BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K14 (909 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 8.5 SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pom... 26 8.5 >SPAC806.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 72 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 411 ILYFNLNNYLKVIISSKFS-L*FHCLFFNNVSNIFLLKL 524 + +FN Y K+ + F + + LF N++S I LL L Sbjct: 33 LCFFNATTYWKLFFGAMFDFIHYQLLFRNSLSEILLLGL 71 >SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 734 Score = 25.8 bits (54), Expect = 8.5 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = -1 Query: 264 FIHILIK*GDVSLLELYSTSERLFGLSDIFTTLQDSHLKFKIWKKYHQKNRTFFSHS 94 ++H+++ G ++L S ERL + TL + F WK + ++++ S S Sbjct: 629 WLHVVVLLGSLALALYNSAGERLGQAFGVVYTLLAIFIGFYAWKLHAKRSQMIKSRS 685 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,600,308 Number of Sequences: 5004 Number of extensions: 44112 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -