BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K06 (938 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 1.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 25 1.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 3.4 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 1.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY 797 PP PP+ P R PPY Sbjct: 68 PPSGGQPPQGMPYPRFPPY 86 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Frame = +2 Query: 782 PGXSXPPXG-----XPXPXXXPPPPLPXXXPP 862 PG + PP G P PP PLP PP Sbjct: 160 PGPALPPTGFLCNNYPPLPQVPPLPLPPIFPP 191 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 830 PPPPLPXXXPPPXP 871 PPPP P PP P Sbjct: 736 PPPPHPHHQPPRNP 749 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 830 PPPPLPXXXPPPXP 871 PPPP P PP P Sbjct: 628 PPPPHPHHQPPRNP 641 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 PG + PP G P P +P PP Sbjct: 160 PGPALPPAGFLCNNYLPLPQVPPLPLPP 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,686 Number of Sequences: 336 Number of extensions: 2819 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26375415 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -