXGXXXGKXGGGGXXGGXXXGGGXGPXXGXXXXGGXXPRXXGGXGRGXXX 744 PAP G GG G G G G GGG P G GG P G G Sbjct: 19 PAPIKVSGRGGGGGFVGS-GNSPSIGSGYFGGGGNP--GTGYMGGGIP-SGGSIRDGSNV 74 Query: 743 XXXXXXGXGGGGGXGXGXGG 684 G GG G G G Sbjct: 75 GTGYRGGFQGGKPSGGGDPG 94 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 4/86 (4%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPXP-XPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXP 828 PPP PP P P P PP P P PP PP P P Sbjct: 43 PPPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPP---AYTPPVYNKP---TLP 96 Query: 829 PPXXXPPXXPP---PPXFPXXXPXPP 897 P PP P PP + PP Sbjct: 97 APVYTPPVYKPTLSPPVYTKPTLLPP 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 26/98 (26%), Positives = 29/98 (29%) Frame = +1 Query: 604 IINLKQINTIFXXXPXPPPPPXPPXXXPPXPXPXPPPPPXPXXXXXXXXXPRPXPPXXRG 783 +++L I T P PP P P P P PP P P Sbjct: 13 LLSLATIATADYYAPSSPPVYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKPT--- 69 Query: 784 XXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPP 897 PP P PPP PP P P PP Sbjct: 70 LSPPVYTKP---TLPPPAYTPPVY-NKPTLPAPVYTPP 103 Score = 29.1 bits (62), Expect = 4.6 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 2/82 (2%) Frame = +1 Query: 658 PPPXPPXXXPPX--PXPXPPPPPXPXXXXXXXXXPRPXPPXXRGXXPPXXXXPXXGPXPP 831 PP P PP P P P PP + P P P Sbjct: 121 PPVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYKPTLSPPVYTKPTLPPPV 180 Query: 832 PXXXPPXXPPPPXFPXXXPXPP 897 P PPPP P PP Sbjct: 181 YKKSPSYSPPPPFAPKPTYTPP 202 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 33.1 bits (72), Expect = 0.28 Identities = 27/107 (25%), Positives = 28/107 (26%), Gaps = 9/107 (8%) Frame = +1 Query: 646 PXPPPPPXPPXXXPPXPXPXPPP--------PPXPXXXXXXXXXPRPXP-PXXRGXXPPX 798 P PP PP P PPP PP P P +G PP Sbjct: 213 PNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPAPNMNQNYQGPPPSNMGQNYQGPPPPN 272 Query: 799 XXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXPXXXXGAGXXXPP 939 GP PP PPP P P PP Sbjct: 273 MNQSYQGPPPPNMNQSYQGPPPSNMGQNYRGPSLPPPNMSQNYEGPP 319 Score = 32.7 bits (71), Expect = 0.37 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 7/91 (7%) Frame = +1 Query: 652 PPPPPXPPXXXPPXPX----PXPPPPPXPXXXXXXXXXPRPXP---PXXRGXXPPXXXXP 810 PPP PP P P PP P P P P +G P Sbjct: 193 PPPNQGMGGAPPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPAPNMNQN 252 Query: 811 XXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 GP P PPPP PP P Sbjct: 253 YQGPPPSNMGQNYQGPPPPNMNQSYQGPPPP 283 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 7/56 (12%) Frame = +1 Query: 757 RPXPPXXRGXXPPXXXXPXXGPXPPPXXXPP-------XXPPPPXFPXXXPXPPXP 903 RP P G PP P PP PP PPPP PP P Sbjct: 192 RPPPNQGMGGAPPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPAP 247 >At1g30780.1 68414.m03763 F-box family protein Length = 482 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 652 PPPPPXPPXXXPPXP-XPXPPPPPXP 726 PPPPP P PP P P PPP P Sbjct: 72 PPPPPDLPLLAPPLPDVPLLPPPAFP 97 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 754 PRPXPPXXRGXXPPXXXXPXXGPXPPPXXXPPXXPPPPXFPXXXPXPPXP 903 P P PP PP P P P P P P +P PP P Sbjct: 71 PPPPPPDLPLLAPPLPDVPLLPPPAFPDFEKPRL-PVPVWPSLPEYPPFP 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,287,324 Number of Sequences: 28952 Number of extensions: 556778 Number of successful extensions: 29934 Number of sequences better than 10.0: 420 Number of HSP's better than 10.0 without gapping: 1596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8225 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -