BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K11 (950 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117283-1|AAI17284.1| 676|Homo sapiens cancer susceptibility c... 31 6.2 BC117281-1|AAI17282.1| 676|Homo sapiens cancer susceptibility c... 31 6.2 BC057795-1|AAH57795.1| 716|Homo sapiens CASC1 protein protein. 31 6.2 BC047415-1|AAH47415.2| 676|Homo sapiens CASC1 protein protein. 31 6.2 AY423543-1|AAQ93499.1| 716|Homo sapiens lung adenoma susceptibi... 31 6.2 >BC117283-1|AAI17284.1| 676|Homo sapiens cancer susceptibility candidate 1 protein. Length = 676 Score = 31.1 bits (67), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 537 WSRRNLVTEDQTLVFKXRSGMSGDCQHNPIIHRIMF 644 WS+ NL+ +VFK R ++ +C NP +MF Sbjct: 570 WSKWNLLCNSTKVVFKVREHLTEECTENPNWALLMF 605 >BC117281-1|AAI17282.1| 676|Homo sapiens cancer susceptibility candidate 1 protein. Length = 676 Score = 31.1 bits (67), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 537 WSRRNLVTEDQTLVFKXRSGMSGDCQHNPIIHRIMF 644 WS+ NL+ +VFK R ++ +C NP +MF Sbjct: 570 WSKWNLLCNSTKVVFKVREHLTEECTENPNWALLMF 605 >BC057795-1|AAH57795.1| 716|Homo sapiens CASC1 protein protein. Length = 716 Score = 31.1 bits (67), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 537 WSRRNLVTEDQTLVFKXRSGMSGDCQHNPIIHRIMF 644 WS+ NL+ +VFK R ++ +C NP +MF Sbjct: 610 WSKWNLLCNSTKVVFKVREHLTEECTENPNWALLMF 645 >BC047415-1|AAH47415.2| 676|Homo sapiens CASC1 protein protein. Length = 676 Score = 31.1 bits (67), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 537 WSRRNLVTEDQTLVFKXRSGMSGDCQHNPIIHRIMF 644 WS+ NL+ +VFK R ++ +C NP +MF Sbjct: 570 WSKWNLLCNSTKVVFKVREHLTEECTENPNWALLMF 605 >AY423543-1|AAQ93499.1| 716|Homo sapiens lung adenoma susceptibility 1-like protein protein. Length = 716 Score = 31.1 bits (67), Expect = 6.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 537 WSRRNLVTEDQTLVFKXRSGMSGDCQHNPIIHRIMF 644 WS+ NL+ +VFK R ++ +C NP +MF Sbjct: 610 WSKWNLLCNSTKVVFKVREHLTEECTENPNWALLMF 645 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,400,146 Number of Sequences: 237096 Number of extensions: 3078174 Number of successful extensions: 6548 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6546 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12547615372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -