BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K07 (863 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 116 2e-26 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.032 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 35 0.074 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.30 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.33 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 30 2.8 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 2.8 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 30 2.8 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 3.7 SB_5916| Best HMM Match : R3H (HMM E-Value=2.9e-10) 29 3.7 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 29 3.7 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 4.9 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 28 8.5 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 28 8.5 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 28 8.5 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 116 bits (280), Expect = 2e-26 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 2/140 (1%) Frame = +1 Query: 85 MGRYSREPDNPAKSCKARGSNLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPF 264 M RY+ +P+NP KSCKARGSNLRVH+KNT+E AMAI+ M +R+A RYLK+V KK+ +PF Sbjct: 1 MTRYATDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVRKANRYLKDVCAKKQLVPF 60 Query: 265 RRFNGGVGRCAQAKQFGT--TQGSLAQEIRRIPLAVIEER*IKX*QQNFGR*XAXHXPHS 438 R++NGGVGR AQAK +QG ++ I L +++ + + H Sbjct: 61 RKYNGGVGRKAQAKNLKVPGSQGRWPKKSAEILLQLLKNAESNAEFKGLDV-DSLVVEHI 119 Query: 439 GKSXRPWLSKRKYRGPGRIN 498 + P + +R YR GRIN Sbjct: 120 QVNEAPSMRRRTYRAHGRIN 139 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXXPX 849 PP P PP P P PP P PPPPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 850 AP 855 P Sbjct: 428 PP 429 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXXPX 849 PP P PP P P PP P PPPPP P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 850 AP 855 P Sbjct: 429 PP 430 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 664 SXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXX 843 S PP P P P P PP P PPPPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 844 PXAP 855 P P Sbjct: 424 PPPP 427 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/68 (26%), Positives = 19/68 (27%) Frame = +1 Query: 652 SXXFSXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXK 831 S + P P PP P P PP P PPPPP Sbjct: 358 SAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Query: 832 PXXXPXAP 855 P P P Sbjct: 418 PAPPPPPP 425 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXXPX 849 PP P + PP P P PP P PPPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 850 AP 855 P Sbjct: 430 PP 431 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/75 (25%), Positives = 20/75 (26%) Frame = +1 Query: 631 IXGIPXGSXXFSXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPP 810 + I G PP P P P P PP P PP Sbjct: 354 VTDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Query: 811 PPPXXXKPXXXPXAP 855 PPP P P P Sbjct: 414 PPPPPAPPPPPPPPP 428 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXXPX 849 PP P PP P P PP P PPP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 850 AP 855 P Sbjct: 431 PP 432 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 664 SXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXX 843 S PP P PP P P PP P PPPPP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRL 436 Query: 844 PXAP 855 AP Sbjct: 437 ACAP 440 Score = 32.3 bits (70), Expect = 0.52 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKPXXXPX 849 PP P PP P P PP P P PPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Query: 850 A 852 A Sbjct: 433 A 433 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 769 PXXXXPPXXPGXPPPPPXXXKPXXXPXAPQ 858 P PP P PPPP P P PQ Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQ 394 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.1 bits (77), Expect = 0.074 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAPQH 861 P P PP P PPPPP P P P H Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPPP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 768 PXPXXPPXXAGXXPPPPXXXQTXXXPXXPPT 860 P P PP PPPP P PPT Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPPP P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect(2) = 0.33 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPP 819 P P PP P PPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 23.4 bits (48), Expect(2) = 0.33 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 796 PGXPPPPPXXXKPXXXP 846 P PPPPP P P Sbjct: 136 PAPPPPPPPPPAPCMPP 152 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPPP P AP Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXP 846 P P PP P PPPPP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPP P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKPXXXPXAP 855 PP P PPPPP P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTP 706 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +1 Query: 643 PXGSXXFSXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPX 822 P G S PP P PP P P PP P PPPPP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAP-PPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Query: 823 XXK 831 K Sbjct: 995 MRK 997 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.3 bits (70), Expect = 0.52 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 3/69 (4%) Frame = +1 Query: 649 GSXXFSXPPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXP---GXPPPPP 819 G + PP P PP P P PP P G PPPPP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Query: 820 XXXKPXXXP 846 P P Sbjct: 400 PTNGPPPPP 408 Score = 31.9 bits (69), Expect = 0.69 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXP---GXPPPPPXXXKP 834 PP P T PP P P PP P G PPPPP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 759 PXXPXPXXPPXXAGXXPPPPXXXQTXXXPXXPP 857 P P PP PPPP QT P PP Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKP 834 P P PP P PPPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKPXXXPXAP 855 PP P PPPPP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXP 846 P P PP P P PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPP P P P P Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPP P P P P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP 126 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPP P P P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPP P P P P Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/84 (22%), Positives = 21/84 (25%) Frame = +3 Query: 567 YPLLMMPXXKNXPKKTWAXXXNXRDPXRXXXIFPPPXXXXXXXXXXXXXXXXXXXXXXXP 746 YP P P + N P +PPP P Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Query: 747 XXXXPXXPXPXXPPXXAGXXPPPP 818 P P P PP PPPP Sbjct: 184 NPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPP P P P P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPP-PPXXXKPXXXPXAPQH 861 P P PP P PPP PP P P P + Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 768 PXPXXPPXXAGXXPPPPXXXQTXXXPXXPP 857 P P PP G PPPP P PP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXA 852 P P PP P PPPP P P A Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPPVKKPAA 255 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKPXXXPXAP 855 PP P PPPPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 768 PXPXXPPXXAGXXPPPPXXXQTXXXPXXPP 857 P P P G PPPP T P PP Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPPP P P Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 759 PXXPXPXXPPXXAGXXPPPPXXXQTXXXPXXPP 857 P P P P PPPP T P PP Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPP 819 P P PP P PPPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPP 206 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKP 834 P P PP P PPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKP 834 P P PP P PPPPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKPXXXPXAP 855 PP P PPPPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 673 PXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPPPXXXKP 834 P P PP P P PP G PPPPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 759 PXXPXPXXPPXXAGXXPPPPXXXQTXXXPXXPP 857 P P P PP PPPP Q PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP 742 >SB_5916| Best HMM Match : R3H (HMM E-Value=2.9e-10) Length = 798 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 366 NCKRNSADFLGQRPLCCAKLLCLS 295 +CK+N + LGQ+ +CC ++ CLS Sbjct: 712 SCKQNIS-LLGQKCVCCTRVFCLS 734 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPPP P P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 744 PXXXXPXXPXPXXPPXXAGXXPPPP 818 P P P P PP G PPPP Sbjct: 310 PGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PXXPXPXXPPXXAGXXPPPP 818 P P P PP G PPPP Sbjct: 316 PPPPPPPPPPGDGGAPPPPP 335 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 744 PXXXXPXXPXPXXPPXXAGXXPPPP 818 P P P P PP G PPPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPP 214 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP PG PPPP P P P Sbjct: 196 PPPPPPPPPGFPGGAPPPP--PPPFGAPPPP 224 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P P PP P PPPP P AP Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 769 PXXXXPPXXPGXPPPPPXXXKPXXXPXAPQH 861 P PP P PPPP P AP H Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPP 819 P P PP P PPPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPP 91 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKP 834 PP P PPPPP KP Sbjct: 82 PPPPPPPPPPPPGAKKP 98 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPP 819 P P PP P PPPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPP 292 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 784 PPXXPGXPPPPPXXXKP 834 PP P PPPPP KP Sbjct: 283 PPPPPPPPPPPPGAKKP 299 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 769 PXXXXPPXXPGXPPPPPXXXKPXXXPXAP 855 P PP P PP PP P P P Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 763 PXPXXXXPPXXPGXPPPPPXXXK--PXXXPXAP 855 P P PP G PPPPP + P P P Sbjct: 378 PPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 670 PPXPXXXTXXPPXXXXXXXXVXXXXXXXXXXPXPXXXXPPXXPGXPPPP 816 PP P PP P P PP G PPPP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,316,206 Number of Sequences: 59808 Number of extensions: 435624 Number of successful extensions: 2398 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1665 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -