BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K10 (982 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.79 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 2.4 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 3.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 3.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 4.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 4.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 9.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 9.7 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 25.4 bits (53), Expect = 0.79 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 903 PPXXXPPPPPP 935 PP PPPPPP Sbjct: 338 PPKPAPPPPPP 348 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 2/35 (5%) Frame = +1 Query: 877 PTPXXRPPXPPXXXXR--PPPPSXXXHPSXPPPPP 975 P P P P R PP PS P PP P Sbjct: 21 PGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAP 55 Score = 21.8 bits (44), Expect = 9.7 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 882 PXPPXXXPPXXXPPPPPP 935 P P PP PP PP Sbjct: 39 PPNPSQGPPPGGPPGAPP 56 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 124 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 151 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 372 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 399 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 357 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 384 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 3.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 873 PPHPXPPXXXPPXXXPPPPPPXXXXXPL 956 P P PP PP PPP P+ Sbjct: 373 PLTPFPPRFIPPDMYRLRPPPNPRFGPM 400 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 4.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 269 NTMYNYELNK*NTKNLGTRS*VKQRARIQQYLRSIIFEQDFSLFAY 132 N + NYE N+ T GT + VK I+ + D+S+ Y Sbjct: 43 NLLMNYENNQLPTHGKGTPTVVKTNILIRSMGPVSELDMDYSMDCY 88 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.0 bits (47), Expect = 4.2 Identities = 15/64 (23%), Positives = 26/64 (40%) Frame = -1 Query: 280 LLIVTLCITTN*ISKIQKIWAHALK*SSEPESNNIYAA*FSNKIFRCLLIMYISAVQCIQ 101 +LI + I ++ IS +W A++ PE + IF + Y+ + Sbjct: 165 VLIAIVWICSSAISFPAIVWWRAVRTEEVPEDKCPFTEHLGYLIFSSTISFYLPLFVMVF 224 Query: 100 VYYK 89 YYK Sbjct: 225 TYYK 228 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 9.7 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -3 Query: 167 IIFEQDFSLFAYHVHICCTMYTSV 96 ++F+++FS + ++I C M V Sbjct: 235 LLFKREFSYYLIQIYIPCCMLVIV 258 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 9.7 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -3 Query: 167 IIFEQDFSLFAYHVHICCTMYTSV 96 ++F+++FS + ++I C M V Sbjct: 235 LLFKREFSYYLIQIYIPCCMLVIV 258 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,988 Number of Sequences: 438 Number of extensions: 7300 Number of successful extensions: 65 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 32411652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -