BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K10 (982 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 39 0.001 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 36 0.002 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 33 0.046 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 33 0.046 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 33 0.061 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 31 0.19 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 31 0.25 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 30 0.57 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 29 1.0 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 28 2.3 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 27 3.1 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 27 3.1 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 26 7.1 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 26 7.1 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 26 7.1 SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 26 9.3 SPAC5D6.06c |||UDP-GlcNAc transferase associated protein Alg14|S... 26 9.3 SPBC1703.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 9.3 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 39.1 bits (87), Expect = 0.001 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 903 PPXXXPPPPPPXXXXXPLXPPPPP 974 PP PPPPPP P PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 37.1 bits (82), Expect = 0.004 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P PP PP PPPPPP Sbjct: 10 PPPPPPPGFEPPSQPPPPPPP 30 Score = 34.3 bits (75), Expect = 0.027 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 904 PPXXXXRPPPPSXXXHPSXPPPPP 975 PP PPPP PS PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 33.9 bits (74), Expect = 0.035 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P PP P PPPPPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPP 29 Score = 32.7 bits (71), Expect = 0.081 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 891 PXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 P PP PPPPPP PPPPP Sbjct: 5 PPGNPP---PPPPPPGFEPPSQPPPPPP 29 Score = 31.5 bits (68), Expect = 0.19 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 888 PPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 PP PP PPPPP PPPPP Sbjct: 5 PPGNPPP---PPPPPGFEPPSQPPPPPPP 30 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 876 PHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 P P PP PPPPPP PPPPP Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 35.5 bits (78), Expect = 0.012 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 876 PHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 P P P PP PPPPP P PPPPP Sbjct: 752 PPPAPIMGGPPP--PPPPPGVAGAGPPPPPPPP 782 Score = 34.3 bits (75), Expect = 0.027 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 873 PPHPXPPXXXP---PXXXPPPPPPXXXXXPLXPPPPP 974 PP P P P P P PPP P PPPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 32.3 bits (70), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPS----XXXHPSXPPPPPXA 981 P P PP P PPPP P PPPPP A Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPA 784 Score = 31.9 bits (69), Expect = 0.14 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 874 PPTPXXRPPXP-PXXXXRPPPPSXXXHPSXPPPPP 975 PP P P P P PPP P PPPPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 30.3 bits (65), Expect = 0.43 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 876 PHPXPPXXXPPXXXPPPPPPXXXXXP-LXPPPPP 974 P P P P PPPPP PPPPP Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 30.3 bits (65), Expect(2) = 0.002 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P PP PPPPPP Sbjct: 761 PPPPPPPPGVAGAGPPPPPPP 781 Score = 30.3 bits (65), Expect(2) = 0.028 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P PP PPPPPP Sbjct: 762 PPPPPPPGVAGAGPPPPPPPP 782 Score = 28.3 bits (60), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRPPPPSXXXHPSXPPPPPXA 981 PP P P PP P P PPPP A Sbjct: 736 PPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVA 771 Score = 26.6 bits (56), Expect(2) = 0.002 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 648 LALXXPXPPPXXTRFPXXGPPFXXSPPPXLLXPRXPP 758 L L P PPP P P PPP + PP Sbjct: 727 LLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP 763 Score = 26.6 bits (56), Expect = 5.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P P PPPPPP Sbjct: 763 PPPPPPGVAGAGPPPPPPPPP 783 Score = 22.6 bits (46), Expect(2) = 0.028 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +3 Query: 639 RXLLALXXPXPPPXXTRFPXXGPPFXXSPPPXLLXPRXPP 758 + LL P PP P P P P + P PP Sbjct: 726 KLLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPP 765 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 33.5 bits (73), Expect = 0.046 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P P PP PP PP PP P PPPP Sbjct: 1705 PTPPPPPMSVPP---PPSAPPMPAGPPSAPPPP 1734 Score = 32.3 bits (70), Expect = 0.11 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPSXXXHPSXPP--PPP 975 P P PP PPPPS P+ PP PPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 29.1 bits (62), Expect = 1.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPSXXXHPSXPPPP 972 PTP P P PP P+ PS PPPP Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGP--PSAPPPP 1734 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 876 PHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 P P PP P PPP P P PP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPP 1722 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPP-SXXXHPSXPPP 969 P P PP P PPPP PS P P Sbjct: 1715 PPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPP 968 PP PP P PPPP P P P P Sbjct: 1716 PPPSAPPMPAGPPSAPPPPLP-ASSAPSVPNP 1746 Score = 26.2 bits (55), Expect = 7.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 PP P P PPPP P+ PPPP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPP-----PMSVPPPP 1718 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 33.5 bits (73), Expect = 0.046 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXGW 878 GG GG G GGG GG G GG GW Sbjct: 242 GGPGGFGGGLGGFGGGPGGFGGGPGGHGGPGW 273 Score = 29.5 bits (63), Expect = 0.76 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXGWG 875 G GGG G GG GGG G GG G G Sbjct: 225 GFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGG 257 Score = 29.1 bits (62), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 974 GGGGGXEGXXXXXGGGGRXXXXGGXGGRXXGVGG 873 GG GG EG GGG GG GG G GG Sbjct: 228 GGPGGFEGGPGGFGGGP-GGFGGGLGGFGGGPGG 260 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXGWGG 872 G GGG G GG GGG G GG G G Sbjct: 239 GFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXGWGG 872 GG GG G GGG GG GG G G GG Sbjct: 228 GGPGGFEGGPGGFGGGPGG-FGGGLGGFGGGPGG 260 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 33.1 bits (72), Expect = 0.061 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 974 GGGGGXEGXXXXXGGGGRXXXXGGXGGRXXGVGG 873 GG GG G GGGR GG GGR GG Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 29.5 bits (63), Expect = 0.76 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 974 GGGGGXEGXXXXXGGGGRXXXXGGXGGRXXGVGG 873 GG GG G GGR G GGR GG Sbjct: 30 GGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 974 GGGGGXEGXXXXXGGGGRXXXXGGXGGRXXGVGG 873 GG GG G G GGR GG GG G GG Sbjct: 38 GGRGGARG-----GRGGRGGARGGRGGSSGGRGG 66 Score = 27.5 bits (58), Expect(2) = 0.71 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 784 GGXRXXAPQGGXRGXRSXGGGEXXKGGPXXGNRVFXGGGXGXXK 653 GG R A GG G R GG G G+ GG G K Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAK 72 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 788 GGGGKXXGAAGXXXGGKEXXGGGXXKGGPXXGEPRXXRGWGG 663 GG G G G GG+ GGG +GG G RG G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGG--RGGARGGGRGGARGGRG 48 Score = 27.1 bits (57), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 980 AXGGGGGXEGXXXXXGGGGRXXXXGGXGGRXXGVGG 873 A GGG G GG R G GGR GG Sbjct: 35 ARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 26.2 bits (55), Expect = 7.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGG--GGXKXGGXXXGGXG 881 GG GG RG G GG GG G GG G Sbjct: 26 GGFGGGRGGARGGGRGGARGGRGGRGGARGGRG 58 Score = 25.8 bits (54), Expect = 9.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXGWGG 872 GG GG RG GG GG + G G GG Sbjct: 38 GGRGGARGGRGGRGGARGG-RGGSSGGRGGAKGG 70 Score = 20.6 bits (41), Expect(2) = 0.71 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -1 Query: 934 GGGGGGXKXGGXXXGGXGWGG 872 G GG GG G G+GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGG 30 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 31.5 bits (68), Expect = 0.19 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPSXXXHPSXPPPPP 975 P P PP P P P S PS PPP P Sbjct: 1035 PVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Score = 29.5 bits (63), Expect = 0.76 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 PP P P PP P PP PP PP Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP 1212 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 PP P P PP P PP PP P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP 1134 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 PP P P PP P PP PP P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVP 1153 Score = 27.5 bits (58), Expect = 3.1 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPSXXXHPSXPPP 969 P P PP P PP P+ P P P Sbjct: 1134 PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKP 1164 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 PP P P PP P PP PP P Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVP 1172 Score = 27.5 bits (58), Expect = 3.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXP----PPPPPXXXXXPLXPPP 968 PP P P PP P PP P P PPP Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 27.5 bits (58), Expect = 3.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP PP P PP PPP Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPP 1213 Score = 27.1 bits (57), Expect = 4.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 PP P P PP P PP PP P Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPP 965 PP PP P PP P P P+ P Sbjct: 1212 PPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 26.6 bits (56), Expect = 5.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 PP P P PP P PP P PP P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPP--VPIPTSTPPVP 1053 Score = 26.6 bits (56), Expect = 5.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXP---PPPPPXXXXXPLXPPPPP 974 PP P P PP P PP P P PPP P Sbjct: 1032 PPIPVPSTA-PPVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPPPSXXXHPSXPPP 969 P P PP P PP P P P P Sbjct: 1115 PAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 26.2 bits (55), Expect = 7.1 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXP----PPPPPXXXXXPLXPP 965 PP P P PP P PP PP P+ P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKP 1203 Score = 25.8 bits (54), Expect = 9.3 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 3/35 (8%) Frame = +1 Query: 874 PPTPXXR---PPXPPXXXXRPPPPSXXXHPSXPPP 969 PP P PP PP P P P PPP Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPP 1213 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 31.1 bits (67), Expect = 0.25 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 873 PPHPXPPXXXP---PXXXPPPPPPXXXXXPLXPPPPP 974 PP P PP P P P PP P PP PP Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 30.7 bits (66), Expect = 0.33 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 877 PTPXXRPPX-PPXXXXRPPPPSXXXHPSXPPPPPXA 981 PTP PP PP PP P+ PP PP A Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSA 453 Score = 30.3 bits (65), Expect = 0.43 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRPP-PPSXXXHPSXPPPPPXA 981 PP+ PP P PP PP+ P P P P A Sbjct: 450 PPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAA 486 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 895 PPXPPXXXXRPPPP--SXXXHPSXPPPPP 975 PP PP R PP + + S PPPPP Sbjct: 313 PPPPPSRRNRGKPPIGNGSSNSSLPPPPP 341 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRPPPPSXXXHPSXPPPPPXA 981 PP P P P +PPP S S PP PP A Sbjct: 361 PPPPP--PRSAPSTGRQPPPLSSSRAVSNPPAPPPA 394 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRP-PPPSXXXHPSXPPPPPXA 981 P P P PP P PP P+ PP PP A Sbjct: 437 PSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAA 473 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRP-PPPSXXXHPSXPPPPPXA 981 PP P P PP P PP P+ PP P A Sbjct: 447 PPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPA 483 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 6/40 (15%) Frame = +1 Query: 874 PPTPXXRP------PXPPXXXXRPPPPSXXXHPSXPPPPP 975 PP P R P PP PPPP PS PP Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPP 377 Score = 26.6 bits (56), Expect = 5.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXRPPP---PSXXXHPSXPPPPP 975 PT PP PP PP PS P+ PP PP Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSA-PAPPPIPP 258 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 9/42 (21%) Frame = +3 Query: 873 PPHPXPP-------XXXPP--XXXPPPPPPXXXXXPLXPPPP 971 PP P PP PP PPPPPP PPP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPP 378 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 29.9 bits (64), Expect = 0.57 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 669 PPPXXTRFPXXGPPFXXSPPPXLLXPRXPPCGA 767 PPP P GPP + P L P PP GA Sbjct: 1883 PPPPPMALPKAGPP--SAAPTSALPPAGPPAGA 1913 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 895 PPXPPXXXXRPPPPSXXXHPSXPPPPPXA 981 PP PP + PPS + PP P A Sbjct: 1883 PPPPPMALPKAGPPSAAPTSALPPAGPPA 1911 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 250 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 299 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P PP P PPPP PPPP Sbjct: 312 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPLXPPPP 971 P P P PPPPP P PP P Sbjct: 729 PAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRPPPP-SXXXHPSXPPPP 972 PPTP P P PPPP PS PP P Sbjct: 731 PPTPA---PTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 968 GGGXEGXXXXXGGGGRXXXXGGXGG-RXXGVGG 873 GGG G GG G GG GG R G GG Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 883 PXXRPPXPPXXXXRPPPPSXXXHPSXPPPPP 975 P P P PP S PS PPP P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSP 154 Score = 27.1 bits (57), Expect = 4.0 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 874 PPTPXXRPP----XPPXXXXRPPPPSXXXHPSXPPPP 972 PP P PP PP PP PS P+ P P Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 874 PPTPXXRPPXP---PXXXXRPPPPSXXXHPSXPPP 969 PP+P PP P P PPP+ P PP Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRPPPPSXXXHPSXPPPPP 975 PP P PP PPS PS PP P Sbjct: 165 PPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP 198 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 874 PPTPXXRPPXPPXXXXRP--PPPSXXXHPSXPPPPP 975 PPTP P RP PPPS P P P Sbjct: 130 PPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAP 165 Score = 25.8 bits (54), Expect = 9.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 918 PPPPPPXXXXXPLXPPPP 971 PPPPPP P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 888 PPXXXPPXXXPPPPPPXXXXXPLXPPPPP 974 PP PP P P PPPPP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPP 196 Score = 25.8 bits (54), Expect = 9.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPP 935 PP P P PPPPPP Sbjct: 224 PPTYTPKQADPLPAPPPPPPP 244 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGG-GGGXK--XGGXXXGGXGWG 875 GG GG RG GG GG + GG GG G G Sbjct: 138 GGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGG 173 Score = 25.8 bits (54), Expect = 9.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 973 GGGGGXRGXXXXXGGGGGGXKXGGXXXGGXG 881 G GGG RG GGG G GG G G Sbjct: 161 GFGGGSRG---GFGGGSRGGSRGGFRGGSRG 188 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 26.2 bits (55), Expect = 7.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 934 PSXXXHPSXPPPPP 975 P+ HP+ PPPPP Sbjct: 899 PTIITHPTPPPPPP 912 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 25.8 bits (54), Expect = 9.3 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 937 SXXXHPSXPPPPP 975 S HPS PPPPP Sbjct: 40 STHSHPSNPPPPP 52 >SPAC5D6.06c |||UDP-GlcNAc transferase associated protein Alg14|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 25.8 bits (54), Expect = 9.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 299 FVCMLRTI*KYSGKQIKIAFV 361 F+C+L + K+ GK +KI +V Sbjct: 146 FICLLGYLAKFLGKNVKIVYV 166 >SPBC1703.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 202 Score = 25.8 bits (54), Expect = 9.3 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 148 KSCSKIMLRKYCWILARCFT*ERVPKFFVFYLFNS*LYIVLQSKANES 291 ++C K++ + +LA C+ P V L S Y++L+ AN S Sbjct: 151 RNCIKLLFKNSLVLLAACYFMNTTPSRLVINLIRS-GYLILKRFANPS 197 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,855,047 Number of Sequences: 5004 Number of extensions: 54171 Number of successful extensions: 596 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 505288058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -