Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_K11
         (950 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor |Schizo...    27   3.9  
SPBC3H7.08c |||conserved fungal protein|Schizosaccharomyces pomb...    26   6.8  

>SPCC417.05c |chr2|cfh2|chitin synthase regulatory factor
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 512

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 259 WDRTTMDYSVKP 294
           WDRTT+DY ++P
Sbjct: 14  WDRTTIDYDIEP 25


>SPBC3H7.08c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 120

 Score = 26.2 bits (55), Expect = 6.8
 Identities = 14/58 (24%), Positives = 24/58 (41%)
 Frame = +1

Query: 118 SWCV*TQKYTGLLIMKKNTPSEAYFQSDTPVTSRGTREWEEGRSSALWDRTTMDYSVK 291
           +WCV T  +     M          +    + S+    WE+ +SS+     ++DYS K
Sbjct: 25  TWCVMTYTFGVAGYMLGQRGLLVQHEDQVRIPSKNAHPWEDTKSSSGKSDESLDYSYK 82


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,612,966
Number of Sequences: 5004
Number of extensions: 78479
Number of successful extensions: 152
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 152
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 485316198
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)