BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K08 (914 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0080 + 587674-588510 34 0.14 05_01_0142 - 940421-940701,941262-941574 33 0.32 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 31 1.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.7 08_01_0162 - 1302497-1302787,1304608-1305271,1305380-1306927,130... 30 2.2 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 2.2 12_02_1174 - 26696869-26698191 30 2.9 06_03_0790 - 24636805-24637770 30 2.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 30 2.9 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 3.9 02_05_0686 - 30900748-30902167,30903442-30904742 29 3.9 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 5.2 07_03_0600 + 19866757-19867218,19867920-19868429 29 5.2 06_01_0178 + 1386981-1387505 29 5.2 03_06_0471 + 34169562-34169892,34170121-34170347 29 5.2 01_03_0270 + 14445240-14445464,14445490-14445655,14446193-144463... 29 5.2 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 28 9.0 08_01_0059 - 394001-394708 28 9.0 06_01_0493 - 3536207-3537056,3537603-3537826,3538234-3538503,353... 28 9.0 03_06_0448 - 34005581-34005655,34005735-34005830,34006669-340076... 28 9.0 03_05_0737 + 27258320-27259007,27259263-27259435,27262684-272627... 28 9.0 03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647,132... 28 9.0 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 28 9.0 01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831,768... 28 9.0 >07_01_0080 + 587674-588510 Length = 278 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP G PPPP PP PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP G PPPP PP PP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP PPP PP PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPP 117 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRP 807 PP PP G PPPP +PP P Sbjct: 50 PPGAYPPPPGAYPPPPGAYPPQHGYP 75 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPP 792 PP PP G PPPP +PP Sbjct: 36 PPQGYPPPPGAYPPPPGAYPP 56 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPP 792 PP PP G PPPP +PP Sbjct: 43 PPGAYPPPPGAYPPPPGAYPP 63 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 5/61 (8%) Frame = +1 Query: 730 PPXXXPPXXG-----GXPPPPXXHPPXXXRPPXXXXXXXXXXXXXXXXPXXXXXPXXXXP 894 PP PP G G PPPP HP PP P P P Sbjct: 304 PPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRP 363 Query: 895 P 897 P Sbjct: 364 P 364 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP PPP HPP PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPP 145 >08_01_0162 - 1302497-1302787,1304608-1305271,1305380-1306927, 1307360-1308768 Length = 1303 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = -2 Query: 223 SIFLKSFHLGSGAALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPNTISFD 62 SI HLG G L+ PR + K+ K +LP+ S G F T SF+ Sbjct: 219 SILAMRLHLGYG--LSGPRHRPDYNLSYKVDLKSVLPELVSVG-FSASTTTSFE 269 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 733 PXXXPPXXGGXPPPPXXHPPXXXRPP 810 P PP PPPP PP RPP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPP 374 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRP 807 PP PP PPPP PP P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPP 379 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP P PPPP PP RPP Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPP 168 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 2/59 (3%) Frame = +1 Query: 730 PPXXXPPXXGGXPP--PPXXHPPXXXRPPXXXXXXXXXXXXXXXXPXXXXXPXXXXPPP 900 PP PP PP PP PP PP P P PPP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 >06_03_0790 - 24636805-24637770 Length = 321 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -1 Query: 899 GGGXXXXGXXXXXGXXXXXXXXXXXXXXXXGGRXXXGGCXXGGGGXPPXXGGXXXGG 729 GGG G G GGR GG GGGG GG GG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP GG PPP PP PP Sbjct: 292 PPRIPPPPVGGTQPPPPP-PPLANGPP 317 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPPXXXXXXXXXXXXXXXXPXXXXXPXXXXPPP 900 PP PP PPPP + P PP P P PPP Sbjct: 268 PPPQVPPPPPQAPPPPPPNAP-MGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPP 323 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPPXXXXXXXXXXXXXXXXPXXXXXPXXXXPP 897 PP PP PPPP PP +P P P PP Sbjct: 43 PPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPP 98 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPPXXXXXXXXXXXXXXXXPXXXXXPXXXXPPP 900 PP PP PPP P PP P P PPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP PPP PP +PP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPPLPIQPP 1206 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP G PPPP PP PP Sbjct: 62 PPPQQPPAMWGQPPPP---PPQYAPPP 85 >06_01_0178 + 1386981-1387505 Length = 174 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 809 GGRXXXGGCXXGGGGXPPXXGGXXXGG 729 GGR GG GGGG GG GG Sbjct: 27 GGRGGRGGASGGGGGGGGGGGGGGGGG 53 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 730 PPXXXPPXXGGXPP---PPXXHPPXXXRPP 810 PP PP GG PP PP +P PP Sbjct: 68 PPSGYPPSQGGYPPGAYPPSGYPQQPGYPP 97 >01_03_0270 + 14445240-14445464,14445490-14445655,14446193-14446341, 14446634-14446674,14447683-14447755 Length = 217 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 733 PXXXPPXXGGXPPPPXXHPPXXXRPP 810 P PP GG PPPP P RPP Sbjct: 12 PPSPPPSCGGIPPPPSRRP----RPP 33 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP P G PPP +PP PP Sbjct: 61 PPQGYPSSHGVYPPPQGPYPPPHQPPP 87 >08_01_0059 - 394001-394708 Length = 235 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRP 807 PP PP PPPP PP P Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPP 31 >06_01_0493 - 3536207-3537056,3537603-3537826,3538234-3538503, 3539042-3539146 Length = 482 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 733 PXXXPPXXGGXPPPPXXHPPXXXRPP 810 P PP G PPP +PP PP Sbjct: 419 PPYYPPYGGYMPPPRMPYPPPPQYPP 444 >03_06_0448 - 34005581-34005655,34005735-34005830,34006669-34007616, 34007684-34007851,34007908-34008099,34008164-34008346, 34008414-34008590,34008667-34012074 Length = 1748 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPP 792 P PP G PPPP PP Sbjct: 29 PAHLLPPLAGAPPPPPPFRPP 49 >03_05_0737 + 27258320-27259007,27259263-27259435,27262684-27262758, 27262832-27263296 Length = 466 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 809 GGRXXXGGCXXGGGGXPPXXGGXXXGG 729 GGR GG GGGG GG GG Sbjct: 374 GGRGGRGGRGMGGGGYQNGRGGGGGGG 400 >03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647, 1327482-1327530,1328834-1328855,1328969-1329071 Length = 241 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 730 PPXXXPPXX---GGXPPPPXXHPPXXXRPP 810 PP PP GG PPP +PP PP Sbjct: 199 PPAAYPPAGYPQGGAYPPPGSYPPPGSYPP 228 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 PP PP PPPP P PP Sbjct: 433 PPEHPPPPESTSPPPPPTSDPPPVPPP 459 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 P PP PPPP PP PP Sbjct: 434 PEHPPPPESTSPPPPPTSDPPPVPPPP 460 >01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831, 7688011-7688469,7690648-7690788,7691771-7692421 Length = 539 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 730 PPXXXPPXXGGXPPPPXXHPPXXXRPP 810 P PP PP HPP RPP Sbjct: 322 PTIGFPPPHAAAMVPPPPHPPPFCRPP 348 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,872,527 Number of Sequences: 37544 Number of extensions: 320230 Number of successful extensions: 1906 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1690 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -