BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K06 (938 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 58 1e-08 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 53 4e-07 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 52 5e-07 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 52 7e-07 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 48 1e-05 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 47 2e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 47 2e-05 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 46 4e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 46 6e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 46 6e-05 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 44 1e-04 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 44 2e-04 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 43 3e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 43 3e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 43 4e-04 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 43 4e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 42 5e-04 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 42 5e-04 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 41 0.001 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 41 0.002 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 40 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 40 0.004 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 40 0.004 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 39 0.005 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 39 0.007 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 38 0.009 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.009 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 38 0.009 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 38 0.009 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 38 0.012 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 38 0.012 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 38 0.012 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 38 0.012 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 38 0.015 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 38 0.015 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 37 0.020 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 37 0.020 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 37 0.020 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 37 0.020 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 37 0.020 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 36 0.036 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 36 0.047 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 36 0.047 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 36 0.063 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 35 0.083 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 35 0.083 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 35 0.11 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 34 0.14 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 34 0.14 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 34 0.14 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 34 0.14 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 34 0.19 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.25 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.25 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.25 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 33 0.25 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 33 0.25 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 33 0.33 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 33 0.33 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.44 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 33 0.44 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 33 0.44 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 0.45 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 32 0.58 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 32 0.58 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 32 0.58 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 32 0.77 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 32 0.77 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 32 0.77 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.0 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 31 1.3 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 1.8 SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 1.8 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 1.8 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 31 1.8 SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) 31 1.8 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 2.4 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 30 2.4 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 2.4 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 30 2.4 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 30 3.1 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 30 3.1 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 30 3.1 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 30 3.1 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 26 3.4 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.1 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 29 4.1 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 29 4.1 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 29 4.1 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 4.1 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 4.1 SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 29 4.1 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 29 5.4 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 29 5.4 SB_24277| Best HMM Match : EGF (HMM E-Value=2.4e-06) 29 5.4 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 5.4 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 29 5.4 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 7.2 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 29 7.2 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 29 7.2 SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) 29 7.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 7.2 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.2 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 28 9.5 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 28 9.5 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) 28 9.5 SB_9191| Best HMM Match : TolA (HMM E-Value=1) 28 9.5 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 28 9.5 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 28 9.5 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_39661| Best HMM Match : KOW (HMM E-Value=1.1e-07) 28 9.5 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 28 9.5 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 9.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP PP P P P PPPP PPP P P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 56.8 bits (131), Expect = 2e-08 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP PP PP P P P PPPP PPP P P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 921 RPXP 932 P P Sbjct: 425 PPPP 428 Score = 56.0 bits (129), Expect = 4e-08 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP P P PPPP PPP P P PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 918 ARPXP 932 P P Sbjct: 427 PPPPP 431 Score = 55.2 bits (127), Expect = 7e-08 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S PP P P PPPP P PPP P PPPPP P PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP P P P PPPP P P P P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLA 437 Query: 918 ARP 926 P Sbjct: 438 CAP 440 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP P PP P P P PPPP PPP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 918 ARPXP 932 P P Sbjct: 425 PPPPP 429 Score = 52.0 bits (119), Expect = 7e-07 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P P PP P P PPPP P PPP Sbjct: 365 PPPPPPPPPPP-----PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 869 PXXXXXXPPPPP 904 P PPPPP Sbjct: 420 PPPPPPPPPPPP 431 Score = 52.0 bits (119), Expect = 7e-07 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P PPPP P PPP P PPPPP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/59 (37%), Positives = 24/59 (40%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 +PP PP PP P P P +PPPP PPP P P PP P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP P P PP P P PPPP P PPP P Sbjct: 364 SPPPPPPPPPP------------PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Query: 878 XXXXPPPPPRXXXGXPXPP 934 PPP P P PP Sbjct: 412 PPPPPPPAPPPPPPPPPPP 430 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLP--XXXPP 862 P PPPPP P P PP P P PPPP P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 863 PXPXXXXXXPPPPPRXXXGXP 925 P P PPR P Sbjct: 428 PPPPPALRLACAPPRLRFTSP 448 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G + P P P PP P P PPP PPPPP P PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/68 (42%), Positives = 29/68 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGGG G G G GG GG GGA GGGG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGGG 299 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 300 GGATGGGG 307 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/68 (42%), Positives = 29/68 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGGG G G G GG GG GGA GGGG Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGVG 313 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 314 GGATGGGG 321 Score = 50.8 bits (116), Expect = 2e-06 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---GGAXXGGGGXV 731 GG G GGG GGGG G G G GGA GG GG GGGG Sbjct: 250 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 309 Query: 730 FXXGXGR--GGGGXLG 689 G G GGGG G Sbjct: 310 TGVGGGATGGGGGATG 325 Score = 50.8 bits (116), Expect = 2e-06 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---GGAXXGGGGXV 731 GG G GGG GGGG G G G GGA GG GG GGGG Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGA 323 Query: 730 FXXGXGR--GGGGXLG 689 G G GGGG G Sbjct: 324 TGGGVGATGGGGGATG 339 Score = 50.4 bits (115), Expect = 2e-06 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---G 761 G G A G G G GGG GGGG G G G GGA GG G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATG--GGGGATGGGGGATGGGGGATGGGGGATGVG 313 Query: 760 GAXXGGGGXVFXXGXGRGGGG 698 G GGGG G G GGG Sbjct: 314 GGATGGGGGATGGGVGATGGG 334 Score = 50.0 bits (114), Expect = 3e-06 Identities = 30/72 (41%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGGG G G G GG GG GGA GGGG Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGGG 306 Query: 721 GXGRG-GGGXLG 689 G G GGG G Sbjct: 307 GGATGVGGGATG 318 Score = 50.0 bits (114), Expect = 3e-06 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-----GXRGGAXXGGGG 737 GG G G GG GGGG G G G GG G G GGA GGGG Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Query: 736 XVFXXGXGRGGGGXLG 689 G GGGG G Sbjct: 344 VTGGGGGATGGGGGPG 359 Score = 48.0 bits (109), Expect = 1e-05 Identities = 32/82 (39%), Positives = 32/82 (39%), Gaps = 4/82 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---- 764 G G A G G G GGG GGGG G G G GGA GG Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATG--GGGGATGGGGGATGGGGGATGVGGGATGGG 320 Query: 763 GGAXXGGGGXVFXXGXGRGGGG 698 GGA GG G G GGGG Sbjct: 321 GGATGGGVGATGGGGGATGGGG 342 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G GGG GGGG G G G GG GG GGA GGGG G Sbjct: 239 GRLGGGGATGGGGGA-TGGGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGGGGGA 295 Query: 712 RGGGG 698 GGGG Sbjct: 296 TGGGG 300 Score = 46.4 bits (105), Expect = 3e-05 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR--GG 758 G G GG G GGG GGG G G G G GG GG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Query: 757 AXXGGGGXVFXXGXGRGGGG 698 GGGG G G G GG Sbjct: 343 GVTGGGGGATGGGGGPGSGG 362 Score = 45.2 bits (102), Expect = 8e-05 Identities = 32/82 (39%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A G G G GGG GGGG G G G GG GG GG Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGAT---GGGGGATGGGVGATGGGGGATGGG--GGVT 345 Query: 751 XGGGGXVFXXGX-GRGGGGXLG 689 GGGG G G GG G G Sbjct: 346 GGGGGATGGGGGPGSGGCGEDG 367 Score = 35.5 bits (78), Expect = 0.063 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGGG G G G GGA GG GA GGGG G G G G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGG---GATGGGGGAT---GGGGGATGGGG 286 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF-XGXGXPXGGXEXPG 781 G G GGGGG G GG GGGG G G GG PG Sbjct: 308 GATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 33.9 bits (74), Expect = 0.19 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 G G GGGGG G GG GGGG G G G Sbjct: 245 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Query: 753 XXXXXXGFFXXGXGGGGGVXWG 688 G GGGGG G Sbjct: 305 GGGGATGVGGGATGGGGGATGG 326 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG-GXFXGXGXPXGG 796 G G GGGGG G GG GGG G G G GG Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGG 340 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G GGGGG G GG GGGG G G E Sbjct: 322 GATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTE 369 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXG-----RGGGGXFXGXGXPXGG 796 GG G GG G G GGG G GGGG G G GG Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 G G GGGGG G G GGGG G G Sbjct: 287 GATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 52.8 bits (121), Expect = 4e-07 Identities = 32/82 (39%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G GGG G GGG G G G GG GG GG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GGGG + G G GGGG G Sbjct: 195 GYGGGGGGY-GGSGYGGGGGYG 215 Score = 50.4 bits (115), Expect = 2e-06 Identities = 31/81 (38%), Positives = 32/81 (39%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G R GG G G GGG GGG G G G GG GG GG Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGY-----GGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G GG + G G GGGG G Sbjct: 201 GGYGGSGYGGGGGYGGGGYGG 221 Score = 48.4 bits (110), Expect = 8e-06 Identities = 33/81 (40%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG--GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G GR GG G G GG G GGGG G G G GG GG GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG----GGYGGG 179 Query: 757 AXXGGG-GXVFXXGXGRGGGG 698 GGG G G G GGGG Sbjct: 180 GYGGGGHGGGGYGGGGYGGGG 200 Score = 45.2 bits (102), Expect = 8e-05 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G GG G G G GG R G GG GG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 721 GXGRGGGGXLG 689 G G GGGG G Sbjct: 183 GGGHGGGGYGG 193 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GGG GGG G G G GG G GG Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG--GGGGGYGGSGYGGGGG 213 Query: 751 XGGGGXVFXXGXGRGGGG 698 GGGG G GR GGG Sbjct: 214 YGGGG----YGGGRSGGG 227 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGX--GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G GR GG G G GGG G GG G G +G GG GG GG Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Query: 757 AXXGGG 740 GGG Sbjct: 223 RSGGGG 228 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 2/84 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG-GGGXFXGXGXPXGGXEXPG-XXXXXXX 760 GG G R GGG GGG GRG GGG + G G GG G Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGG 193 Query: 759 XXXXXXXXGFFXXGXGGGGGVXWG 688 G+ G GGGGG G Sbjct: 194 GGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 35.1 bits (77), Expect = 0.083 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGG-GXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GG G GGGG G G GG G GGGG + G G G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGGGG GGG G G GG G G Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 52.4 bits (120), Expect = 5e-07 Identities = 30/71 (42%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR----GGAXXGGGGX 734 GG G G GGG GGGG G G G GGA GG GGA GGGG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 733 VFXXGXGRGGG 701 G GGG Sbjct: 111 TGGHGGATGGG 121 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGG--GGXXXGXGXXXWGXGGARXXGGXRGG 758 G G A G G G GGG GG GG G GG G GG Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Query: 757 AXXGGGGXVFXXGXGRGGGG 698 A GGGG G GGGG Sbjct: 145 ATGGGGGATGGGGGATGGGG 164 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR----GGAXXGGGGX 734 GG G G G GGGG G G G GGA GG GGA GGGG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA 103 Query: 733 VFXXGXGRGG-GGXLG 689 G GG GG G Sbjct: 104 TGGGGGATGGHGGATG 119 Score = 46.0 bits (104), Expect = 4e-05 Identities = 33/86 (38%), Positives = 33/86 (38%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG----GXR 764 G G A G G G GGG GGGG G G G GGA G G Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATG--GGGGATGGGGGATGGHGGATGGGVGATGGH 128 Query: 763 GGAXXGGGGXVFXXGXGRGG-GGXLG 689 GGA G GG G GG GG G Sbjct: 129 GGATGGHGGATGGHGGATGGGGGATG 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GGG G G G GGA G GGA GGGG Sbjct: 41 GATGGHGGATGGGGGAT----GGGATGGGGGATGGGGGAT---GGHGGATGGGGGATGDG 93 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 94 GGATGGGG 101 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 6/77 (7%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-----GXRGGAXXGGGG 737 GG G G GG GGGG G G G GG G G GGA GG G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Query: 736 XVFXXGXGRGG-GGXLG 689 G GG GG G Sbjct: 124 ATGGHGGATGGHGGATG 140 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXG--GXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG G G G GGA G G GGA GGGG G GGGG Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGG 87 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A G G G GGG G GG G G G GGA GG GG Sbjct: 99 GGGGATGGGGGATGGHGGAT--GGGVGATGGHGGATGGHGGATGGHGGAT--GG--GGGA 152 Query: 751 XGGGGXVFXXGXGRGGG 701 GGGG G G GG Sbjct: 153 TGGGGGATGGGGGATGG 169 Score = 35.1 bits (77), Expect = 0.083 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = -2 Query: 832 GXXXGXGXXXWGXGGARXXGGXR--GGAXXGGGGXVFXXGXGRGG-GGXLG 689 G G G G GGA GG GGA GGGG G GG GG G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATG 84 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGGGG GGG G GGGG G G GG Sbjct: 41 GATGGHGGATGGGGGATGGGATGGGGGATG-GGGGATGGHGGATGG 85 Score = 32.3 bits (70), Expect = 0.58 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG GGGGG G GG GGGG G G Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDG 93 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG G G GGG GGGG G G GG Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATG--GGGGATGGGGGATGG 113 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG G G GGG GGGG G G GG Sbjct: 126 GGHGGATGGHGGATGGHGGATGGGGGATG--GGGGATGGGGGATGG 169 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGR-GGGGXFXGXGXPXGG 796 G G GGGGG G GG GGGG G G GG Sbjct: 74 GATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGG 120 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG-GXFXGXGXPXGG 796 G G GGGGG G GG GGG G G G GG Sbjct: 88 GATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGG 134 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXG---XGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGGG G G G G GGG G G GG G Sbjct: 52 GGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATG 105 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GG G G GGG GGG G G GG G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGD-GGGATGGGGGATGGGGGATG 112 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGG-----GGXFXGXGXPXGG 796 GG G GG G G GG G GG GG G G GG Sbjct: 105 GGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGG 155 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 52.0 bits (119), Expect = 7e-07 Identities = 31/81 (38%), Positives = 31/81 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG G GG G G G A GG GG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G G GGGG G Sbjct: 855 GGGGGGGGGGGGGGGGGGGGG 875 Score = 50.8 bits (116), Expect = 2e-06 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G G GGGG G G GG GG G Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G G GGGG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGG 868 Score = 50.8 bits (116), Expect = 2e-06 Identities = 31/83 (37%), Positives = 32/83 (38%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGX--GXXXWGXGGARXXGGXRGG 758 G G GG G G GGG GGGG G +G GG G GG Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGG 850 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GGGG G G GGGG G Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGG 873 Score = 50.0 bits (114), Expect = 3e-06 Identities = 33/91 (36%), Positives = 33/91 (36%), Gaps = 8/91 (8%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG- 761 V G G GG G G GGG GGGG G G G GG GG G Sbjct: 767 VVGGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGD 826 Query: 760 -------GAXXGGGGXVFXXGXGRGGGGXLG 689 G GGG G G GGGG G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 48.8 bits (111), Expect = 6e-06 Identities = 29/80 (36%), Positives = 30/80 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GG GGG G G GG GG GG Sbjct: 802 GDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 Query: 751 XGGGGXVFXXGXGRGGGGXL 692 GGGG G G GGGG + Sbjct: 862 GGGGGG---GGGGGGGGGVI 878 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGG G GGG G GGGG G G GG Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG G G GGG G GGGG G G GG Sbjct: 824 GGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGG G GGG G GGGG G G GG Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG GGGGG G GGG G GGGG Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G G GG G GGG G GGGG G G Sbjct: 834 GGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGGGG G GGG G GGGG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGGG G GGG G GGGG Sbjct: 847 GGGGGGGGGGGGGGGG-----GGGGGGGGGGGGGG 876 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXG-GGXXXGRGGGGXFXGXGXPXGG 796 GG G GG GG G G GG GGG G G GG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 50.8 bits (116), Expect = 2e-06 Identities = 27/66 (40%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP PP P P PPYP P NPPPP+ PPP P P PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYP---PPPNAPNPPPPNPPYPPPPNAPNP-PYPPPPNAPN 230 Query: 915 XARPXP 932 P P Sbjct: 231 PPYPPP 236 Score = 48.4 bits (110), Expect = 8e-06 Identities = 26/66 (39%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAP--PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP PP PP AP P P+ P P PPPP+ PPP P P PP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPY-PPPPNPPYPPPPNAPNP-PPPNPPYPPP 214 Query: 915 XARPXP 932 P P Sbjct: 215 PNAPNP 220 Score = 48.0 bits (109), Expect = 1e-05 Identities = 30/115 (26%), Positives = 32/115 (27%) Frame = +2 Query: 593 PPXPGXPXXKNXSXXXXXXXXXXXXXXXXAXXPQXTPPPPPXPXXKNXXXXXXXXXXXXX 772 PP P P + P PPPP P N Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 773 XXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P PP P PPPP P PPP PPPP P PP+ Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPN-APNPPYPPPPNAPNPPYPPPPN 238 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/65 (36%), Positives = 26/65 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP P P+ P P PPPP+ P P P P PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPY-PPPPNAPYPPSPNAPYP-PPPNPPYPPPL 160 Query: 918 ARPXP 932 P P Sbjct: 161 YPPPP 165 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/70 (37%), Positives = 28/70 (40%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNP--PPPSXXXXPP--PXXXXPXXXPXPP 902 PPPP PP P P PP P+ P P P PPP+ PP P P P PP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Query: 903 XXXXXARPXP 932 P P Sbjct: 222 YPPPPNAPNP 231 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P PP PP PP P+ P P PPP P P P P P PP Sbjct: 151 PPNPPYPPPLYPPPPNPPP-PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 915 XARPXP 932 P P Sbjct: 210 PYPPPP 215 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPPXXXX 914 P PP PP PP PPYP P P PPP + PP P P P PP Sbjct: 90 PNPPYPPPP-YPPYPPPPPYP--PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNA 146 Query: 915 XARPXP 932 P P Sbjct: 147 PYPPPP 152 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP AP PP PP P+ P P PP PP P P PP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 921 RPXP 932 P P Sbjct: 177 PPYP 180 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-XXXPXPPXXXXX 917 PPP P PP PP P+ P P NPP P PPP P P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYP-PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Query: 918 ARPXP 932 P P Sbjct: 184 NPPYP 188 Score = 42.3 bits (95), Expect = 5e-04 Identities = 33/125 (26%), Positives = 34/125 (27%), Gaps = 10/125 (8%) Frame = +2 Query: 593 PPXPGXPXXKNXSXXXXXXXXXXXXXXXXAXXPQXTPPPP----PXPXXKNXXXXXXXXX 760 PP P P N P P PP P P N Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP 162 Query: 761 XXXXXXXPGXSXPPXGXPXPXXXP--PPPLPXXXPPPX----PXXXXXXPPPPPRXXXGX 922 P PP P P P PPP P PPP P PPPP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 923 PXPPH 937 P PP+ Sbjct: 223 PPPPN 227 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P PP P+ P P PPPP+ PPP P P PP P P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP-PPPNPPYPPPPNAPYP 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP-XXXXPXXXPXPPXXXX 914 PP P PP P PP P P PP P+ PPP P P PP Sbjct: 111 PPNPPYPPPPNAPYP-PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Query: 915 XARPXP 932 P P Sbjct: 170 PNAPYP 175 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P P PPP P PPP P PPPP P P Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 37.1 bits (82), Expect = 0.020 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 2/75 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPP--PLPXXXPP 862 P PPPP P N P PP P P PPP P P PP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPP--PNAPNPPP--PNPPYPPPPNAPNPPYPPP 225 Query: 863 PXPXXXXXXPPPPPR 907 P PPP P+ Sbjct: 226 PNAPNPPYPPPPNPQ 240 Score = 36.7 bits (81), Expect = 0.027 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXPXXXPXP 899 PP P P PP AP P P P PPP P+ PPP P P P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPP---PPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P P P P PP P PPP P PPPP P PP+ Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNP----PYPPPPNAPYPPPPNPPY 132 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P PP P P PP P P PP P PP PP P P+ Sbjct: 95 PPPPYPPYPPPPPYPPPPNP-PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPN 145 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP-PPRXXXGXPXPPH 937 P PP P PPPP PPP P P PP P PP+ Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 S P P P PPP P PP P P PP P PP+ Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPN 137 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + PP P PPPP P PPP P PPPPP P PP Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP P P P P PPPP PP P P PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPP----PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 402 Query: 918 ARPXP 932 P P Sbjct: 403 GPPPP 407 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + PP P P PPPP P PP P PPPPP G P PP Sbjct: 360 PTNNTPPP--PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + P P P PPP P PP P PPPPP G P PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/75 (34%), Positives = 27/75 (36%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP N P + PP P P PPPP P PP P Sbjct: 346 PPPPPT----NNPPSPPPPTNNTPPPPPPTNKPPP-PPPPTNGPPPPPPPTNGPPPPPPP 400 Query: 881 XXXPPPPPRXXXGXP 925 PPPPP G P Sbjct: 401 TNGPPPPPPPTNGPP 415 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + P P PPPP P PPP P PPPPP P PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P PP PP P P PPP + PPP P P P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP PP PP P P PPP + PPP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G + PP P PPPP PPP P PPPPP G P PP Sbjct: 343 GVNPPPPPTNNPPS-PPPPTNNTPPPPPP---TNKPPPPPPPTNGPPPPP 388 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/87 (26%), Positives = 24/87 (27%), Gaps = 4/87 (4%) Frame = +2 Query: 689 PQXTPPP----PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXX 856 P PPP PP P N P + PP P P PPP P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP--PPPPTNGPPPPPPPT 411 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P R G PH Sbjct: 412 NGPPSEGKCGRKPAGARIINGQNAQPH 438 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 NPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXPXT 938 NPPPP P P P PP P P T Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPT 381 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 48.4 bits (110), Expect = 8e-06 Identities = 28/68 (41%), Positives = 29/68 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GGGG G G G G G GG GGGG + Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGM--GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG 1813 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 1814 GGGMGGGG 1821 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXX-EGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G GGG EG GG G G GG GG G Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Query: 754 XXGGGGXVFXXGXGRGGGG 698 GGG G G GGGG Sbjct: 1826 AAGGGMGAGGEGGGAGGGG 1844 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GGGG G G G G A G GG GGGG G GGGG +G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A G G G GG GGGG G G GG GG GGA Sbjct: 1782 GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Query: 751 XGGGG 737 GGGG Sbjct: 1842 GGGGG 1846 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/81 (34%), Positives = 29/81 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG GGG G G G G G GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAA-GGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG + G G G GG G Sbjct: 1818 GGGGEGMGAAGGGMGAGGEGG 1838 Score = 37.1 bits (82), Expect = 0.020 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGG G GGG G GGGG G G GG E G Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAG-GGGGMGGGGGGMGGGGEGMG 1825 Score = 33.9 bits (74), Expect = 0.19 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFFX 724 G GGG G GGG GGGG G G GG E G Sbjct: 1757 GFGGGGGGGGMGGGGGM---AGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG 1813 Query: 723 XGXGGGGGVXWG 688 G GGGG G Sbjct: 1814 GGGMGGGGEGMG 1825 Score = 32.7 bits (71), Expect = 0.44 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 4/82 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXG---RGGGGXF-XGXGXPXGGXEXPGXXXXX 766 GG G GGGGG GGG G GGGG G G GG G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGM 1824 Query: 765 XXXXXXXXXXGFFXXGXGGGGG 700 G GGGGG Sbjct: 1825 GAAGGGMGAGGEGGGAGGGGGG 1846 Score = 32.3 bits (70), Expect = 0.58 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 10/88 (11%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGG----------GXXXGRGGGGXFXGXGXPXGGXEXP 784 GG G GGGGG G GG G G GGGG G G GG Sbjct: 1759 GGGGGGGGM-GGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Query: 783 GXXXXXXXXXXXXXXXGFFXXGXGGGGG 700 G G G GGGGG Sbjct: 1818 GGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG GGG G GGG G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFG 1793 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/68 (41%), Positives = 28/68 (41%), Gaps = 3/68 (4%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGG---GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G GGG GGG G G G G GG GG RGG GGG Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Query: 721 GXGRGGGG 698 G RGGGG Sbjct: 187 GGSRGGGG 194 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GG G G G G GG GG RG GG Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG-RGRGTGGGSRGGGGD 195 Query: 721 GXGRGGGG 698 G GRG GG Sbjct: 196 GRGRGRGG 203 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GG GGG G G G GG R GG GG G GG Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGI-GRGGGRGRGGGEGG-WGGRGGNGGGR 172 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 173 GGGEGGGG 180 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 RGGG G G GGG G GGGG G G G G Sbjct: 155 RGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Score = 35.1 bits (77), Expect = 0.083 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GG G RGGG G G GGG RGGGG G G GG E Sbjct: 163 GGRGGNGGGRGGGEGGGGRGRGTGGGS---RGGGG--DGRGRGRGGTE 205 Score = 32.7 bits (71), Expect = 0.44 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GG GG G G G G GG GG G Sbjct: 140 GNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGR 199 Query: 751 XGGGGXVFXXGXGRGGG 701 GG G G G Sbjct: 200 GRGGTEERTRIEGYGSG 216 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG GG GG G GGG G GG G G G GG + G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGG--EGGGGRGRGTGGGSRGGGGDGRG 198 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFXXGXGRGGGGXLG 689 G G G W GG + GG G GGG G G GRGGG G Sbjct: 107 GYGAKRENGMEGWRRGGVQR-GGRGGWRGRGGGEGNGAGGGIGRGGGRGRG 156 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/67 (38%), Positives = 28/67 (41%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG +GG G G G G GG GG GG GGGG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGG-GYGGGHGGGGYGGGGRHDYG 238 Query: 721 GXGRGGG 701 G +GGG Sbjct: 239 GGSKGGG 245 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G R+ GG G GGG GGGG G G +G GG GG G Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 37.5 bits (83), Expect = 0.015 Identities = 23/52 (44%), Positives = 25/52 (48%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 + GGG G G G G GG GG+ GGGG G GRGGGG G Sbjct: 177 DSGGGGSQGGGYRSGGGGYGGSKGGYGGGS--GGGG----YGGGRGGGGYGG 222 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXX-GGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG G G GG++ GG GG GGG G G GGGG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGG G G GGG G GGG + G G Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 33.5 bits (73), Expect = 0.25 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---G 761 G + GG G GGG GG G G G G GG GG R G Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGG--GGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 760 GAXXGGG 740 G GGG Sbjct: 239 GGSKGGG 245 Score = 32.7 bits (71), Expect = 0.44 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXGXPXGG 796 GG R GGGG G GGG G GGG G G GG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGG 226 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/72 (27%), Positives = 22/72 (30%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXX 739 P GGGG GGG +GG G G G GG G Sbjct: 174 PRGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Query: 738 XGFFXXGXGGGG 703 + G GGG Sbjct: 234 RHDYGGGSKGGG 245 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GG G G G G G GG GG G A Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Query: 751 XGGGGXVFXXGXGR-GGGGXLG 689 G GG V G G GG G G Sbjct: 93 AGAGGNVGGGGSGGVGGNGGSG 114 Score = 44.8 bits (101), Expect = 1e-04 Identities = 29/76 (38%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GGG G G G GG G GGA GGGG Sbjct: 28 GGVGVGVGGGGVGGGGG---NGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGN 84 Query: 721 GX-----GRGGGGXLG 689 G G G GG +G Sbjct: 85 GGAAGAAGAGAGGNVG 100 Score = 32.7 bits (71), Expect = 0.44 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGG-GXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG G G G GGG G GGGG G G GG Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGG--AGNGGGGGG 81 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG GG G GGG G G G G GG Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Score = 30.3 bits (65), Expect = 2.4 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXX---XXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXX 763 GG G GGG G GGG G GGGG G G GG G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGG---GGGAGNGGAAGAA 91 Query: 762 XXXXXXXXXGFFXXGXGGGGG 700 G G GG GG Sbjct: 92 GAGAGGNVGGGGSGGVGGNGG 112 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP----SXXXXPPPXXXXPXXXPXP 899 T PPPP PP PP PP P P P P PP + PPP P P P Sbjct: 202 TQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXG-XPXPP 934 PP P P PPPP P P P P PP PPR P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSP-PRPPPPPPPSPPRPLAAKLPEPP 249 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP-PPPRXXXGXPXP 931 G S P PPPP P PPP P PP PPP P P Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P PP R PP P P P +PP P P P P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 35.1 bits (77), Expect = 0.083 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P P P P PPPPP P PP Sbjct: 198 PSQITQPPPPPPRPPPSPPP------PPPPPSPSPPRPPPP 232 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P PP P P PPP P PP PPP P P P Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 692 QXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 Q T PPPP P P PP P P PP PL P P P Sbjct: 200 QITQPPPPPP---------RPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Query: 872 XXXXXXPPPPP 904 PPP Sbjct: 251 IPNMPPTLPPP 261 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +3 Query: 762 PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P PP P P P PPPP PP P P P P P Sbjct: 195 PTSPSQITQPP-PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPP P PPPPP P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRP 229 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/70 (38%), Positives = 28/70 (40%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAP-----PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP AP P PP A P P +PPPPS PPP P P PP Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPS--GGPPPPPPPPPPPPPPP 209 Query: 903 XXXXXARPXP 932 A P P Sbjct: 210 ILELAAPPPP 219 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P P PPPP P PPP P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPIL 211 Query: 881 XXXPPPPPRXXXG 919 PPPP G Sbjct: 212 ELAAPPPPGSVLG 224 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/82 (30%), Positives = 26/82 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P P + P P PPPP PPP Sbjct: 146 PATGGPPPPPPIAP-----ATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPP 200 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P PP Sbjct: 201 PPP---PPPPPPILELAAPPPP 219 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP-----SXXXXPPPXXXXPXXXP 893 +T P PP P RAPP P P PPPP + PPP P Sbjct: 118 ETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVP 177 Query: 894 XPPXXXXXARPXP 932 P A P P Sbjct: 178 APAVPLAAASPPP 190 Score = 35.9 bits (79), Expect = 0.047 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXP-XXXPXPPXX 908 PPPP AP PP P PPP P+ PPP P P PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 909 XXXARPXP 932 A P Sbjct: 170 IAPAATVP 177 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P PP PP P PPPP G P PP Sbjct: 108 PTPPPPPRAPETPSQAPSPP----PPPTSPATRAPPPPPPIAPATGGPPPP 154 Score = 34.3 bits (75), Expect = 0.14 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 19/84 (22%) Frame = +3 Query: 738 PPPPXX-------------------APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 PPPP PP PP A P P +PPPPS P Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPP 197 Query: 861 PPXXXXPXXXPXPPXXXXXARPXP 932 PP P P PP A P P Sbjct: 198 PP---PPPPPPPPPPILELAAPPP 218 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP---RXXXGXPXPP 934 P P P P P P PPP P PPPP G P PP Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 762 PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP RAP P P P P P+ PPP P PP Sbjct: 108 PTPPPPPRAPETP-SQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP 153 Score = 30.3 bits (65), Expect = 2.4 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 5/84 (5%) Frame = +2 Query: 698 TPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLP-XXXPP 862 TPPPPP P P P G P P PPP P PP Sbjct: 109 TPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP---PPPIAPATGGPP 165 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PP Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPP 189 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/51 (45%), Positives = 24/51 (47%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGGG G G G GG G GG GGGG G G GGGG +G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG GGGG G G G GG GG GG GGGG G GR G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGGG G G G GG G GG GGGG G G GGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +GGGG G G G GG GG GGGG G G GGGG G Sbjct: 61 DGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GGGG G G GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GGG GGGG G G GG GG GG GGGG V Sbjct: 62 GGGGGGGGGGGGGGG-----GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGV 113 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 GG G G GGG +GGGG G G G GG GG G A G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG GGG G GGGG G G GG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GG G GGG G G GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GG G GGGG G GGG G GGG G G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGG 770 G G GG G G GGG GGGG G G G G R G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGGG G GGG G GGG G G GG Sbjct: 62 GGGGGGGGGGGGGGGGG--GGGGGDDGDGGGGDGGG 95 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGGGG G GGG G G G G GG + G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG 788 G G GG G G GG GGGG G G G GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG 788 G G GG G G G G GGGG G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 45.6 bits (103), Expect = 6e-05 Identities = 27/83 (32%), Positives = 27/83 (32%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP N G PP P PPPPL PPP Sbjct: 265 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA--PPPPLNATPPPPP 322 Query: 869 PXXXXXXPPPPP-RXXXGXPXPP 934 P PPPP R P PP Sbjct: 323 PSRDQVPLPPPPLRGQIAPPPPP 345 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP PP APP P P P PPPP PP P P P Sbjct: 342 PPPPISKPPTST--RSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP + PP P P PPP + PPP P PP Sbjct: 281 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAP-PPPLNATPPPPPPSRDQVPLPPPPLRGQI 339 Query: 918 ARPXP 932 A P P Sbjct: 340 APPPP 344 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/70 (32%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +2 Query: 701 PPPPPX--PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPX 874 PPPPP P ++ PG + PP P PP P PPP P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP-PK 274 Query: 875 XXXXXPPPPP 904 PPPPP Sbjct: 275 RGSSNPPPPP 284 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 5/90 (5%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL----- 844 A P+ + PPPP P PP G P P P Sbjct: 132 APPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFP--PPPPMGKPPPPSGNKPTFGNSRT 189 Query: 845 PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP P PPPP G P PP Sbjct: 190 STNGPPPPPHSRHGSAPPPPERSSGPPPPP 219 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 8/71 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR----APPYP---HXXXPXPXXNPPPPSXX-XXPPPXXXXPXXXP 893 PPPP A P PP R PP P P P + PP S PPP P Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 894 XPPXXXXXARP 926 PP RP Sbjct: 370 GPPPPPPGRRP 380 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/82 (26%), Positives = 26/82 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ + PPP P + G S P P PPPP+ Sbjct: 209 PERSSGPPPPPPGRGPSQRSLAPPPT------GSSRPLPAPPPGENRPPPPMRGPTSGGE 262 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP R P PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPP 284 Score = 35.1 bits (77), Expect = 0.083 Identities = 20/57 (35%), Positives = 23/57 (40%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 ++ PPPP P+ P PP P P NPPPP PPP P P Sbjct: 354 RSAPPPPPGRAPQ-PLGGPPPPPPGRRPPSGKINPPPP-----PPPAMDKPSFTNGP 404 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA----PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XP 899 PPP P PP R PP P P + PPP P P P P P Sbjct: 321 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 381 PSGKINPPPPP 391 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +3 Query: 738 PPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 PPPP APP PP + P P P P P PPP P P P Sbjct: 331 PPPPLRGQIAPP-PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 389 Query: 900 PXXXXXARP 926 P +P Sbjct: 390 PPPPAMDKP 398 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/82 (25%), Positives = 23/82 (28%), Gaps = 3/82 (3%) Frame = +2 Query: 698 TPPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 +PPPP P P + P PP P PPP Sbjct: 139 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 198 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PPPP R P PP Sbjct: 199 HSRHGSAPPPPERSSGPPPPPP 220 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 738 PPPPXXAPPRX----PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP P + PP + P P P PPPP P P PP Sbjct: 217 PPPPGRGPSQRSLAPPPTGSSRPLP--APPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 274 Query: 906 XXXXARPXPXT 938 P P T Sbjct: 275 RGSSNPPPPPT 285 Score = 32.7 bits (71), Expect = 0.44 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P P S PP PPPP P P P Sbjct: 313 PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTST---RSAPPPP-PGRAPQPL 368 Query: 869 PXXXXXXPPPPP--RXXXGXPXPP 934 PPPPP R G PP Sbjct: 369 ----GGPPPPPPGRRPPSGKINPP 388 Score = 32.3 bits (70), Expect = 0.58 Identities = 24/77 (31%), Positives = 28/77 (36%), Gaps = 12/77 (15%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-----PXPXXN-----PPPP--SXXXXPPPXXXXP 881 PPPP PP PP P + + P P + PPPP S PPP P Sbjct: 167 PPPPMGKPP--PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Query: 882 XXXPXPPXXXXXARPXP 932 P +RP P Sbjct: 225 SQRSLAPPPTGSSRPLP 241 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXX----APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP APP PP P P PPP+ P P P PP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXG 919 PPPP P PPP PPP G Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPPSSKNRG 31 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP +PP P P P PS PPP P P PP Sbjct: 125 PPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPP---PPMGKPPPP 177 Score = 29.1 bits (62), Expect = 5.4 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 11/89 (12%) Frame = +2 Query: 701 PPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX--PPPPLPXXXP-- 859 PPPP P P N P S P P PPPP P P Sbjct: 167 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQ 226 Query: 860 ----PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP P PP Sbjct: 227 RSLAPPPTGSSRPLPAPPP--GENRPPPP 253 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/82 (31%), Positives = 26/82 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP N G PP P PPPPL PPP Sbjct: 177 PPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA--PPPPLNATPPPPP 234 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 235 PSRDQVPLPPPPLRGQIAPPPP 256 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP PP APP P P P PPPP PP P P P Sbjct: 254 PPPPISKPPTST--RSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP + PP P P PPP + PPP P PP Sbjct: 193 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAP-PPPLNATPPPPPPSRDQVPLPPPPLRGQI 251 Query: 918 ARPXP 932 A P P Sbjct: 252 APPPP 256 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/70 (32%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +2 Query: 701 PPPPPX--PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPX 874 PPPPP P ++ PG + PP P PP P PPP P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP-PK 186 Query: 875 XXXXXPPPPP 904 PPPPP Sbjct: 187 RGSSNPPPPP 196 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/90 (27%), Positives = 27/90 (30%), Gaps = 5/90 (5%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL----- 844 A P+ + PPPP P PP G P P P Sbjct: 44 APPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFP--PPPPMGKPPPPSGNKPTFGNSRT 101 Query: 845 PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP P PPPP G P PP Sbjct: 102 STNGPPPPPHSRHGSAPPPPERSSGPPPPP 131 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 8/71 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR----APPYP---HXXXPXPXXNPPPPSXX-XXPPPXXXXPXXXP 893 PPPP A P PP R PP P P P + PP S PPP P Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 894 XPPXXXXXARP 926 PP RP Sbjct: 282 GPPPPPPGRRP 292 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/82 (26%), Positives = 26/82 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ + PPP P + G S P P PPPP+ Sbjct: 121 PERSSGPPPPPPGRGPSQRSLAPPPT------GSSRPLPAPPPGENRPPPPMRGPTSGGE 174 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP R P PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPP 196 Score = 35.1 bits (77), Expect = 0.083 Identities = 20/57 (35%), Positives = 23/57 (40%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 ++ PPPP P+ P PP P P NPPPP PPP P P Sbjct: 266 RSAPPPPPGRAPQ-PLGGPPPPPPGRRPPSGKINPPPP-----PPPAMDKPSFTNGP 316 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA----PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XP 899 PPP P PP R PP P P + PPP P P P P P Sbjct: 233 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 293 PSGKINPPPPP 303 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +3 Query: 738 PPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 PPPP APP PP + P P P P P PPP P P P Sbjct: 243 PPPPLRGQIAPP-PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 301 Query: 900 PXXXXXARP 926 P +P Sbjct: 302 PPPPAMDKP 310 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/82 (25%), Positives = 23/82 (28%), Gaps = 3/82 (3%) Frame = +2 Query: 698 TPPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 +PPPP P P + P PP P PPP Sbjct: 51 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 110 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PPPP R P PP Sbjct: 111 HSRHGSAPPPPERSSGPPPPPP 132 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 738 PPPPXXAPPRX----PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP P + PP + P P P PPPP P P PP Sbjct: 129 PPPPGRGPSQRSLAPPPTGSSRPLP--APPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 186 Query: 906 XXXXARPXPXT 938 P P T Sbjct: 187 RGSSNPPPPPT 197 Score = 32.7 bits (71), Expect = 0.44 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P P S PP PPPP P P P Sbjct: 225 PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTST---RSAPPPP-PGRAPQP- 279 Query: 869 PXXXXXXPPPPP--RXXXGXPXPP 934 PPPPP R G PP Sbjct: 280 ---LGGPPPPPPGRRPPSGKINPP 300 Score = 32.3 bits (70), Expect = 0.58 Identities = 24/77 (31%), Positives = 28/77 (36%), Gaps = 12/77 (15%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-----PXPXXN-----PPPP--SXXXXPPPXXXXP 881 PPPP PP PP P + + P P + PPPP S PPP P Sbjct: 79 PPPPMGKPP--PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Query: 882 XXXPXPPXXXXXARPXP 932 P +RP P Sbjct: 137 SQRSLAPPPTGSSRPLP 153 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXX----APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP APP PP P P PPP+ P P P PP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP +PP P P P PS PPP P P PP Sbjct: 37 PPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPP---PPMGKPPPP 89 Score = 29.1 bits (62), Expect = 5.4 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 11/89 (12%) Frame = +2 Query: 701 PPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX--PPPPLPXXXP-- 859 PPPP P P N P S P P PPPP P P Sbjct: 79 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQ 138 Query: 860 ----PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP P PP Sbjct: 139 RSLAPPPTGSSRPLPAPPP--GENRPPPP 165 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/70 (40%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGX--GGARXXGGXRGGAXXGGGGXVF 728 GG G G GGG GGGG G G G GG GG RGG+ G G Sbjct: 749 GGYGNRSGGGYRGGGGYG--GGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYK 806 Query: 727 XXGXGRGGGG 698 G G+G GG Sbjct: 807 SGGYGQGSGG 816 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/69 (39%), Positives = 28/69 (40%), Gaps = 2/69 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGA--RXXGGXRGGAXXGGGGXVF 728 GG G GG GGGG G GG R GG RGG GGGG + Sbjct: 718 GGRGGWQKDYQRGG-----RGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGY 772 Query: 727 XXGXGRGGG 701 G G GGG Sbjct: 773 RGGGGYGGG 781 Score = 37.5 bits (83), Expect = 0.015 Identities = 27/71 (38%), Positives = 28/71 (39%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG G G +G GG GG RGG GGG Sbjct: 735 GGYGGGYNDRRMQQGGYGNRSGGGYRGGGG---YGGGG----GGYRGGGGYGGG---HRG 784 Query: 721 GXGRGGGGXLG 689 G G GGGG G Sbjct: 785 GGGYGGGGHRG 795 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/68 (33%), Positives = 25/68 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GGG G G G R G + G G G Sbjct: 763 GGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYR--GSYKSGGYGQGSG----- 815 Query: 721 GXGRGGGG 698 G G+G GG Sbjct: 816 GYGQGSGG 823 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGG-GGXFXGXGXPXGGXEXPG 781 R GGG G GGG G GG GG G G GG G Sbjct: 754 RSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GG GGGGG GGG G GGG + G G G Sbjct: 757 GGYRGGGGYGGGGGGYR-----GGGGYGGGHRGGGGYGGGGHRGG 796 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSX-XXXPPPXXXXPXXXPXPP 902 P PP AP PP AP P P PPPP PPP P P PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP P A P PP A P P PPPP PPP P P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P PPP P PPP P PPP P PPH Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPPP AP PP P P P P PPPP P P P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAP--PPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P PP P PPPP P PPP P Sbjct: 51 PPPPPSP------PAAAPAAPPPPAAAPAAPPPPAA---PPAAPPPPPPLPAPPPPPAQP 101 Query: 881 XXXPPPPP 904 PPP P Sbjct: 102 APQPPPAP 109 Score = 37.1 bits (82), Expect = 0.020 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +2 Query: 791 SXPPXGXPXPXXX----PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP P P PPPP PP P PPPPP P PP Sbjct: 48 SSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP-PLPAPPPPP 98 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P P P PP P P PPP P PP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +3 Query: 756 APPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPX 929 +PP P P AP P P PPP + PPP P P PP +P Sbjct: 49 SPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP--PPPLPAPPPPPAQPAPQPP 106 Query: 930 P 932 P Sbjct: 107 P 107 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 795 YPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 YPH P PP PP+ PP P PP A P P Sbjct: 42 YPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP 88 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/85 (30%), Positives = 30/85 (35%), Gaps = 6/85 (7%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 T PPPP P ++ G + PP G P PPPP+ PPP P Sbjct: 324 TAPPPPPPS-RSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIE 382 Query: 878 XXX------XPPPPPRXXXGXPXPP 934 PPPPP P P Sbjct: 383 GRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +2 Query: 701 PPP----PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PPP PP P + P S P P PPP P P Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP-PSMGMAPP 356 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP G P PP Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPP 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP P PP P PPP+ PPP P Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP---PPSMGMAPPPVGGAAPPPPPPPPV 371 Query: 884 XXPPPPPRXXXGXP 925 PPPPP G P Sbjct: 372 GGPPPPPPPIEGRP 385 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP APP PP + P P PPPPS PPP P PP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPP----PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPV 371 Query: 909 XXXARPXP 932 P P Sbjct: 372 GGPPPPPP 379 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G + PP P PPPP PPP P PPPPP PP Sbjct: 294 GAAPPPPSRGAP---PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P PPP P + P P PPPP P Sbjct: 296 APPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAP 355 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP PPPPP P PP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP P PPPP PPP P PPPP R P PP Sbjct: 284 GIQPPPP--PSRGAAPPPP-SRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP----XPPX 905 PPP APP P APP P PPP PPP P PP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Query: 906 XXXXARPXP 932 A P P Sbjct: 358 VGGAAPPPP 366 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR-APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP PP R APP P P PPPP+ PP PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAP---PPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 915 XARPXP 932 A P P Sbjct: 344 GAPPPP 349 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP PP P P P PPP PPP P Sbjct: 367 PPPPVGGPPPPPPPIEGRPPSSLGNPPP----PPPPGRGAPPPGPMIP 410 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/73 (36%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXG--GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF 728 GG G G G GG GG G G +G GG GG G+ GGGG + Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGD-Y 199 Query: 727 XXGXGRGGGGXLG 689 G G GGG G Sbjct: 200 GGGPGYGGGQGYG 212 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/78 (33%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXX-EGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G G G G GGG EGG G G G G + GG GG Sbjct: 143 GGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGG 202 Query: 754 XXGGGGXVFXXGXGRGGG 701 GGG + G GGG Sbjct: 203 PGYGGGQGYGSYSGGGGG 220 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G RGG G GGG G G GG G G GG Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGG-GEGGYGMGGGDYSGG 186 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRG 707 GG GGGG G G G GG GG GG GGGG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G G G GGG GGGG G G G GG GG GGA G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 +GG G G G G GG GG GG GGGG G G GG G Sbjct: 658 DGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GGG GGGG G G G GG GG GG G GG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG G G G GG GG GG GGGG G G GGGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGAG 703 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GGGG G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGGGG G GGG G GGGG G G G + G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G G G G GG GG GG GGGG G G GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GGGGG G GGG G GGGG G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GGGG G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG GGGG G G G GG GG GGA G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Query: 718 XG 713 G Sbjct: 715 DG 716 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GGG GGGG G G G GG G G G G V Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDV 718 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGGGG G GGG G GGGG G G + G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GGGGG G GGG G GGGG G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 37.1 bits (82), Expect = 0.020 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 G G GGGGG G GGG G GGGG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -2 Query: 802 WGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +G GG GG GG GGGG G G GGGG G Sbjct: 656 YGDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GG G G G GG R GG GG G GG Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGG--GYGGGRGGGGYGGGRGGGYGGGRRDY 144 Query: 721 GXGRGGGG 698 G G GGG Sbjct: 145 GGGSKGGG 152 Score = 35.9 bits (79), Expect = 0.047 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---G 761 G RA GG G GG GGGG G G +G G GG R G Sbjct: 89 GGSRAGGYRSGGGGYGGSSR---GGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYG 145 Query: 760 GAXXGGG 740 G GGG Sbjct: 146 GGSKGGG 152 Score = 35.9 bits (79), Expect = 0.047 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G RGG GG GGG GRGGGG G G GG Sbjct: 99 GGGGYGGSSRGGYGGGRG-----GGGYGGGRGGGGYGGGRGGGYGG 139 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 906 RGGGG-GXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 RGGGG G G GGG G GGG G G GG + Sbjct: 115 RGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGGYD 154 Score = 32.3 bits (70), Expect = 0.58 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG-GGXVFXXGXGRGGGGXLGXXXR 677 G GG G G G GG GG GG GG G G G GG G R Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRR 142 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GGG G G GGG G GGG G GG + G Sbjct: 102 GYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -2 Query: 790 GARXXGGXRGGAXXGGGGXV-----FXXGXGRGGGGXLG 689 G R GG R G GGG G GRGGGG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 122 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P PPPP P PPP P PPPPP G P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPP-PGGAPPPPPP-----PPPPPPGDGGAPPPP 334 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 G + P P P PPPP P PPP P PPPPP Sbjct: 299 GSAPAPPPPPPPGGAPPPPPP--PPPPPPGDGGAPPPPPP 336 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +3 Query: 738 PPPPXX----APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP APP PP APP P P PPPP PPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPP------PPPPPPPPPPGDGGAPPP 333 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP + P PP PP P P P PPPP PP P Sbjct: 294 PPPADGSAPAPPP----PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P AP P P P PPPP PPP P PP Sbjct: 292 PPPPPADGSAPAPP--PPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P PPPP P PP P PPPPP P PP Sbjct: 288 GAPVP---PPPPADGSAPAPPPPPPPGGAPPPPP---PPPPPPP 325 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP P P PPPP PPP P PP A P P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPP-----PPPPPPGDGGAPPPP 334 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPP P PP PP P PPPP+ Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPPT 338 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P + PPPP P N PG S P P PPPP P Sbjct: 912 ASPPGGSVPPPPPPPGGNAPLPPPP---------PGGSAPSQPPPPGGNAPPPPPPPGGS 962 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP P PP Sbjct: 963 APPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP PG S PP G P PPP PPP P Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP--- 989 Query: 884 XXPPPPPRXXXG 919 PPPPP G Sbjct: 990 --PPPPPMRKLG 999 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLP----XXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PG S P P PPPP P PPP P PPPP P PP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 32.3 bits (70), Expect = 0.58 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S P G P PP PPP P PPPPP PP Sbjct: 901 SQTPGGSESPSASPPGG-SVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 P +P PP PP P PPPP S PPP P PP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/54 (25%), Positives = 18/54 (33%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P +P P +PP S PPP P PP ++P P Sbjct: 894 PRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/72 (36%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG----GAXXGGGGX 734 G G G GG + GGG G G G GGA+ G G GA GGGG Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGV 174 Query: 733 VFXXGXGRGGGG 698 G GGG Sbjct: 175 SGSSGTSIAGGG 186 Score = 35.5 bits (78), Expect = 0.063 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 5/88 (5%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V G A G G GG GGGG G G GGA GG GG Sbjct: 90 VFANGTAQAGASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAG-GGAAGGGGQEGG 148 Query: 757 AXXG--GGGXVFXXGXG---RGGGGXLG 689 G GG G GGGG G Sbjct: 149 GQGGAQAGGSTSGSSSGGATSGGGGVSG 176 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 GG G G G G GG GG GG GGGG G G GGGG G R Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG---GGGFGGGGGGGFGSRAR 132 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG GGGG G G G GG GG GG GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 37.1 bits (82), Expect = 0.020 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RGGG G G GGG G GGGG F G G GG Sbjct: 83 RGGGFGGGGGFGGGGGGGFGG-GGGGGFGGGGGGGGG 118 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 GG G GGGG G GGG G GGGG F P Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG--AXXGGGGXVF 728 GG GGGG G G +G GG GG GG GGGG F Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGF 127 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF-XGXGXPXGGXEXP 784 GG G GGGGG G GGG G GGGG F G G G P Sbjct: 85 GGFGGGGGFGGGGGGGFGG--GGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG GG G GGG G GGGG G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG-GGFGGGGGG 125 Score = 35.1 bits (77), Expect = 0.083 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G GGG GGGG G G G GG GG GG GG G Sbjct: 81 GGRGGGFG----GGGGFGGGGGGGFGGGGGG---GFGGGGGGGGGFGGGGGGGFG 128 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 922 RAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG 773 RA GG G GGG GGGG G G G GG G Sbjct: 77 RASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGAR 782 GG G G GGG GGGG G G G G+R Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 G + PP P P PPPP P PPP P PPPPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFP------PPPPP 494 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPP P PPP P PPPPP P P H Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPPP P PPP P PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPPP PP PP PP P P P PPPP+ Sbjct: 464 PPPPPPPPPPPPP----PPPPPPPPPPPFPPPPPPT 495 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P PP P P PPPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P PP P P PPPP P PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP 821 PPPP PP PP PP+P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 783 RAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 +APP P P P PPPP PPP P P P Sbjct: 462 QAPPPPPPPPPPPPPPPPPP----PPPPPPFPPPPPPTP 496 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 APP PP PP P P PPPP PPP Sbjct: 463 APPPPPPPPPPPP-----PPPPPPPPPPPPFPPPPPP 494 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P PP P P PPPP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +GGGG G G G G GG GG GGGG G G G GG G Sbjct: 50 DGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G G G +GGG G G GG G GG GGGG Sbjct: 53 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 33.5 bits (73), Expect = 0.25 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGX-GXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG +G G G G GG GG G GGGG G G GGGG G Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDG--GGGGDGDGGGGGDGGGGGDG 109 Score = 32.3 bits (70), Expect = 0.58 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G GGGG G G G G GGGG G G G + Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDGDD 119 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G G G GGG GGGG G G G GG G G Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXG---GGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GG GG G G GG GGGG G G GG + G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G G G GGG G G G GG GG GG Sbjct: 54 GGGDGDGDDDDGDGNV-GDDGGGDGGGCDGGGGDGDGGGGGD--GDGGG---GGDGGGGG 107 Query: 751 XGGGG 737 GGGG Sbjct: 108 DGGGG 112 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 GG G GG G G GGG G GGG Sbjct: 74 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG GGGG G G G G GGGG Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +GGGG G G G G GG GG GGGG G G G GG G Sbjct: 65 DGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G G G +GGG G G GG G GG GGGG Sbjct: 68 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 33.5 bits (73), Expect = 0.25 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGX-GXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG +G G G G GG GG G GGGG G G GGGG G Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDG--GGGGDGDGGGGGDGGGGGDG 124 Score = 32.3 bits (70), Expect = 0.58 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G GGGG G G G G GGGG G G G + Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDGDD 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G G G GGG GGGG G G G GG G G Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXG---GGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GG GG G G GG GGGG G G GG + G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G G G GGG G G G GG GG GG Sbjct: 69 GGGDGDGDDDDGDGNV-GDDGGGDGGGCDGGGGDGDGGGGGD--GDGGG---GGDGGGGG 122 Query: 751 XGGGG 737 GGGG Sbjct: 123 DGGGG 127 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 GG G GG G G GGG G GGG Sbjct: 89 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG GGGG G G G G GGGG Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/66 (34%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-XXXPXPPXXXX 914 P PP A P PP +PP P P P PPP + PPP P P P Sbjct: 1047 PSPPPSAVPIPPPRKPSPP-PSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Query: 915 XARPXP 932 +P P Sbjct: 1106 PRQPKP 1111 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +3 Query: 726 KKTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 +K PPP APP + PP + P P P P P P+ PPP P P P Sbjct: 1060 RKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPI--PTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP PPR P PH P P P PP PP P P P Sbjct: 995 PPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPP--SAQPLPPPRKPSPPPS 1052 Query: 918 ARPXP 932 A P P Sbjct: 1053 AVPIP 1057 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K + P PPR P P A P P P P + P P PPP P P P Sbjct: 1032 KASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/67 (34%), Positives = 24/67 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P P PP +A P P P PPPS PPP P P P Sbjct: 1019 PPGPTEQP--VPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPP--RKPSPPPSEPAPPPR 1074 Query: 918 ARPXPXT 938 P P T Sbjct: 1075 QPPPPST 1081 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P P PPP + PP P P P P P P Sbjct: 1033 ASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVP-PPRQP 1091 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXP 931 P P PPPR P P Sbjct: 1092 DPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +2 Query: 791 SXPPXGXPXPXXX---PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP P P PPP P P P P PPPR P P Sbjct: 1048 SPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNP 1098 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 2/71 (2%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXP 899 K P P R A P P P P + P PP PPP P P Sbjct: 1018 KPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP 1077 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 1078 PPSTSQPVPPP 1088 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P P P P P P PP P PP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/82 (39%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXG-GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G GR G G G G GGG GGG G G G G R GG G Sbjct: 7 GWGRGSGGGWGQGPGGGWGRGQ-GGGMGRGPGGG---WGRGS---GGGWGRMQGGGMGRG 59 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G + G GRG GG LG Sbjct: 60 PGGGWGRMQGGGMGRGPGGGLG 81 Score = 39.9 bits (89), Expect = 0.003 Identities = 31/84 (36%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = -2 Query: 931 GXGRAXXXXXG-GXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWGXGG-ARXXGGXRG 761 G GR G G G G GGG +GGG G G G GG R GG G Sbjct: 23 GWGRGQGGGMGRGPGGGWGRGS-GGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLG 81 Query: 760 GAXXGGGGXVFXXGXGRGGGGXLG 689 GG G + G GRG G G Sbjct: 82 RGPGGGWGRMQEGGMGRGPGQGWG 105 Score = 36.7 bits (81), Expect = 0.027 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGG--ARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GGG G G GG R GG G GG G + G GRG GG G Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWG 65 Score = 32.7 bits (71), Expect = 0.44 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G G G G GG G G G G R GG G GG G Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGG---GWGRMQ-GGGMGRGPGGGWGRMQGGGMGRGPG 77 Query: 724 XGXGRGGGGXLG 689 G GRG GG G Sbjct: 78 GGLGRGPGGGWG 89 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 40.7 bits (91), Expect = 0.002 Identities = 31/83 (37%), Positives = 32/83 (38%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXG-GXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWGXGGARXXGGXRGG 758 G GR G G G G GGG +GGG G G G G R GG G Sbjct: 267 GWGRGQGRGMGRGPGGGWGRGS-GGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGR 325 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GG G G GRG GG G Sbjct: 326 MQGGGMGRGPGGGLGRGPGGGWG 348 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/81 (34%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G +G GG G G G G R GG G Sbjct: 233 GRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGG-GWGRGQ---GRGMGRGPGGGWGRGS 288 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG G + G GRG GG G Sbjct: 289 GGGWGRMQGGGMGRGPGGGWG 309 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG-ARXXGGXRGGA 755 G GR G GGG +GG G G G GG R GG G Sbjct: 283 GWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRG 342 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G + G GRG G G Sbjct: 343 PGGGWGRMQGGGMGRGPGQGWG 364 Score = 37.1 bits (82), Expect = 0.020 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG-ARXXGGXRGGA 755 G G+ G G G GG G G G G GG R GG G Sbjct: 244 GMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 303 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G + G GRG GG G Sbjct: 304 PGGGWGRM-QGGMGRGPGGGWG 324 Score = 35.5 bits (78), Expect = 0.063 Identities = 27/72 (37%), Positives = 28/72 (38%), Gaps = 2/72 (2%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG-GAXXGGG-GXVFX 725 G G G GGG G G G G G GG G RG G GGG G Sbjct: 231 GIGRGSGSPMWGGGMGQGPRGWGRGSGGGWGQ-GPGGGWGRGQGRGMGRGPGGGWGRGSG 289 Query: 724 XGXGRGGGGXLG 689 G GR GG +G Sbjct: 290 GGWGRMQGGGMG 301 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG---GXFXGXGXPXGG 796 G G P G G G G GGG G GGG G G G GG Sbjct: 235 GSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGG 282 Score = 29.5 bits (63), Expect = 4.1 Identities = 28/80 (35%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWG--XGGARXXGGXRG 761 G GR G G G GGG GGG G G G WG GG G +G Sbjct: 307 GWGRMQGGMGRGPGGGWGRMQ-GGGMGRGPGGGLGRGPGGG---WGRMQGGGMGRGPGQG 362 Query: 760 GAXXGGGGXVFXXGXGRGGG 701 G G + G GR GG Sbjct: 363 WGCR-GMGCGWGCGNGRFGG 381 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX-PXPXXXPPPPLPXXXPPPXPXX 877 PPPPP P + G PP P PPPP PPP P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPP-----PPPPPGC 750 Query: 878 XXXXPPPPP 904 PPPPP Sbjct: 751 AGLPPPPPP 759 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/83 (30%), Positives = 27/83 (32%), Gaps = 5/83 (6%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPP-----PLPXXXPPP 865 PPPPP P + + P P P PPP P P P P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLP---MPPPPPPPPPGCAGLPPPPPSPQP 734 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 PPPPP G P PP Sbjct: 735 GCAGLPPPPPPPPPGCAGLPPPP 757 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP P P PPPP P P P PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP--PSPQPGCAGLPPPPPPPPPGCAG 752 Query: 918 ARPXP 932 P P Sbjct: 753 LPPPP 757 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP P P PPPP PPP P P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP--PPPIDVPMKP 766 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXAPP-------RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPX 896 PPPP PP PP PP P P +P P PPP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 897 PP 902 PP Sbjct: 754 PP 755 Score = 32.7 bits (71), Expect = 0.44 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 10/68 (14%) Frame = +3 Query: 729 KTXPPPPXXAP--------PRXPPXXRAPPYPHXXXPXPXXNPPPP--SXXXXPPPXXXX 878 K PPPP P PP PP P P PPPP PPP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQ 733 Query: 879 PXXXPXPP 902 P PP Sbjct: 734 PGCAGLPP 741 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPPP P PPP P PPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PPP P PPPPP+ P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPP------PPPPPQPSTPPPPPP 711 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPP-PPPRXXXGXPXPP 934 P P PPPP P PPP P PP PP G P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP 836 PPPP PP PP PP P P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPPXXXX 914 PPPP PP PP PP P P + P S P P P PP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLP 748 Query: 915 XARP 926 +P Sbjct: 749 GQQP 752 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 PP P P PPPP P PPP P P G P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 +T PPP PP PP PP P P + PP P Sbjct: 679 QTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 32.3 bits (70), Expect = 0.58 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P+ PPP P PPPPP PP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP P P P PPPP PPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 P PP P P P PPPP PPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG--GGXVF 728 G G G G GG G G G GG GG GG GG Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Query: 727 XXGXGRGGGGXLG 689 G GG G Sbjct: 632 GNTGGNNNGGNSG 644 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 789 PPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXPXT 938 P P P P PPPP PPP P P PP P P T Sbjct: 667 PSIPIQILPIPIQTMVPPPP-----PPPPPPPPPPPPPPPQPSTPPPPPPST 713 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G GG GG G GG GG GG+ GG G Sbjct: 506 GNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGG-NNNGGNNGGSNNGGNDGSNNNGGN 564 Query: 712 RGGGGXLG 689 GG G Sbjct: 565 TGGNNNGG 572 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/67 (25%), Positives = 19/67 (28%), Gaps = 4/67 (5%) Frame = +3 Query: 738 PPPPXXAPPRX----PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP PP+ PP PP P P + P P P Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLPGQQP 752 Query: 906 XXXXARP 926 RP Sbjct: 753 GQAGGRP 759 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P P PP P P P PP PPP P P PP Sbjct: 1236 PPPPAMPPDGPPKFMGLPP------PPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + PP G P PPPP PP P PPPP G P PP Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQP---PFMPPPPRMQPPGPPGPP 1284 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA----PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP PP PP P P PPPP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP G PPPP PP P PPPPP P PP Sbjct: 1225 PPMGHHMMNMPPPPPA---MPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA-PPYPHXXXPXPXXNPPPPSXXXXPP 863 PP P PP R PP P P P PP P PP Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPPP P P PP P P P P PP Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX-PXPXXXPPPPLPXXXPPPXPXXX 880 PPP N G PP G P P P P P PP P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 Query: 881 XXXPPPPP 904 P P P Sbjct: 1284 PGPPGPQP 1291 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/73 (34%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF-- 728 GG G GGG GGG G G G GG GG G GG + Sbjct: 142 GGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEG 201 Query: 727 XXGXGRGGGGXLG 689 G G GGG +G Sbjct: 202 MQGMGSMGGGMMG 214 Score = 37.1 bits (82), Expect = 0.020 Identities = 27/80 (33%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG---GXXXGXGXXXWGXGGARXXGGXRG 761 G G + GG G G GGG GGG G G G G G G +G Sbjct: 145 GGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQG 204 Query: 760 GAXXGGGGXVFXXGXGRGGG 701 GGG G G GGG Sbjct: 205 MGSMGGG----MMGGGMGGG 220 Score = 35.9 bits (79), Expect = 0.047 Identities = 25/70 (35%), Positives = 26/70 (37%), Gaps = 3/70 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGG-GXXXXEGGGGXXX-GXGXXXWGXGGARXXGGXRGGAXXGG-GGXV 731 GG G G GG G EG G G G G GG G G GG GG + Sbjct: 180 GGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGM 239 Query: 730 FXXGXGRGGG 701 G GGG Sbjct: 240 LQMGDSNGGG 249 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GG G G G GG GG G Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Query: 721 GXGRGGGGXL 692 G G GG + Sbjct: 189 GMEGGMGGGM 198 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRG------GAXXGGGGXVFXXGXGRGGG 701 EGG G G G GG GG G G GGG + G G GGG Sbjct: 128 EGGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGG 181 Score = 28.3 bits (60), Expect = 9.5 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G GG EGG G G G G GG GG G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG 234 Query: 712 RGGG 701 GGG Sbjct: 235 MGGG 238 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP P PPPPP G P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPP 678 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 605 PGXGGXXXXPXGGGETRCPPPEXXGGG 525 P GG P GGG PPP GGG Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPPGGG 673 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP PPP PPPP G P PP Sbjct: 654 PPPPGGGMFPPP-------PPPPPGGGVPGPPKPP 681 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G GR G G G G EG GGG G G G G G G Sbjct: 72 GMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGE 131 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 G GG G G GGGG G Sbjct: 132 GMGRGGMA---GEGMGGGGMAG 150 Score = 37.5 bits (83), Expect = 0.015 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG G G G G G G G GGGG G Sbjct: 94 GRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMA---G 150 Query: 718 XGRGGGGXLG 689 G GGGG G Sbjct: 151 EGMGGGGMAG 160 Score = 36.7 bits (81), Expect = 0.027 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG G G G G G G G G GGGG + G Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGG-MAGEG 92 Query: 718 XGRGG 704 GRGG Sbjct: 93 MGRGG 97 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G R GGGG G GG G GGGG G G GG G Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGG-MAGEGMGRGGMAGEG 82 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/65 (33%), Positives = 23/65 (35%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG G G G G G G G G GGGG + G Sbjct: 54 GRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGG-MAGEG 112 Query: 718 XGRGG 704 RGG Sbjct: 113 MSRGG 117 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGGG G GG G GGGG G G GG G Sbjct: 64 GGGGMAGEGMGRGGMAGEGMGGGG-MAGEGMGRGGIAGEG 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = -2 Query: 931 GXGRAXXXXXG-GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G GR G G G G GGG GGG G G G G GG GA Sbjct: 122 GMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGAIFGA 181 Score = 30.7 bits (66), Expect = 1.8 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXG-GARXXGGXRGGA 755 G G G G G G GG G G G G G G GG Sbjct: 8 GEGNNSNSTHGWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGG 67 Query: 754 XXGGG-GXVFXXGXGRGGGGXLG 689 G G G G G GGGG G Sbjct: 68 MAGEGMGRGGMAGEGMGGGGMAG 90 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG EG GG G RGG G G G G G GG G Sbjct: 2 GGGGMAGEGNNSNSTHGWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAG 60 Score = 29.1 bits (62), Expect = 5.4 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG--GXVFX 725 G G G GG GGG G G G GG G GG G G Sbjct: 44 GGGGMAGEGMGRGGMAGEGMGGGGMAGEGM---GRGGMAGEG--MGGGGMAGEGMGRGGI 98 Query: 724 XGXGRGGGGXLG 689 G G GGGG G Sbjct: 99 AGEGMGGGGMAG 110 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G G G GG GGG G G G G GG G GG Sbjct: 124 GRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXX---PPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPP PPP P PPPPP G P PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 806 GXPXPXXXPPPPLP-XXXPPPXPXXXXXXPPPPPRXXXG 919 G P P PPPPLP PPP P PPPPP G Sbjct: 674 GAPPP---PPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP PP P PPPP PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPP 702 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP--SXXXXPPP 866 PPP PP APP P P PPPP PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP PP PP P PP P PPP P PP Sbjct: 656 PEAGPPPPPPP---PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/56 (42%), Positives = 26/56 (46%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 E GGG G G + GG G RGG G GG + G GRGGGG G R Sbjct: 90 ERGGGGSQGGG---YRSGGGGYGGSSRGGYGGGRGGGGY--GGGRGGGGSYGGGRR 140 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G GGG GG G G G GG R GG GG GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGG--GYGGGRGGGGSYGGGRRDYGG 144 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G RGG GG GGG GRGGGG + G GG Sbjct: 104 GGGGYGGSSRGGYGGGRG-----GGGYGGGRGGGGSYGGGRRDYGG 144 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G R GGGG G G G GRGGGG G G + Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSGCD 358 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G G GGG GGG G G GG GG GG GGG Sbjct: 89 GERGGGGSQGGGYRSG-GGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 31.9 bits (69), Expect = 0.77 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 RGGG G G GGG GRGGG + G G GG G Sbjct: 311 RGGGRGGGYRSGG-GGGYGGGRGGGRGY-GGGRGGGGRRDYG 350 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA---XXGGG 740 GGG GGG G G G GG R GG RGG GGG Sbjct: 312 GGG----RGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 775 GGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG RGG GGG + G GRGGG G Sbjct: 312 GGGRGGGYRSGGGGGY--GGGRGGGRGYG 338 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG GG G GGG + G GRGGGG Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGY--GGGRGGGG 345 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRG-GAXXGGGGXVFXXGXGRGG 704 GGG G G G GG R GG RG G GGGG G R G Sbjct: 316 GGGYRSGGGG---GYGGGR--GGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -3 Query: 918 PXXXRGG----GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 P RGG GGG G GG G GGG G G GG Sbjct: 87 PRGERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG 131 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = -2 Query: 790 GARXXGGXRGGAXXGGGGXV-----FXXGXGRGGGGXLG 689 G R GG +GG GGG G GRGGGG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 127 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP PP+ PP P P P P PP PP P P PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXP 893 K PPP P P PP P PP P PPP P P Sbjct: 29 KPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +3 Query: 774 PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXPXT 938 P +A P P P P + PPP PP P PP P T Sbjct: 14 PVDQATPKPPQPTP-PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVT 67 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG GG G G G GG GG R GGGG + G GGGG Sbjct: 92 GGGGRRERGGRGGGGGYG------GGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG R GG GG GGGG G GGGG G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG RGGGGG GGG G GGGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGG 127 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RGGGG G GGG GGGG + G G GG Sbjct: 91 RGGGGRRERGGRGGGGGY----GGGGGYGGGGRSYGG 123 Score = 31.9 bits (69), Expect = 0.77 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX--GRGGGGXFXGXGXPXGG 796 GG G GGGG G GGG G GGGG F GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGG 139 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG 788 G GR GG G G GGG GGGG G +G GG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSY-GGGGGGGGFYQDSYGGGG 139 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G GGG GGGG G G G GG GG + GGGG Sbjct: 92 GGGGRRERGGRGGGGGY---GGGGGYGGGGRSYGGGGGG---GGFYQDSYGGGGG 140 Score = 28.7 bits (61), Expect = 7.2 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFFXXGXGGGGG 700 G G GRGGGG + G G GG G GF+ GGGGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYG---------GGGGGGGFYQDSYGGGGG 140 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/82 (26%), Positives = 25/82 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P + P P P PPP+P PP Sbjct: 913 PLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP--PPPTSALPPPIPATQVPPP 970 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP + PP Sbjct: 971 PLPPLPPPPPPVQTTTAPTLPP 992 Score = 33.5 bits (73), Expect = 0.25 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP-XXXXPXXXPXPPXX 908 T P APP P + P P P P PPP PPP P P Sbjct: 885 TKNPKTTTAPPTTPTTPK-PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQ 943 Query: 909 XXXARPXP 932 RP P Sbjct: 944 ASTTRPTP 951 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPPLP PP P PPPPP P P Sbjct: 908 PPPPLPLAPEPPPP-----LPPPPPPIQTTRPTVP 937 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 K T PP P+ PP P P P PPPP P P Sbjct: 889 KTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP P PP PP P P P + P P PP Sbjct: 908 PPPPLPLAPEPPPPL-PPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQ 966 Query: 918 ARPXP 932 P P Sbjct: 967 VPPPP 971 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP AP PP PP P P + P P P P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVP 968 Query: 918 ARPXP 932 P P Sbjct: 969 PPPLP 973 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 +GGGG G G G GG GG GG GGGG Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGGGG G GGG G GGGG G G G + G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GGGGG G GGG G GGGG G G G E Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDE 170 Score = 36.7 bits (81), Expect = 0.027 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG GGGG G G GGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGGG G GGG G GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GGGGG G GGG G GGGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGG G GGG G GGGG G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 + GGG G G G GG GG GG GGGG Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G G GG GG GG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGGG G GGG G GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 GGG GGGG G G G GG GG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 GGG GGGG G G G GG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG 788 G G GGG GGGG G G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGG 770 G G G GGG GGGG G G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PP G P PPP +P PP PPPPP Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP PP +P P PPP PP P PP Sbjct: 242 PPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPP--XPXXXXXXPP--PPPRXXXGXP 925 G PP P P PP +P PP P PP PPP G P Sbjct: 239 GAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMP 289 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP--PPPRXXXGXPXPP 934 P PP G P PP +P P P PP PP P PP Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP P P P P P PP PPP Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 28.3 bits (60), Expect = 9.5 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 7/70 (10%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-------PSXXXXPPPXXXXPXXXPXPP 902 PP APP PP PP P P PPP P PPP P P Sbjct: 236 PPMGAPP--PPHSMPPP----GMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMP 289 Query: 903 XXXXXARPXP 932 P P Sbjct: 290 PNMEQPPPPP 299 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPP P PPP P PPPPP G P PP Sbjct: 188 PSPMAGMPPPPP---PPPPPGFPGGAPPPPP-PPFGAPPPP 224 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPP-LPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 P G P P PPPP P PPP P PPPP G P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPP--PPFGAPPPPALNGGPP 231 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP PP P APP P P P PPPP+ PP Sbjct: 196 PPPPPPPPPGFPGG--APPPP----PPPFGAPPPPALNGGPP 231 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 792 PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P P P PPPP PP P P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP 892 P PP P PPPP P PP P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP APP PP PP H P PPPS P P Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPPMGAPPMG-PPPSGSHSPAP 2224 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPP 866 PPP APP PP APP P P +PP + PPP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P P APP PP APP P PPP P P P P Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XPPXXX 911 PPP P R P +P P P PP PP P P PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGA 2209 Query: 912 XXARPXP 932 P P Sbjct: 2210 PPMGPPP 2216 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXP--PPXXXXPXXXPXP 899 PPP + PP P P P PP PP P PP P P P Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/77 (25%), Positives = 21/77 (27%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPP P + P PP G P P P P PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVP--PPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPM 2207 Query: 881 XXXPPPPPRXXXGXPXP 931 P PP P P Sbjct: 2208 GAPPMGPPPSGSHSPAP 2224 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GG R GG RGG GGGG G GRGGG Sbjct: 47 GRGGPR--GGGRGGGRGGGGGFKSPRGGGRGGG 77 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -3 Query: 933 GGXGXPXXX-RGGG-GGXXXXXXGXGGGXXXGRGGG-GXFXGXG 811 GG G P RGGG GG GGG GRGGG G F G Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARG 89 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 924 GXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G P G G GGG GRGGGG F P GG G Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKS---PRGGGRGGG 77 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 GG GGG G G G G GG RGG GG G G Sbjct: 45 GGGRGGPRGGGRGGGRGG---GGGFKSPRGGGRGGGRGGGRGVFIARG 89 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP PPP P PPPP G P PP Sbjct: 555 GWGQPPPGAGQGGGPPPPGAGQGGPPP-PGAGQEGPPPPGAGQGGGPPPP 603 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G PP G PPP PP P PPPP G P P Sbjct: 544 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPP 592 Score = 35.1 bits (77), Expect = 0.083 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP P P PPPP G P PP Sbjct: 533 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPP 582 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP PP P PPPP G PP Sbjct: 511 GGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPP 560 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPPP PP P PPPP G PP Sbjct: 566 GGGPPPPGAGQ--GGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPP 613 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPL-PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP PPP PPP G P PP Sbjct: 489 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 539 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP P P PPPP G PP Sbjct: 500 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPP 549 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPL-PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP G PPP PPP PPP G P PP Sbjct: 522 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 572 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXGXPXGGXEXPG 781 G G P G GGG G G G G G GG G GG PG Sbjct: 533 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPG 583 Score = 30.3 bits (65), Expect = 2.4 Identities = 23/71 (32%), Positives = 26/71 (36%), Gaps = 5/71 (7%) Frame = -1 Query: 608 PPGXG-GXXXXPXGGGETRCPPPEXXGGGXF---XXGGXGGAPKKKXXXPXXXGXFFXQK 441 PPG G G P G G+ PPP G G G GG P + Sbjct: 527 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQ 586 Query: 440 NXPXPPG-GRG 411 P PPG G+G Sbjct: 587 EGPPPPGAGQG 597 Score = 29.9 bits (64), Expect = 3.1 Identities = 24/68 (35%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = -1 Query: 608 PPGXG-GXXXXPXGGGETRCPPPEXXGGGXFXXGGXGGAPKKKXXXPXXXGXFFXQKNXP 432 PPG G G P G G+ PPP G G G G ++ P G Q P Sbjct: 549 PPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAG----QEGPPPPGAG----QGGGP 600 Query: 431 XPPG-GRG 411 PPG G+G Sbjct: 601 PPPGAGQG 608 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G P G GGG G GG G G G GG PG Sbjct: 555 GWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPG 604 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGG---XXXGRGGGGXFXGXGXPXGGXEXPG 781 G G P G GGG G GGG G+G G G G GG PG Sbjct: 489 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG-QGGGPPPPG 540 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGG---XXXGRGGGGXFXGXGXPXGGXEXPG 781 G G P G GGG G GGG G+G G G G GG PG Sbjct: 522 GWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG-QGGGPPPPG 573 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/68 (35%), Positives = 25/68 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G G GG G GG GGGG V+ Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGF--GGGGGVWGN 237 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 238 GGGGGGGG 245 Score = 31.9 bits (69), Expect = 0.77 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GG G G G G WG GG GG GG GG G Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGV-WGNGGG--GGGG-GGYSGGGSGNPHYY 258 Query: 721 GXGRGGG 701 G GGG Sbjct: 259 ACGGGGG 265 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXX---GXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 GG G GG GG G GGG GGG G G GG P Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNP 255 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 726 KKTXPPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PP P P P PP +PP P P P P PP P P PP Sbjct: 175 KPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Score = 35.1 bits (77), Expect = 0.083 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR---APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP P PP APP P+ P + PP PP P P PP Sbjct: 298 PAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 32.7 bits (71), Expect = 0.44 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXX-----PXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P PP APP P P P PP + PP P P PP Sbjct: 221 PPAPLHPHIPP---APPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Query: 909 XXXARPXP 932 A P P Sbjct: 278 SIPAPPNP 285 Score = 32.3 bits (70), Expect = 0.58 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 6/85 (7%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP PP P P PP P P P PP P PP P Sbjct: 230 PPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPAS-PNPSIPPAPPNPSIPAPPNPSIP 288 Query: 881 XX------XPPPPPRXXXGXPXPPH 937 P PP P PH Sbjct: 289 LAPPNPYIPPAPPNLFIPSAPPNPH 313 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 741 PPPXXAPPRXPP--XXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXPXXXPXPP 902 PP PP P APP PH P NP P+ P PP P P PP Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPH--IPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPP 346 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXP-PPXXXXPXXXPXP 899 PP P P P APP P+ P P PP+ P PP P P P Sbjct: 274 PPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNP 330 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPH--XXXPXPXXNPPPPSXXXXP-PPXXXXPXXXP 893 PP P P P P APP P P P P PP+ P PP P P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/81 (23%), Positives = 21/81 (25%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +P PP P + P P P PP P PP Sbjct: 214 PPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPA 273 Query: 869 PXXXXXXPPPPPRXXXGXPXP 931 P PP P P P Sbjct: 274 PPNPSIPAPPNPSIPLAPPNP 294 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P PP P PP P P P P P PP+ PP P P P Sbjct: 243 PNPPMPETP-LPPATPNPFIP-PASPNPSIPPAPPNPSIPAPPNPSIPLAPPNP 294 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP P PP P P PP PS PP P P PP Sbjct: 251 PLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPP----NPYIPPAPPNLFIP 306 Query: 918 ARP 926 + P Sbjct: 307 SAP 309 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ PP PP P P P P P PP P PP Sbjct: 172 PETKPPKPPAPST------IPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHI--PPA 223 Query: 869 PXXXXXXPPPP-PRXXXGXPXPP 934 P P PP P P PP Sbjct: 224 PLHPHIPPAPPNPSKAIATPNPP 246 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +3 Query: 738 PP--PPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P PP P P APP P P PP P P P PP Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNP 321 Query: 909 XXXARP 926 P Sbjct: 322 YIPTAP 327 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P P P PP P P PP P P PP P PH Sbjct: 176 PPKPPAPSTIPTPPTP---PAPPSPPIPTAPPTPPMPETPLPPGSPH 219 Score = 28.3 bits (60), Expect = 9.5 Identities = 20/77 (25%), Positives = 20/77 (25%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP P P N P P P P P PP P P P Sbjct: 274 PPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPS-APPNPHIPPAPPNPYIPTAP-PNPS 331 Query: 881 XXXPPPPPRXXXGXPXP 931 PP P P P Sbjct: 332 IPPAPPNPSIPPAPPNP 348 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP P PPP P PPPPP Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP P PPPPP G P PP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPP 220 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLP--XXXPPPXP 871 P S PP P P PPPP P PPP P Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/70 (27%), Positives = 23/70 (32%), Gaps = 3/70 (4%) Frame = +3 Query: 726 KKTXPPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPX 896 K PPP PP + P + P+P+ P P P P PPP P Sbjct: 658 KNRYPPPYKQVPPPYKQVPHPYKQVPHPYKQVPAPYKQVPLP-YKQVPPPYKQVPHPYKQ 716 Query: 897 PPXXXXXARP 926 P P Sbjct: 717 VPATYKQVSP 726 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 729 KTXPPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 K P P PP + PP + P+P+ P P P P PP Sbjct: 736 KQVPHPYKQVPPPYKQVPPPYKQVPHPYKQVPAPYKQVPAPYKQVPPP 783 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP + PP P+ P P PPP PPP P Sbjct: 726 PPFKQVPP-PYKQVPHPYKQVPPP-YKQVPPPYKQVP 760 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + P P PPPP PP P PPPPP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPX----XXPPPXPXXXXXXPPPPP 904 P PP P P PPPLP PPP P PPPPP Sbjct: 550 PSEEPPP---PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPP 866 P PP PP PP P P P PP P PPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 32.3 bits (70), Expect = 0.58 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPP PP PP P P P PPPP Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P AP P PP P P P PP PPP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPL--PPSEDPKPPPPPPEPPEECPPPPP 591 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/67 (37%), Positives = 26/67 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G G G G G GG GG G GGGG + Sbjct: 205 GGLGGLGGLGVIGTGVIGA-GAVGGLGGLGGLG-GVGGLGGVGGLGGIGGLGGGGVIAGA 262 Query: 721 GXGRGGG 701 G G GGG Sbjct: 263 GAGIGGG 269 Score = 33.5 bits (73), Expect = 0.25 Identities = 30/76 (39%), Positives = 31/76 (40%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG--GGGXXXGXGXXXWGXGGARXXGGXRG-GAXXG-GGGX 734 GG G G GG G G G G G G GG GG G G G GGG Sbjct: 199 GGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLG-GLGGVGGLGGVGGLGGIGGLGGGG 257 Query: 733 VFXXGXGRG-GGGXLG 689 V G G G GGG +G Sbjct: 258 VI-AGAGAGIGGGVIG 272 Score = 29.5 bits (63), Expect = 4.1 Identities = 26/73 (35%), Positives = 27/73 (36%), Gaps = 3/73 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXX-GGGGXVFX 725 GG G G G G GG G G G G GG GG GG G G + Sbjct: 211 GGLGVI-GTGVIGAGAVGGLGGLGGLGGVGGLG-GVGGLGGIGGLGGGGVIAGAGAGIGG 268 Query: 724 XGXGRGG--GGXL 692 G GG GG L Sbjct: 269 GVIGTGGIPGGIL 281 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 37.5 bits (83), Expect = 0.015 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 E GGG G G G G G GG GGG G GRGGGG G R Sbjct: 181 ERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGG-----YGGGRGGGGGYGGGRR 231 Score = 37.1 bits (82), Expect = 0.020 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G GGG GG G G +G GG GG GG GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYG-GGRGGGGGYGGGRRDYGGG 236 Score = 37.1 bits (82), Expect = 0.020 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXG-GARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 G GGG GGG G +G G G GG RGG GGG G +GG Sbjct: 184 GGGSQGGGY---RSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Query: 703 G 701 G Sbjct: 241 G 241 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G RGG GG GGG GRGGGG + G GG G Sbjct: 195 GGGGYGGSSRGGYGGGRG-----GGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 33.9 bits (74), Expect = 0.19 Identities = 25/61 (40%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXG---XGXXXWGXGGARXXGGXRGGAXXGG--GGXVFXXGXGRGGG 701 GGG +GGG G G G GG R GG GG GG GG G G GG Sbjct: 183 GGGGS--QGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Query: 700 G 698 G Sbjct: 241 G 241 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR--GGAXXGGG 740 G G G GG GGG G G G GG GG R GG GGG Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGG--YGGGRRDYGGGSKGGG 241 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 P G GGG G GGG GRGGGG F G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 RGGGGG G GGG G GGG G G P Sbjct: 341 RGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPP 374 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 GG+ GG GG GGGG G GRGGGG R Sbjct: 337 GGSGRGGGGGGGGGGGGGGG----GGGRGGGGGFSSRGR 371 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 766 RGGAXXGGGGXVFXXGXGRGGGGXLG 689 RGG+ GGGG G G GGGG G Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRG 361 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 897 GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 GG G GGG G GGGG G G G P Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPP 374 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 820 GXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G G G GG GG GG GGGG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G GG GG GG GGGG G G Sbjct: 344 GGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P + P P G P P P PP Sbjct: 34 PYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGL 93 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PP G P PP Sbjct: 94 PGPNGVNGPPGELGDMGPPGPP 115 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP PL PP P PP P G P P Sbjct: 339 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGP 390 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP PL PP P PP P G P P Sbjct: 424 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGP 475 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP PL PP P PP P G P P Sbjct: 509 PAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGP 560 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXP-PPXXXXPXXXP 893 +T PPPP P PP P P N P PP P PP P P Sbjct: 27 ETPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPP---PPPRXXXGXPXPP 934 PPPP P PPP P P P P+ G PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP P P P P+ G P PP Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P S P G P P PP + PP P PP P G P P Sbjct: 764 PAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGP 815 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P S P G P P PP + PP P PP P G P P Sbjct: 849 PAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGP 900 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 741 PPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP P P + PP P P PP + PP P P P Sbjct: 275 PPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 330 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P + P G P P PP L PP P PP P G P P Sbjct: 84 PAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGP 135 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P PP P P P G P PP Sbjct: 33 PPYEAPPPPPGPPGP---DGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP P PP P PP P G P P Sbjct: 254 PAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGP 305 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP P PP P PP P G P P Sbjct: 169 PAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGP 220 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXX--APPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P PP P P + PP P P N PP PP P P P Sbjct: 442 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 500 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXX--APPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P PP P P + PP P P N PP PP P P P Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 585 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 782 PGXSXPPX--GXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPPPPRXXXGXP 925 PG + PP G P P PP P PP P PP P G P Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 782 PGXSXPPX--GXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPPPPRXXXGXP 925 PG + PP G P P PP P PP P PP P G P Sbjct: 777 PGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 782 PGXSXPPX--GXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPPPPRXXXGXP 925 PG + PP G P P PP P PP P PP P G P Sbjct: 862 PGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPP 913 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +2 Query: 782 PGXSXPPX--GXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPPPPRXXXGXP 925 PG + PP G P P PP P PP P PP P G P Sbjct: 607 PGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P G P P PP + PP P PP P G P P Sbjct: 679 PAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGP 730 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 37.1 bits (82), Expect = 0.020 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 KK PP PP P R PP P PPPP P P P PP Sbjct: 771 KKALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP--PPGKPTKPTKPSLPPVPP 827 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P P P PP P P PP G P P Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P P P +P P P PPPPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 37.1 bits (82), Expect = 0.020 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PP P PP PP PP P P PP P P P PP Sbjct: 447 TLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPLP PPP P PPPP P PP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 4/81 (4%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGX--SXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 PP P P N P PP P PPPP P P P P Sbjct: 423 PPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPE 482 Query: 878 XXXXP--PPPPRXXXGXPXPP 934 P PP P PP Sbjct: 483 LPGSPGDSPPATSPKQPPLPP 503 Score = 29.9 bits (64), Expect(2) = 0.77 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 PP P PP LP P PP PP+ G P Sbjct: 468 PPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX--PXXNPPPPSXXXXPP 863 PPPP A P P P P P P P PP PP Sbjct: 467 PPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 20.6 bits (41), Expect(2) = 0.77 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 701 PPPPPXP 721 PPPPP P Sbjct: 466 PPPPPAP 472 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/72 (30%), Positives = 24/72 (33%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G G +GG G G G GG + GG GGG G Sbjct: 216 GGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGA 275 Query: 712 RGGGGXLGXXXR 677 GGGG G R Sbjct: 276 GGGGGYSGGGLR 287 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V G G G G GG GG G G GG G GG Sbjct: 214 VSGGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGG 273 Query: 757 AXXGGGG 737 GGGG Sbjct: 274 GAGGGGG 280 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXX-RAPPYPHXXXPXPXXNPPPPSXXXXPPP--XXXXPXXXPXPP 902 PP +PPR PP R P P P P PP PS PP P P PP Sbjct: 296 PPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPP 353 Score = 35.9 bits (79), Expect = 0.047 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 6/73 (8%) Frame = +3 Query: 732 TXPPPPXXAPPRXPP-XXRAPPYPHXXXPXPXXNPP-----PPSXXXXPPPXXXXPXXXP 893 T PP +PPR PP R PP H P PP PP PP P P Sbjct: 287 TLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHP 346 Query: 894 XPPXXXXXARPXP 932 P P P Sbjct: 347 RYPPSPPRYPPSP 359 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPLP PP P P PP P PP Sbjct: 328 PPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPP 360 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPP---XPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP +P PP P PP PPR P P Sbjct: 261 PPRYPPSPLRYPP--IPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYP 307 Score = 29.1 bits (62), Expect = 5.4 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 10/65 (15%) Frame = +3 Query: 738 PPPPXX---APPRXPPXX-RAPPYPHXXXPXPXXNPP-----PPSXXXXP-PPXXXXPXX 887 PP P PPR PP R P P P P PP PPS P P P Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSP 324 Query: 888 XPXPP 902 PP Sbjct: 325 IRYPP 329 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P+ P R PP P P P PP PP P P P P Sbjct: 307 PPSLHRYPQSP--LRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPS 364 Query: 918 ARP 926 + P Sbjct: 365 SHP 367 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 756 APPRXPP-XXRAPPYPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXP 893 +PPR PP R PP P P P PP PP P P Sbjct: 260 SPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYP 307 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 812 PXPXXXPP-PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PP PP P P PP PPR P P Sbjct: 329 PLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYP 370 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PG PP P PP P PPP P PPP P Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/83 (25%), Positives = 21/83 (25%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLP-XXXPPP 865 PQ P P P P K PPP P PPP Sbjct: 132 PQPVPQPVPQPASKGKSVLDKILQLQMTLKLMALLGQKNSVSPGILAPPPAPPGVLAPPP 191 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 P PP PP P P Sbjct: 192 APPGVLPPPPAPPGALIPPPPAP 214 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 9/51 (17%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---------YPHXXXPXPXXNPPPPSXXXXPP 863 PPPP PP PP PP H P P PPPP PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P PP APP P P P PPPP P PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPP 139 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPP P PPP P PPPPP Sbjct: 97 PACCAPPPPPPPPPPPPP-----PPPPPP 120 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPPP P PPP PPPPP Sbjct: 96 PPACCAPPPPPPPPPPPP-------PPPPPP 119 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 P AP P PP P P P PPPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 36.3 bits (80), Expect = 0.036 Identities = 24/81 (29%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = +2 Query: 698 TPPPPPXPXXKN---XXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 TPPPPP P N G + P P P L PPP Sbjct: 372 TPPPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRP--FPTPNRRRRRSLVQPPPPPP 429 Query: 869 PXXXXXXPPPPPRXXXGXPXP 931 P PPPPP+ P P Sbjct: 430 PAPLPPPPPPPPQPTTALPDP 450 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 669 GRXRXXFPXXXXXXXXXXXKKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP 833 GR FP + PPPP PP PP PP P P P P Sbjct: 404 GRTIRPFPTPNRRRRRSLVQPPPPPPPAPLPPPPPP----PPQPTTALPDPLQGP 454 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/77 (25%), Positives = 21/77 (27%) Frame = +2 Query: 707 PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXX 886 PPP + P PP G P P PP PPP Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 471 Query: 887 XPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 472 PPPGAPHPRVPPPGAPH 488 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P P PP PPP Sbjct: 507 PHPRVPPPGAPHPR-VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPG 565 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 566 APHPRVPPPGAPHPRVPPPGTPH 588 Score = 35.9 bits (79), Expect = 0.047 Identities = 23/86 (26%), Positives = 24/86 (27%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P+ PP P P P PP G P P PP P Sbjct: 396 ASHPRVPPPGAPHP---RVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVP 452 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP PP P P PH Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPH 478 Score = 35.9 bits (79), Expect = 0.047 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P P PP PPP Sbjct: 427 PHPRVPPPGAPHPR-FPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 485 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 486 APHPRVPPPGAPHQRVPPPGAPH 508 Score = 35.9 bits (79), Expect = 0.047 Identities = 23/86 (26%), Positives = 24/86 (27%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P+ PP P P P PP G P P PP P Sbjct: 436 APHPRFPPPGAPHP---RVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP PP P P PH Sbjct: 493 PPGAPHQRVPPPGAPHPRVPPPGAPH 518 Score = 35.9 bits (79), Expect = 0.047 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P P PP PPP Sbjct: 447 PHPRVPPPGAPHPR-VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPG 505 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 506 APHPRVPPPGAPHPRVPPPGAPH 528 Score = 35.9 bits (79), Expect = 0.047 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P P PP PPP Sbjct: 467 PHPRVPPPGAPHPR-VPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPG 525 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 526 APHPRVPPPGAPHPRVPPPGAPH 548 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PR PP + P P P P PP PPP P P Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PR PP P P P P PP PPP P P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PR PP P P P P PP PPP P P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +3 Query: 741 PPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PR P P P P P P PP S PP P P Sbjct: 382 PPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPP 433 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/83 (25%), Positives = 22/83 (26%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P PP PPP Sbjct: 517 PHPRVPPPGAPHPR-VPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPG 575 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PH Sbjct: 576 APHPRVPPPGTPHPRVPPPGAPH 598 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP G P P PP PPP PP P P P+ Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPY 608 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 9/73 (12%) Frame = +3 Query: 741 PPPXXAPPRXPP----XXRAPP--YPHXXXPXP-XXNP--PPPSXXXXPPPXXXXPXXXP 893 PPP PR PP R PP PH P P +P PPP P P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 541 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 542 PPPGAPHPRVPPP 554 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPP 866 PPP PR PP P P P P PP PPP Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPL--PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP G P PPPP+ P PP PP P PP Sbjct: 312 PPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPP 364 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P PP G P P PPP P PP Sbjct: 537 PHPRVPPPGAPHPR-VPPPGASHPRVPPPGAPHPRVPPPGAPHP-RVPPPGTPHPRVPPP 594 Query: 869 PXXXXXXPPP 898 PPP Sbjct: 595 GAPHPKVPPP 604 Score = 29.5 bits (63), Expect = 4.1 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 9/73 (12%) Frame = +3 Query: 741 PPPXXAPPRXPP----XXRAPP----YPHXXXP-XPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PR PP R PP +P P P PPP P P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV 591 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 592 PPPGAPHPKVPPP 604 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY---PHXXXPXPXXNPPPPSXXXXPPP 866 PPP P+ PP PY P+ P PP P PPP Sbjct: 592 PPPGAPHPKVPPP--GAPYQRLPYSGAYHPRLPPPGPPYQRVPPP 634 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PR PP P P P P PP P P P P Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGP 626 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXN-----PPPPSXXXXPPPXXXXPXXXP 893 P P + PR PP P PH P P + PP PPP P P Sbjct: 392 PSPGASHPRVPP----PGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPP 443 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P G P PP PPP PP P P PH Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPH 438 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP P P P P PPPP PPP P Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPF-GPPPPFYRGPPPPRGMPP 505 Score = 35.5 bits (78), Expect = 0.063 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP+ PP PP P P PP PPP P PP Sbjct: 446 PQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPP 498 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSX--XXXPPPXXXXPXXXPXPP 902 PPPP P P P P PPPP PPP P PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPP 484 Score = 32.3 bits (70), Expect = 0.58 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 7/69 (10%) Frame = +3 Query: 747 PXXAPPRXPPXXRA----PPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXPPX 905 P PP PP PP P P P PPPP PPP P P PP Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPP--FGPPPPFYRGPPPPRGMPPPPR 508 Query: 906 XXXXARPXP 932 ++ P Sbjct: 509 QRMPSQGPP 517 Score = 32.3 bits (70), Expect = 0.58 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PQ P PP P P PP G P P PPP PPP Sbjct: 452 PQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFP---PPPFGPPPPFYRGPPPPRGMPPPPR 508 Query: 869 PXXXXXXPP 895 PP Sbjct: 509 QRMPSQGPP 517 Score = 30.3 bits (65), Expect = 2.4 Identities = 25/82 (30%), Positives = 26/82 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PQ T PP P P P PP G PPPP+ PPP Sbjct: 431 PQHTGPPQPRPPH------GMPQGGGPPQLPPNLPPPPGGM---RGMPPPPM-GMYPPPR 480 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PPPP P PP Sbjct: 481 GFPPPPFGPPPP--FYRGPPPP 500 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP PP PP P P PP PPP P P R P Sbjct: 428 PP--PPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFP 483 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP P PP P P P P PP PPP P PP Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPP--NTPIPGDPPPNTPIP 90 Query: 918 ARPXPXT 938 P P T Sbjct: 91 GNPPPNT 97 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP P PP P P P P PP PPP P PP Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP--NTPIPGDPPPNTPIP 110 Query: 918 ARPXPXT 938 P P T Sbjct: 111 GDPPPNT 117 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP P PP P P P PP PPP P PP Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGN--PPPNTPIP 70 Query: 918 ARPXPXT 938 P P T Sbjct: 71 GDPPPNT 77 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P PP P P PPP P PP P PPP G P P Sbjct: 48 PIPGDPPPNIPIP-GNPPPNTPIPGDPP-PNTPIPGDPPPNTPIPGNPPP 95 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPP-PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P PP P P PP P+P PP P PPP G P P Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP---IPGDPPPNTPIPGDPPP 115 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PP P PP P P P P PPP+ P P PP Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIP--GDPPPNTPIPGDPPPNTPIPGNPPPNTPIPG 101 Query: 921 RPXPXT 938 P P T Sbjct: 102 DPPPNT 107 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPP P N P PP P P PPP P PP P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNT-PIPGDPPPNTPIP-GNPPPNTPIPGDPP-PNTPI 109 Query: 884 XXPPPPPRXXXGXP 925 PPP G P Sbjct: 110 PGDPPPNTPIQGDP 123 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP PP P R PP P P PPPP PP P P Sbjct: 217 PPPGMLPPPGGMPPGRMPPQG-LPFPPPGPIPPPPGAGGMRPPHGQMHMGGPRP 269 Score = 35.1 bits (77), Expect = 0.083 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PG PP G P P PP LP PPP P PPPP G PPH Sbjct: 219 PGMLPPPGGMP-PGRMPPQGLP--FPPPGP-----IPPPP---GAGGMRPPH 259 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 35.9 bits (79), Expect = 0.047 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFX 725 GG G G GGG GGGG G + GG G G GGG G + Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYG 256 Query: 724 XGXGRGGGG 698 G G G Sbjct: 257 SYDGYGSMG 265 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG RGG GGGG G + GG G Sbjct: 201 GYGGRGRGGGGRGG-YGGGGGYGGYGGYDQYSGGGYG 236 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 G PP G PPPPLP P P PPPPP G P Sbjct: 289 GMLPPPFGGHPAAAPPPPPLPAGVPAP--------PPPPPPPMLGGP 327 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 812 PXPXXXPPPPLPXXX-PPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPPL PPP PPPPP G P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPP-LPAGVPAPP 316 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP P P P P PP PPP P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPP--PPPPPPMLGGP 327 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 795 YPHXXXPXPXXNPPPP-SXXXXPPPXXXXPXXXPXPP 902 Y + P PPPP + PPP P P PP Sbjct: 270 YTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPP 306 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 35.9 bits (79), Expect = 0.047 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG GG G G GG+ G GG GGG G GGGG Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGGG GGG GG G G GG Sbjct: 227 GGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 35.9 bits (79), Expect = 0.047 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP PPP P PPPPP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 35.5 bits (78), Expect = 0.063 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 TPPPPP P G PP P P PPP PPP P Sbjct: 279 TPPPPPPPPSNTPGMFASS----------GFQPPP---PPPTDFAPPP-----PPPEPTS 320 Query: 878 XXXXPPPPP 904 PPPPP Sbjct: 321 ELPPPPPPP 329 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPP-PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P PPP P PPPPP P PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP P PP P P PP P+ PPP Sbjct: 284 PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P PPPP P PP PPP P P PP Sbjct: 285 PPPSNTPGMFASSGFQPPPPPPTDFAPPP-------PPPEPTSELPPPPPP 328 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G + PP P P P P PPP PPPP P P Sbjct: 304 GEAPPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +2 Query: 782 PGXSXPPXGXPX---PXXXPP-PPLPXXXP--PPXPXXXXXXPPPPPRXXXGXPXPP 934 PG PP P P PP PP+ P PP PPPPP P PP Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPP 439 Score = 33.5 bits (73), Expect = 0.25 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPP-PP---LPXXX 856 P PP P N PG PP G P P PP P Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGP--PPPGPPMLNMAPSIPPWQTTPGYI 424 Query: 857 PPPXPXXXXXXPPPPP 904 PPP P PPPPP Sbjct: 425 PPPPPGFPQFQPPPPP 440 Score = 31.9 bits (69), Expect = 0.77 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = +3 Query: 738 PPPPXXAPPRX----PPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPP 866 PPPP + P PP +APP P P PPP PS PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTI---PSTLPPPPVPSATSAPPP 352 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PG P G P P P LP PP P PP + G PP Sbjct: 377 PGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPP 427 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P PP P PPPP+P P P P P Sbjct: 323 PPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P PP P AP P PPPP PP P P Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 29.1 bits (62), Expect = 5.4 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXPXXXPXPPXXXX 914 PP P PP + P P P P PP P PP P P PP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPP---PGPPMLNMAPSIPPWQTTPGYIPPPPPGFP 432 Query: 915 XARPXP 932 +P P Sbjct: 433 QFQPPP 438 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/56 (30%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPS--XXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP + P P P PPPP PPP P PP + P P Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAP-PPWATSNSGPKP 362 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.5 bits (78), Expect = 0.063 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PP PP+ P APP P PP P PP PP Sbjct: 745 TKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPN 804 Query: 912 XXARPXP 932 A P P Sbjct: 805 ISAEPPP 811 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPP-PPLPXXXP-PPXPXXXXXXP--PPPPRXXXGXPXPP 934 P PP P P P PP+P P PP P P PP P P PP Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/62 (29%), Positives = 20/62 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P P PP PP P P P P + PP P PP Sbjct: 761 PPAPPQFAPVPPPCAPIPPMP-CSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARKP 819 Query: 918 AR 923 +R Sbjct: 820 SR 821 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPP 902 P P + PP PP P P P P PP PP P P P PP Sbjct: 738 PSPSEVTTKSPPA---PPLPPKVTPKP---PAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 29.5 bits (63), Expect = 4.1 Identities = 22/68 (32%), Positives = 24/68 (35%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K P PP APP+ P PP P P P PP+ P P P P P Sbjct: 756 KVTPKPP--APPQFAP---VPPPCAPIPPMPCSAPLPPA----PAPFSAAPHLPPAPNIS 806 Query: 909 XXXARPXP 932 P P Sbjct: 807 AEPPPPPP 814 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 35.5 bits (78), Expect = 0.063 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG + GGG G GG GG GG GGG G Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGG----DYG 401 Query: 718 XGRGGGGXL 692 G G G L Sbjct: 402 DGDHGDGDL 410 Score = 35.1 bits (77), Expect = 0.083 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG + GGG G GG GG G GGG G Sbjct: 331 GDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG----DHG 386 Query: 718 XGRGGGGXLG 689 G GGG G Sbjct: 387 GGDHGGGDHG 396 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GG + GGG G GG GG GG G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDG----DH 380 Query: 721 GXGRGGGGXLG 689 G G GGG G Sbjct: 381 GGGDHGGGDHG 391 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 35.1 bits (77), Expect = 0.083 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + GG G G G G GG G G GG+ GG GGA Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGS--SGGASGGAG 828 Query: 751 XGGGG 737 GG Sbjct: 829 SSSGG 833 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G G G GG G G GG+ GG GGA GG G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGS--SGGASGGAGGSSGGA--SGG 826 Query: 718 XGRGGGGXLG 689 G GG G Sbjct: 827 AGSSSGGASG 836 Score = 32.3 bits (70), Expect = 0.58 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -2 Query: 901 GGXGXXX-GXXXXGGGXXXXEGG--GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GG GG GG G G G G GG GGA G GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGA--GGSSGGASGGAGG-- 818 Query: 730 FXXGXGRGGGG 698 G GG G Sbjct: 819 -SSGGASGGAG 828 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P G P PPPP PPP P PPPPR PP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTP---VTNKPPPPRPATTQAPPP 248 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 ++ P PP APP P PP P P PP P+ PPP Sbjct: 207 RSGPLPPTAAPPPPPTTGAPPPTPVTNKPP----PPRPATTQAPPP 248 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +2 Query: 785 GXSXPPXGXPXPXX-XPPPPLPXXXPPPXPXXXXXXPPPP 901 G P P P PPP P PP P PPP Sbjct: 209 GPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP P PPP PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 35.1 bits (77), Expect = 0.083 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP P PP P PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPPP P PP P PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPP---PPPPPPPP 1184 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPPP P P P P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 PPP P PPP P PPPPP P P Sbjct: 1157 PPPPP---PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPP PP PP +PP P P PPPP+ Sbjct: 1157 PPPPPPPPPPPPSSPSPP------PPPPPPPPPPT 1185 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P PP P PPPP P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 813 PXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P P PPPP PPP P P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP 821 PPPP PP P PP P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP P P P PPPP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP----PPPP 1184 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 35.1 bits (77), Expect = 0.083 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 KKT P AP + PP P P PPPP+ PPP P P PP Sbjct: 196 KKTKPSAA--APKQQKATPVNPPEPDYLEP----TPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P P P P P P P P PPPPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 32.7 bits (71), Expect = 0.44 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP PPP PPPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP PPP P PPP P PPPPP Sbjct: 215 PPEPDYLEPTPPPPAAP--APPPPPAAAPPPPPPPP 248 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP 839 P P P PP APP P P P PPP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P PPPPP P PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 35.1 bits (77), Expect = 0.083 Identities = 25/90 (27%), Positives = 26/90 (28%), Gaps = 8/90 (8%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXP--GXSXPPXGXPXPXXXPP------PPL 844 PQ PPP P P G PP P PP PP+ Sbjct: 2565 PQNVEQPPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPM 2624 Query: 845 PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP G P PP Sbjct: 2625 LPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 34.7 bits (76), Expect = 0.11 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 P APP PP PP+ P P N PPP PPP P PP Sbjct: 270 PFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFS-RPPPNFNDPAFQGRPP---PFV 325 Query: 921 RPXP 932 RP P Sbjct: 326 RPPP 329 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXP 881 PP PP PP R P P+ P PPP P+ PPP P Sbjct: 279 PPRWGPPPHMPPDYRGFPPPN-FPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP 815 PPPP +PP+ PP PP P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 T P P PR PP PP P P P PP P Sbjct: 1350 TTSPIPSTPRPR-PPTPPRPPTPRPRPPTPRPGPPTP 1385 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 GGG GGGG G G G G GG GGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GGGG G G G G G A GGGG G G G G Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G GGG GGGG G G G A GG GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGD-GDANANADGGGGGGGGGDGDG 87 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGGGG G G GGGG G G G + G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGG---GGGGGDGDGDGDG 91 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG G G G GG GG G G G G GGGG Sbjct: 41 GGGGGGGGG----GGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGGG G GGG G G G GG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGG 77 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = -2 Query: 865 GGGXXXXEGGG-GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GGG +G G G G G GG GG GG GG G G GGG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G G GG +GGGG G G GG GG GG GG G Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGG--DGGGDGGGDGGGDG 482 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXGXPXGGXEXPG 781 RGG GG G GGG G GGG G G GG + G Sbjct: 442 RGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 31.9 bits (69), Expect = 0.77 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 +G GG G G GG GG GG G GG G G GGG Sbjct: 440 DGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGG---GDGGGDGGG 484 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG-GXFXGXG 811 GG G GG GG G GGG G GGG G G G Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG G G G G GG GGGG G G GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDG 470 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWGXGGARXXGGXRGG 758 G G G G G +GGG G G G G G GG GG Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GGGG G GG G GGG G GG + Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGGDD 486 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 34.3 bits (75), Expect = 0.14 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXG-GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G GG GGG G G GG GG GG+ Sbjct: 145 GDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGG----GGDDGGS 200 Query: 754 XXGGGGXVFXXGXGRGGGG 698 GGGG GR GG Sbjct: 201 DGGGGG----NDGGRDDGG 215 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG G G G G G GG GG GGG G Sbjct: 143 GDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDG 202 Query: 718 XGRGGGG 698 G G G Sbjct: 203 GGGGNDG 209 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGG G GGG GR GG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG----GXRGGAXXGGGGXV 731 G G G G GGG G GG+ G G GG GG G Sbjct: 135 GDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 Query: 730 FXXGXGRGGGG 698 G GGGG Sbjct: 195 GDDGGSDGGGG 205 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G G G G G G G G GG+ GGG G Sbjct: 125 GDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 Query: 718 XGRGGGGXLG 689 GGG G Sbjct: 185 GDDGGGSGGG 194 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G GG GG G GGG G GGG G GG + Sbjct: 171 GSNGSGGGDDGGDGGDDGGGSG-GGGDDGGSDGGGGGNDGGRDDGGDD 217 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 +T PPP PP PP + PP P P P PP PP P P P Sbjct: 178 RTQPPP---IPPIDPPRTQPPPIPPIDPPRTQPPPIPP----IDPPRTQPPPIFPQP 227 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +3 Query: 729 KTXPPPPXXA-PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 +T PPP PPR P P P P P PP P P P P PP Sbjct: 165 RTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQP-PPI 223 Query: 906 XXXXARPXP 932 P P Sbjct: 224 FPQPTTPAP 232 Score = 32.7 bits (71), Expect = 0.44 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +3 Query: 732 TXPPPPXXAPPR--XPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 T PP PPR PP P P P +PP PP P PP Sbjct: 154 TLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPI 213 Query: 906 XXXXARPXP 932 +P P Sbjct: 214 DPPRTQPPP 222 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPL--PXXXPPPXPXXXXXXPPPPP 904 PP P P PP+ P PPP P PPP Sbjct: 185 PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP P P PP P PPP P PPP Sbjct: 176 PPRTQPPP--IPPIDPPRTQPPPIPPIDPPRTQPPP 209 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPP 902 PP APP P PPPP PP P P P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P P PPPP PP P PPPP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP 866 PP P AP P APP P P P PP + P P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP P PPP P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P + PP P PPPLP PP P Sbjct: 514 PPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPPPLP P PP P Sbjct: 513 PPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +3 Query: 738 PPPPXXAPPRXP--PXXRAPPYPHXXXPX-PXXNPPPPSXXXXPPPXXXXP 881 PPPP PP P PP H P P PPP PPP P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAP 206 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA--PPYPHXXX----PXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP APP P PP H P P PPP PP P P Sbjct: 199 PPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPP 256 >SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) Length = 332 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 GG G G GG + GGG G G GG G GG GG Sbjct: 116 GGGGGSNGEVSDGGDDSSDDSGGGDDSGGGDDSGDGGGGNDSVGASGGYCGGG 168 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 P P PPPP P PPP P PPPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPP------PPPPASSTGSTP 893 Score = 32.3 bits (70), Expect = 0.58 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 P P P PPP P PPPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 762 PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PR P PP P P P PPP S P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 765 RXPPXXRAPPYPHXXXPXPXXNPPPP 842 R P R PP P P P PPPP Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPPPP 884 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 738 PPPPXXAP---PRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 P PP P PR P P R PP PH P P PPPS P Sbjct: 1334 PLPPSGLPLPLPRLPLPPLRLPP-PHSRLPLPPPKLPPPSRIPLP 1377 Score = 32.7 bits (71), Expect = 0.44 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP P PP P P P P PPP S PPP P P P Sbjct: 1329 PPWELP--LPPSGLPLPLPRLPLP-PLRLPPPHSRLPLPPPKLPPPSRIPLP 1377 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP--XPXXXXXXPPPPPR 907 P PP P P P PLP PP P P PPP+ Sbjct: 1324 PANYVPPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPK 1367 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP--PPPPR 907 PP G P P P P P PPP P PPP R Sbjct: 1336 PPSGLPLPLPRLPLP-PLRLPPPHSRLPLPPPKLPPPSR 1373 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Frame = +3 Query: 738 PP--PPXXAPPRX-PPXXRAPPY----PHXXXPXPXXNPPPPSXXXXPPP 866 PP PP PPR PP R Y P P PPPP PPP Sbjct: 101 PPRGPPLPGPPRRGPPPDRDSGYGGYGDRYDRPPPDRRPPPPDRSGYPPP 150 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPPS 845 PPP PP PP Y P PPPPS Sbjct: 133 PPPDRRPPPPDRSGYPPPRDYDRGYADRPRERPPPPS 169 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S PP P P PPP PPP P P P PP Sbjct: 65 PVASTPPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPP 115 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 + GGG G G G GG GG GG GGGG G G G Sbjct: 72 DDGGGDTDGGGGCGGGGGGGGGVGGGGGGG--GGGGDDCEDGGGDDG 116 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG GG G GGGG V G G GGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 903 GGG---GGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GGG GG G GGG G GGGG G GG + Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGD 114 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG +GGGG G G G GG GG G GGG Sbjct: 74 GGGDT--DGGGGCGGGGGGGG-GVGGGGGGGGGGGDDCEDGGG 113 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 G GGG GGGG G G G GG G GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GG G GGGG G GGG GGG G G E Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDE 127 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 GG G GGG GGGG G G GG G GG+ G Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG--DDGEDGGSDNDG 125 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG GGGG GGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 P P+P PPP P PPPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P P PPPP P PPP P PPPP Sbjct: 62 PIPPTLPPPPPP--PPPPLP------PPPP 83 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXP 871 P P PPPP P PPP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 P P+P PPP P PPPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P P PPPP P PPP P PPPP Sbjct: 286 PIPPTLPPPPPP--PPPPLP------PPPP 307 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXP 871 P P PPPP P PPP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 T PP AP P PP P P P NPP P Sbjct: 223 TTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXP 860 PP PP P PP P P P NPP PP+ P Sbjct: 221 PPTTQTPPTKAPTD--PPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP-PPRXXXGXPXP 931 PG P P P PP PP P PP PP P P Sbjct: 209 PGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 806 GXPXPXXXPPPP-LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 G P P PPPP +P PPP P P G PH Sbjct: 93 GDPPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKPH 137 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 G PP P P P PP P PP P PP P Sbjct: 93 GDPPPPATPPPPTMPPTPPPPQTPAPPGP--DTPAPPAP 129 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPP PP PP PP P P P PP+ Sbjct: 96 PPPATPPPPTMPP---TPPPPQTPAPPGPDTPAPPA 128 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGGG G GGG G G GG G G G + G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDG 44 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PP P APP PP R P P P PPPP Sbjct: 860 PPRPVGAPPSLPPRPRTRPLP----PKSDTPPPPP 890 Score = 32.3 bits (70), Expect = 0.58 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 KT P APP PP R P P P P PP PPP Sbjct: 846 KTDRPLSPSAPPPLPP--RPVGAPPSLPPRPRTRPLPPKSDTPPPP 889 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 S PP P P PP P P P PPPPPR Sbjct: 854 SAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDT-PPPPPR 891 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 33.1 bits (72), Expect = 0.33 Identities = 22/75 (29%), Positives = 27/75 (36%), Gaps = 6/75 (8%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXPP----PXXXXPXX 887 K P PP PP+ P P+P+ P + P PP PP P P Sbjct: 609 KHESPSPPSRVPPQ--PETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKT 666 Query: 888 XPXPPXXXXXARPXP 932 P P +RP P Sbjct: 667 TPKPHIPPAPSRPPP 681 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G P GGGGG G G GGGG G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 31.9 bits (69), Expect = 0.77 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G GG GG GGGG Sbjct: 422 GGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGF-GGGGGPNGAG 480 Query: 721 GXGRGGGGXLG 689 G G GGGG G Sbjct: 481 GGGGGGGGYSG 491 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXG-GXRGGAXXGGGGXVFXXGXGRGGG 701 GG G GG G G G G+R G GG+ G G G G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGSDKSQQAGANNGAG 525 Score = 28.3 bits (60), Expect = 9.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG G G G GG GG GG GG Sbjct: 443 GTGGEGGKSFLAGGAGGRSNQNDVEGGFG----GGGGPNGAGGGGGGGGGYSGGASGSRS 498 Query: 718 XGRGGGG 698 GGGG Sbjct: 499 NSCGGGG 505 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 33.1 bits (72), Expect = 0.33 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 1/68 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-GXRGGAXXGGGGXVFX 725 GG G GG GGG G G G G+ G G G GGGG Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGG---- 460 Query: 724 XGXGRGGG 701 G G GG Sbjct: 461 AGGGSTGG 468 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 GGG GG G G G G A G GGA G G G Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -2 Query: 859 GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG G G GG GG G G G G G GGG G Sbjct: 410 GTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGN----AGNGGAGGGGAG 462 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGG 829 GGGGG G GGG G GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGG 829 GGGGG G GGG G GG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGG 796 G GGG G GGGG G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 775 GGXRGGAXXGGGGXVFXXGXGRGGG 701 GG GG GGGG G G GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 772 GXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG GGGG G G GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G GGG G GGGG G G G + G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.1 bits (72), Expect = 0.33 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG G GG G G GG+ G GG GG G Sbjct: 185 GAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNS 244 Query: 718 XGRGGGGXLG 689 G G G Sbjct: 245 WSGGYGSYDG 254 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGX-GGGXXXGRGGGGXFXGXGXPXG 799 GG G RGGG G G GGG G GGG + G G G Sbjct: 187 GGRGG-RGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G P RGG G G GGG G G G + G Sbjct: 197 GGRGAPRG-RGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGG 236 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG G GG G G G GG GG G G GGGG G Sbjct: 347 GGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGG 405 Score = 32.3 bits (70), Expect = 0.58 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 6/74 (8%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR------GGAXXGGG 740 GG G GG G G G G GG + GG GGG Sbjct: 345 GGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGG 404 Query: 739 GXVFXXGXGRGGGG 698 G F GRGG G Sbjct: 405 GSAFGIEGGRGGHG 418 Score = 29.1 bits (62), Expect = 5.4 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG--GXRGGAX 752 G A GG G G + G G G G G GGA G GG+ Sbjct: 274 GGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGS- 332 Query: 751 XGGGGXVFXXGXGRGGGG 698 GG G GGGG Sbjct: 333 --GGIASSTIGACAGGGG 348 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G P GGGG G G GGGG F G Sbjct: 279 GSTGGPGGINAGGGGGDSTTDSDDGA--GGGGGGGHFSG 315 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 33.1 bits (72), Expect = 0.33 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 3/78 (3%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX-PXPXXXPPPPLPXXXP--PPXP 871 PPPPP P S P P PPP + P PP P Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLP 304 Query: 872 XXXXXXPPPPPRXXXGXP 925 PPPPP P Sbjct: 305 NFTSPSPPPPPPLPPAMP 322 Score = 32.3 bits (70), Expect = 0.58 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP PP PP APP P+ P P PPPP P P PP Sbjct: 283 PVPPMTPPPAVVTAPPP--APPLPNFTSPSPP--PPPPLPPAMPAMDDLLPPEVLSPP 336 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP---XPXXXXXXPPPPP 904 P + P P PPPPLP P P PPPPP Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP +PP PP P P P PP P P P PP Sbjct: 329 PPEVLSPPPPPP----PSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPPP 378 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.7 bits (71), Expect = 0.44 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG--GAXXGGGGXVF 728 GG GGG GGG G G G G RG G G GG F Sbjct: 473 GGGSYDHYDSYYGGGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDF 532 Query: 727 XXGXGRGG 704 GRGG Sbjct: 533 GGRGGRGG 540 Score = 28.7 bits (61), Expect = 7.2 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G G GG G G G GG GG RGG G G G G+GGG Sbjct: 412 GFGSLNSRRGGRGGPGGGYEGRGRGGR---GGPRGGGPRGYDG-----GYGQGGG 458 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -1 Query: 614 GXPPGX--GGXXXXPXGGGETRCPPPEXXGGGXF-XXGGXGGAPKKK 483 G P G G P G R PP GGG F GG GG K Sbjct: 499 GGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGGTTPGK 545 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 32.7 bits (71), Expect = 0.44 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG---GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG 761 G G GG G GG G GG G G G GG GG G Sbjct: 55 GVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDG 114 Query: 760 GAXXGGGGXVFXXGXGRGGG 701 G GG V G GGG Sbjct: 115 GGDDDSGG-VGDDGGDDGGG 133 Score = 29.5 bits (63), Expect = 4.1 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGX---GGARXXGGXRG 761 G G GG G GG + GG G G GG GG G Sbjct: 72 GFGDDGGDDSGGDDDSGGVGDDGGDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDG 131 Query: 760 GAXXGGGGXVFXXGXGRGGG 701 G GG V G GGG Sbjct: 132 GGDDDSGG-VGDDGGDDGGG 150 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 762 PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P PP PP P P P PPP + PP P P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 32.3 bits (70), Expect = 0.58 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 831 PPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXPXT 938 PPPP PPP P PP A P P T Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPT 157 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP P PP PP P P P P PP PP Sbjct: 123 PPPPTGTLP--PPPVTPPPGPET--PPPPDTPAPPVPPTEAPP 161 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP G P PPP P PPP PP PP Sbjct: 125 PPTGTLPPPPVTPPPGPETPPPP----DTPAPPVPP 156 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 732 TXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 T PPPP PP PP P P P PP PP Sbjct: 129 TLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 G PP P P PPP P PP P P PP PP+ Sbjct: 128 GTLPPPPVTPPPGPETPPP-PDTPAPPVP-PTEAPPTAPPTGGSCVSKPPY 176 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARP 926 PP P P P PPP PPP P P PP P Sbjct: 123 PPPPTGTLPPPPVT-PPPGPETPPPPDTPAP---PVPPTEAPPTAP 164 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 32.7 bits (71), Expect = 0.44 Identities = 20/40 (50%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVF---XXGXGRGGGGXLG 689 G GG R GG RGG GGG + G GRGGGG G Sbjct: 395 GRGGYRGRGG-RGGYRGRGGGRGYYRGGRGGGRGGGGRGG 433 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXG 817 G G RG GGG G GGG GRGG G G Sbjct: 401 GRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP +P P PP P P PPPP P P Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTP 370 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP 839 T P PP P+ P PP P P P PPP Sbjct: 341 TTPQPPTPTTPKTHPQLGPPPPP----PPPPPTPPP 372 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 32.7 bits (71), Expect = 0.44 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP-PH 937 P S PP P PP P P PP P PP P P P PH Sbjct: 239 PNTSIPPTPTPHTSI-PPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPH 290 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P S PP P PP P P PP P PP P P PH Sbjct: 249 PHTSIPPTPTPHTSI-PPTPTPHTSIPPTPTPHTSI-PPTPTPHTSIPPTPH 298 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG-GGGXVFXXGXGRGGGGXLG 689 GGG G G G G R G RGG+ G G G G GRG G G Sbjct: 19 GGGDRGRGRGHCL-GHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.9 bits (64), Expect(2) = 0.45 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPP P PPP PPP P Sbjct: 434 PPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXP--PPPPR 907 PPP P PPP P P PPP+ Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQ 456 Score = 21.4 bits (43), Expect(2) = 0.45 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 689 PQXTPPPPPXP 721 P TPPP P P Sbjct: 430 PPPTPPPTPPP 440 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.3 bits (65), Expect(2) = 0.54 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP PPP P PPPPP Sbjct: 82 PPPP-----PPPPPASNVPAPPPPP 101 Score = 20.6 bits (41), Expect(2) = 0.54 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 680 AXXPQXTPPPPP 715 A P PPPPP Sbjct: 79 AVIPPPPPPPPP 90 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 32.3 bits (70), Expect = 0.58 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 784 RXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 R GG RGG GG G GRGGGG Sbjct: 365 RTEGGGRGGGRGGGRGGFRGGRGGRGGGG 393 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 32.3 bits (70), Expect = 0.58 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P PP P P + P PP P PPP P PP Sbjct: 31 PPAPGGYPPA--PGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYG 88 Query: 918 ARP 926 A P Sbjct: 89 APP 91 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXP-PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 PG P P G P PP PPP P PPP G P P Sbjct: 34 PGGYPPAPGGYPPSGGYGYPPA-GGYPPPQPGYAGGPPPPGIAPGIGGPPP 83 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 32.3 bits (70), Expect = 0.58 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G GGG G GGG G GGG G G G + G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 32.3 bits (70), Expect = 0.58 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGGGG G GGG GG G G G G + G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -2 Query: 859 GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G +GGGG G G G GG G G G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 +G G G G G GG GG GG G G G G G G Sbjct: 301 DGDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG-GGGXFXGXGXPXG 799 G G GGGGG G GGG G G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G G GGG G GGGG G G G + G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDG 342 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGG G G GGG G G G G G G + G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG GGGG G G G G G G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 32.3 bits (70), Expect = 0.58 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G GG G G G G GG R GGA Sbjct: 203 GGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRG---GFGGDFGGDGG-RFDASNMGGA- 257 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG G +F G GG G Sbjct: 258 TGGTGNMFGGVGGTAAGGQTG 278 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G G GG+ G GG GGG GGGG Sbjct: 346 GGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP PPP PPPPPR PP Sbjct: 40 PRTEPRDRERPPPP-----PPPRFYDNDIPPPPPPRRGFYDDYPP 79 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 PP G P P PP P PPP P PPP Sbjct: 210 PPMGGPPPMGGPPGGYP--PPPPPPGAGDPAYPPP 242 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPP+ PPP PPPPP G P P Sbjct: 204 PGMWGPPPM--GGPPPMGGPPGGYPPPPPPPGAGDPAYP 240 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 P PP G P PPPP P P P Sbjct: 211 PMGGPPPMGGPPGGYPPPPPPPGAGDPAYP 240 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.9 bits (69), Expect = 0.77 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G G GG GG GGGG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFG-GGGGASGGG 499 Query: 721 GXGRGGGGXLG 689 G G GGGG G Sbjct: 500 GGGGGGGGFSG 510 Score = 31.1 bits (67), Expect = 1.3 Identities = 25/75 (33%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGX--GXXXWGX--GGARXXGGXR 764 G G G G G GG EGG G G W GG GG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGG----EGGKAFLNGGVGGRSIWNVVPGGFGGGGGAS 496 Query: 763 GGAXXGGGGXVFXXG 719 GG GGGG F G Sbjct: 497 GGGGGGGGGGGFSGG 511 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXX---GXGGGXXXGRGGGGXFXGXGXPXG 799 GG G GG GG G GGG GGGG G G G Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG + G G G G A G G GGG Sbjct: 25 GGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDD 84 Query: 721 GXGRGGGG 698 G GGG Sbjct: 85 GYDAAGGG 92 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG +G G G G A G G GGGG Sbjct: 52 GGGSDDDGYDAAGGGGSDHDGDDAAGGG-GSDDDGYDAAGGGGSDHDGYDAGGGGGSDDD 110 Query: 721 GXGRGGGG 698 G GGG Sbjct: 111 GYDAAGGG 118 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG + G G G G G G GGG Sbjct: 90 GGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDD 149 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 150 GDDAGGGG 157 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GG + G G G G A G G GGG Sbjct: 38 GGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHD 97 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 98 GYDAGGGG 105 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG +G G G G A G G GGGG Sbjct: 104 GGGSDDDGYDAAGGGGSDHDGYDAVGDG-GSDDDGYDAAGGGGSDDDGDDAGGGGGSDHD 162 Query: 721 GXGRGGGG 698 G GGG Sbjct: 163 GDDAAGGG 170 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 +GGGG G G GG+ G GGGG + G GGG Sbjct: 10 DGGGGDSYDDGDDAGGGGGS-----DDDGYDAGGGGGSYDDGYDAAGGG 53 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP-PXXXXX 917 PPP R PP + PP P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPA-KLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPE 289 Query: 918 ARPXP 932 P P Sbjct: 290 PEPEP 294 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 +T PP PPR P P P P P P P P P P Sbjct: 236 QTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP 292 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/47 (31%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Frame = +2 Query: 800 PXGXPXPXXXPPP-PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P P P P P P P P P P P P P H Sbjct: 250 PVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEPVH 296 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G GG G GGG G G GG + G G G G Sbjct: 793 GWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRYSG 833 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 835 GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GG WG GG R GGGG + G G GGG Sbjct: 775 GGYGGPPRDQNWGRDPREGWGGNRDNYSRGGGGG-YNRGYGSGGG 818 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGG G G GG G G G G P GG Sbjct: 1266 GSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGG 1311 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/79 (27%), Positives = 22/79 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P G PP G P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP-GLPGPQGIPGYP---GAPAGP 1715 Query: 869 PXXXXXXPPPPPRXXXGXP 925 P PP P G P Sbjct: 1716 PGRDGPMGPPGPSGGQGPP 1734 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP P PP P P G P PP Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 APP PP PP P P P PP P P P Sbjct: 1661 APPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYP 1709 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP P P H PPPP PPP Sbjct: 1425 PPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAPPCPPP 1468 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPP---XXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP APP PP H P P P P + PP Sbjct: 1456 PPPPPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPP 1500 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GGG +GGGG G G G G G G GG V Sbjct: 14 GGDGGDSGGGSDGGGDGG-DGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGGDV 69 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXP 871 P P PPPP P PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPPL PPP P PPPPP Sbjct: 73 PPPLCAPPPPPPPPP---PPPPPP 93 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYP 800 PPP APP PP PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 >SB_42247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG---RGGGGX 695 GGG GGG G G GG G G GGG + G G R GGG Sbjct: 120 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILRYGGGY 179 Query: 694 L 692 + Sbjct: 180 I 180 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 32 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGY 91 Query: 697 XLG 689 LG Sbjct: 92 ILG 94 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 48 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGY 107 Query: 697 XLG 689 LG Sbjct: 108 ILG 110 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 64 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGY 123 Query: 697 XLG 689 LG Sbjct: 124 ILG 126 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 80 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGY 139 Query: 697 XLG 689 LG Sbjct: 140 ILG 142 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 96 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGY 155 Query: 697 XLG 689 LG Sbjct: 156 ILG 158 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 136 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILRYGGGYILGYGGGYILGYGGGY 195 Query: 697 XLG 689 LG Sbjct: 196 ILG 198 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG----XGRGGGG 698 GGG GGG G G GG G G GGG + G G GGG Sbjct: 184 GGGYILGYGGGYILGYGGGYILGYGGGYILGYRGGYILVYGGGLILRYGGGVILGYGGGY 243 Query: 697 XLG 689 LG Sbjct: 244 ILG 246 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GGG G G GG G G GGG + G GGG LG Sbjct: 112 GGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYILGYGGGYIL----GYGGGYILG 166 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GGG G G GG G G GGG + G GGG LG Sbjct: 160 GGGYILGYGGGYILRYGGGYILGYGGGYILGYGGGYILGYGGGYIL----GYGGGYILG 214 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXP 871 P P PPPP P PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPPL PPP P PPPPP Sbjct: 274 PPPLCAPPPPPPPPP---PPPPPP 294 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYP 800 PPP APP PP PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 897 GGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GGG G GGG G GGGG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 +GGGG G G GG GG GG GGGG Sbjct: 24 DGGGGHGGGHGY-----GGGPNGGGGGGGGGGGGGG 54 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 784 RXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 R GG GG GGG G G GGGG G Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGG 829 GGG G G GGG G GGGG Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G GG GGGG G G GGGG Sbjct: 26 GGGHGGGHGYGGGPNGGGG---GGGGGGGGGG 54 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -2 Query: 841 GGGGXXXGX-GXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG G G G GG GG G GGGG G GGG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGG 835 P RGGGGG G GGG GRGG Sbjct: 998 PRRRRGGGGGGGGGGGG-GGGRRGGRGG 1024 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = -3 Query: 933 GGXGXPXXXRGG----GGGXXXXXXGXGGGXXXGRG-GGGXFXGXGXPXGGXEXPG 781 GG G P GG GGG G G G G GGG G G GG G Sbjct: 1072 GGMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQG 1127 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -2 Query: 820 GXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFXXGXGRGGGGXLG 689 G G G GGA GG + GGG G + G G GG +G Sbjct: 1073 GMGMPQMGGGGAAMGGGGQQPMMMGGGQGMMMGNAMGGGMGGGMG 1117 >SB_28064| Best HMM Match : DUF1174 (HMM E-Value=4.5) Length = 404 Score = 30.7 bits (66), Expect = 1.8 Identities = 23/82 (28%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXX-GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G A G G G GG E G G G +G G G G Sbjct: 180 GTGLAGTKGIGEHGTGLAGTKGMGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEHGT 239 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG + G G GG +G Sbjct: 240 GLGGNKGIGEYGTGLGGNKGIG 261 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/81 (25%), Positives = 24/81 (29%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G E G G G +G G A G G Sbjct: 45 GKGEYDTGLGGNKGIGEYGTGLAGNKGIGEYGTGLGGNKGIGEYGTGLAGNKGIGEYGTG 104 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG + G G GG +G Sbjct: 105 LGGNKGIGEYGTGLGGNKGIG 125 Score = 29.1 bits (62), Expect = 5.4 Identities = 22/81 (27%), Positives = 23/81 (28%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G GG E G G G G G A G G Sbjct: 311 GIGEHGTGLAGNKGIGEYGTGLGGNKGKGEYGTGLGGNKGIGEHGTGLAGNKGKGEYGTG 370 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG + G G GG G Sbjct: 371 LGGNKGIDEYGTGLGGNKGKG 391 Score = 28.7 bits (61), Expect = 7.2 Identities = 21/81 (25%), Positives = 23/81 (28%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G GG E G G G +G G G G Sbjct: 207 GIGEHGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEYGTG 266 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG + G G GG G Sbjct: 267 LGGNKGIGEHGTGLGGNKGKG 287 Score = 28.3 bits (60), Expect = 9.5 Identities = 23/82 (28%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGX-GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G A GG G GG E G G G G G G G Sbjct: 193 GTGLAGTKGMGGNKGIGEHGTGLGGNKGIGEYGTGLGGNKGIGEHGTGLGGNKGIGEYGT 252 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG + G G GG +G Sbjct: 253 GLGGNKGIGEYGTGLGGNKGIG 274 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPPLP P PPPPP P P Sbjct: 681 PPLTPPPPLPTPIASSEP---LPLPPPPPPTGIDIPHSP 716 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +2 Query: 791 SXPPXGXPXPXXXP---PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP P P P PLP PPP P P P + P PP Sbjct: 679 SKPPLTPPPPLPTPIASSEPLPL--PPPPPPTGIDIPHSPSKDDLPLPPPP 727 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P PP PP PH PPPP PPP P P Sbjct: 698 PLPLPP--PPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPP 746 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P PPPP P P P PPP P P Sbjct: 692 PIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPP 735 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 P P PP PP P P P PP P P P PP + Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAP-PPVAATLS 589 Query: 921 RPXP 932 P P Sbjct: 590 APPP 593 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 9/90 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPP---------P 841 P PPP P P + P P G P P PPP P Sbjct: 395 PVAAPPPAPPP---SVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVP 451 Query: 842 LPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P PPP P P P P Sbjct: 452 TPVTAPPPAPPPSVFAPSSGVPTPVAAPPP 481 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP P P AP P P PPS PPP P P P Sbjct: 309 PPMGAQLPETEQPQMVAPS---STVTPPVTEPAPPSSVVAPPPAVPTPATAPPP 359 Score = 28.3 bits (60), Expect = 9.5 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP----YPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPX 896 PPP P PP APP P P PPP S P P P P Sbjct: 346 PPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPP---PA 402 Query: 897 PP 902 PP Sbjct: 403 PP 404 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPP-PLPXXXPPP--XPXXXXXXPPPPP 904 P P G P P PPP P P P P PP PP Sbjct: 521 PSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP--PP 904 P G P PPPL PPP P P P PP Sbjct: 168 PMGAPMGMCCMPPPLNPYQPPPFPPPHLMYPQPTAPP 204 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPP 862 PP P P PPPP P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P PPPP P PPP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPP----PLPPTP 1330 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GG G P GGGGG G GGG +G G G G E Sbjct: 19 GGGGSPTEAPGGGGGSPTEAPG-GGGSTPTKGEGSTSPTPGGGKEGAE 65 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP+ PP P PPP P PP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPP 396 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP PP PP P PP PPP P PP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQ 412 Query: 918 ARPXP 932 P P Sbjct: 413 TLPPP 417 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP P P P P P PPP + P P PP Sbjct: 368 PIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVP 427 Query: 918 ARP 926 RP Sbjct: 428 NRP 430 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP P P PP P P P PP P P P P P P Sbjct: 143 PSPPN--PTEAPEPETVPPQPETVPPQPETVPPQPG-SEEPEPVSQAP--EPPKPKTSAP 197 Query: 918 ARPXP 932 P P Sbjct: 198 EPPKP 202 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 +T PP P PP+ PP P P P P P P P Sbjct: 155 ETVPPQPETVPPQ---PETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P P R P P P PPPP P P PP Sbjct: 859 PPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPP 913 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G GGG G GG G+GGGG G G GG Sbjct: 56 GQGGGGQGGGQGVGGQEVGGQGGGGQGVG-GQEVGG 90 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 P RGGGGG G GGG GRG G Sbjct: 509 PRRRRGGGGGGGGGGGGGGGG-RGGRGRG 536 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPP 866 P P P P R P+ + P P P PPS PPP Sbjct: 75 PYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPP 117 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P PPR +P P P +PPP PPP P P Sbjct: 913 PTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPMRSSPLPPPQRKRASTPPSP 964 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/71 (30%), Positives = 25/71 (35%), Gaps = 4/71 (5%) Frame = +3 Query: 732 TXPP---PPXXAPPRXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPPXXXXPXXXPXP 899 T PP P P PP +P P P P P P+ PPP P P Sbjct: 102 TGPPTSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQ 161 Query: 900 PXXXXXARPXP 932 P A+P P Sbjct: 162 P---YPAQPYP 169 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPPR--XPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP PP P A PYP P PPP + P P P P Sbjct: 148 PPPGGYPPTSYPPQPYPAQPYPQQGYP---PQPPPQAYPQPGYPPQGYPPTGPYPQTQPG 204 Query: 915 XARPXP 932 A P Sbjct: 205 YAGATP 210 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P PP PP + P P P P PP P PP Sbjct: 137 PPMPHPTASVYPPPGGYPPTSYPPQPYP-AQPYPQQGYPPQPPPQAYPQPG-YPPQGYPP 194 Query: 918 ARPXPXT 938 P P T Sbjct: 195 TGPYPQT 201 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 26.2 bits (55), Expect(2) = 3.4 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP P P PPP P PP Sbjct: 1125 PPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPP 1159 Score = 21.8 bits (44), Expect(2) = 3.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 689 PQXTPPPPPXP 721 P PPPPP P Sbjct: 1122 PLPPPPPPPIP 1132 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +3 Query: 744 PPXXAPPRXPPXXRA-PPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXP--XXXPXPP 902 PP + P+ PP + PP P P NPP S PP P P PP Sbjct: 906 PPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPP 963 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +3 Query: 744 PPXXAPPRXPPXXRA-PPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXP--XXXPXPP 902 PP + P+ PP + PP P P NPP S PP P P PP Sbjct: 938 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPP 995 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 744 PPXXAPPRXPPXXRA-PPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP + P+ PP + PP P P NPP S PP P P Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQP 928 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 744 PPXXAPPRXPPXXRA-PPYPHXXXPXPXXN-PPPPSXXXXPPP 866 PP + P+ PP + PP P P PP S PPP Sbjct: 954 PPMSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/50 (28%), Positives = 16/50 (32%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXPXT 938 PP PH P P PP PP P P ++P T Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQPTTRT 84 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPP 901 PPPP P PPP P PPPP Sbjct: 54 PPPPPPPPPPPPPP------PPPP 71 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 PPPP P PPP PPPPP P Sbjct: 55 PPPPPPPPPPPP--------PPPPPSSSPSRP 78 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXP 892 P PPPP P PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXP 871 PP P P PPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.5 bits (63), Expect = 4.1 Identities = 21/71 (29%), Positives = 25/71 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G G G + G G G G G GG + G +G G G Sbjct: 30 GIKGEGEGQKGEGKGEGIKDEGKGEGEGKGDGK-GEGGGKGEGEGKGEGKSEGKGEGGGK 88 Query: 721 GXGRGGGGXLG 689 G G+G G G Sbjct: 89 GDGKGEEGGKG 99 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G G G +G G G G G + G GG G G G Sbjct: 40 GEGKGEGIKDEGKGEGEGKGDGKGEGGGKGEGEGKGEGKSEGKGEGGGKGDGKGEEGGKG 99 Query: 718 XGRG 707 G+G Sbjct: 100 DGKG 103 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG GGGG G G G G G G G G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDG 376 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G G G GG GGA G G GG G V GGG Sbjct: 3255 GTGASGSGAAVGGAGGAGGASAYMMSASGGGAAGSSGSIGAGAAGGAGAVAAVAVSGGGG 3314 Query: 700 G 698 G Sbjct: 3315 G 3315 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G +GG G G GG G+GG G G G G + PG Sbjct: 32 GQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQ-GGDGPAGQGGDGPG 81 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPP-RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP P PP + PP P P PP S P P P P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 Score = 29.1 bits (62), Expect = 5.4 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 3/78 (3%) Frame = +2 Query: 710 PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXP---XXXPPPPLPXXXPPPXPXXX 880 PP P N P PP P P PPPPLP PP Sbjct: 227 PPEPEDYNKLEEWTGDKPHPPSVKPSVPIPPPTKPPPRVASRRPPPPLP---PPDSSEAQ 283 Query: 881 XXXPPPPPRXXXGXPXPP 934 PP P G P P Sbjct: 284 AQQPPLSP--PVGKPVVP 299 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 29.5 bits (63), Expect = 4.1 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG G GG G G G+ G G GG G Sbjct: 2934 GLGNPGGTGPGAGGTLGSRGTGGGYGGKGGHADDISGS-WYGSTFNPNVTGSGGGNCASG 2992 Query: 718 XGRGGGGXL 692 G GGG L Sbjct: 2993 NGGAGGGYL 3001 >SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP 836 P APPR P APP P P +PP Sbjct: 176 PQHRAPPRNFPVENAPPKQPFPGPMPTMHPP 206 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPP 866 P P P P R P+ + P P P PPS PPP Sbjct: 128 PYPGPLPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPP 170 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP---PPSXXXXPPP 866 P P P PP PP PH P PP PP P P Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GG G G G GG GG GG GGG G G G Sbjct: 159 GGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDG 205 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPP 866 P P P P R P+ + P P P PPS PPP Sbjct: 165 PYPGPPPVLSPQVYRCYPFQYPGTPPPPMYPAFPPSFPFSPPP 207 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 29.1 bits (62), Expect = 5.4 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GG G GG +G GGA GG GGG GGG Sbjct: 236 GVNATGGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGG 295 Query: 700 G 698 G Sbjct: 296 G 296 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG--GGGXVFXXG 719 GG E GG G G GG GG G G GGG F G Sbjct: 212 GGKGGWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGGGSFNSG 261 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG GG G GG GGGG + G G Sbjct: 212 GGKGGWENGGFGGGGSAMAHPGGGGGYSGGG 242 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPPP A PP PP P P N P S Sbjct: 10 PPPPIAAEFTAPPAPPPPPNPAPDVPAESVNTQPNS 45 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P RAPP P PPP P P P Sbjct: 533 PPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAPKRALDLKPNLPPVP 586 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G GGG EGGGG G G G GG G GGGG V G Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGG--GCVGCEGGGGCVG--CEGGGGCVGCEG 127 >SB_24277| Best HMM Match : EGF (HMM E-Value=2.4e-06) Length = 433 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP G PP + P P P PP R P PP Sbjct: 289 PPKGIMGSTPNPPKGIMGSTPNPPKGIMGSTPNPPKRIMGSLPNPP 334 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP G PP + P P P PP R P PP Sbjct: 355 PPKGIMGSTPNPPKGIMDSTPHPHKGIMGSTPNPPKRIMGSLPNPP 400 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXP 871 P P P PPPP P PPP P Sbjct: 192 PSWNRPPPSGAPPPP-PIGAPPPPP 215 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.1 bits (62), Expect = 5.4 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPL---PXXXPPPXPXXXXXXPPPP----PRXXXGXPXPP 934 G + PP P PPP + P PP PP P P G P PP Sbjct: 34 GFNPPPSSVPVSYPGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPPP 90 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -3 Query: 933 GGXGXPXXXRGG--GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 GG G RGG GG G GG RGGGG F G P GG + Sbjct: 431 GGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGG-FSG---PRGGGQ 476 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 906 RGGG-GGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 RGGG GG G GG G+ GG G G P GG G Sbjct: 429 RGGGRGGFRGNRGGFRGGNERGQRRGGR-GGHGPPRGGGGFSG 470 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPP 866 P P P P R P+ + P P P PPS PPP Sbjct: 165 PFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPP 207 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGGG G GG GGGG G Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDG 138 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP 898 P + PP P PPP P PP P PP Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 GGG G GG G G G R GG RGG G G Sbjct: 338 GGGRG---GRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAG 376 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -3 Query: 906 RGGGGGXXXXXX--GXGGGXXXGRGGG-GXFXGXGXPXG 799 RGG GG G G GRGGG G F G P G Sbjct: 341 RGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQG 379 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPP P PPP P PP P Sbjct: 365 PPPPPHSPPPPLPVIQLNPPPARP 388 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 28.7 bits (61), Expect = 7.2 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGG-GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G GGG GG G G G GG G A GG + Sbjct: 463 GGMNGIVGMNGMGGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGGLNGIGG 522 Query: 724 XGXGRGGGGXLG 689 RG GG G Sbjct: 523 MNGMRGIGGMNG 534 >SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF-XGXGXPXGG 796 G G P RGGG G G G GGG F G G GG Sbjct: 140 GPFGGPRFGRGGGDQFERRYRGGGRGPFGPVFGGGNFGGGFGGDFGG 186 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXE-GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G GG GGGG G G G GG GG G Sbjct: 331 GGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXG---RGGGGXFXGXGXPXGG 796 GG G GGGG G GGG G GG G GG Sbjct: 331 GGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGG 379 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXX--RAPPYPHXXXPXPXXNPPPP 842 PPPP PP PYP P PPPP Sbjct: 356 PPPPGEGPPEDTQVAVPLGVPYPVTSHATPTIIPPPP 392 >SB_45600| Best HMM Match : LTXXQ (HMM E-Value=1.8) Length = 355 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP-PXX 908 T PP P PP P A P+P PP P P P P P Sbjct: 251 TPPPAPVFTPP-PPYRTTAKPFPKMSLTPTPKKPPVPKKPVLTPAQLEGLLKSPSPLPKK 309 Query: 909 XXXARPXP 932 P P Sbjct: 310 KKKTGPPP 317 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP APP PP P P PP S PPP P Sbjct: 684 PPPP--APP-PPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPP 728 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPP 866 PPPP P P + P P P PPPP PPP Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPP-----PPP 94 >SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P P PP R G P PP Sbjct: 478 PPGPAGPPGPSGRYVPGPPGPPGRTVIGLPGPP 510 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G P PPP P PP PPPPP G P Sbjct: 574 GSTSPVATSPPPHPP--PPAHHVNKPGVPPPPPPSKTGKSKP 613 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXG 919 G P P P PPP P P P PPP G Sbjct: 578 GYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPG 622 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P P P PPP P P PP P P Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPP 617 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP 836 PPPP PP PP PP + P P + P Sbjct: 82 PPPPIYMPP--PPVYMPPPPVYMPPPMPMGDVP 112 >SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP PP R P P PP PP P P P Sbjct: 842 PPPVRVTVATPPPVRVPAATPLPVRVPVATLPPVRLPVATPPPVRVPVATPLP 894 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 25.0 bits (52), Expect(2) = 9.2 Identities = 13/42 (30%), Positives = 13/42 (30%), Gaps = 1/42 (2%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP-RXXXGXPXPP 934 P P PPP P P P P P P PP Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPP 983 Score = 21.4 bits (43), Expect(2) = 9.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 689 PQXTPPPPPXP 721 P TPPP P P Sbjct: 940 PTPTPPPSPPP 950 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 842 LPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 LP PPP P P PPR P P Sbjct: 3126 LPVAPPPPVPVSTEVEPMRPPRKMRAPPPP 3155 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXP 931 PPP PPPPPR P P Sbjct: 740 PPPPATAAKAPPPPPPRKDVEEPSP 764 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPY 797 ++ PPPP PPR PPY Sbjct: 877 RRGSPPPPMAPPPRSASPNHRPPY 900 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 P P PP P+ PP P P PPPR Sbjct: 191 PVPAHRPPQPVDVL--PPPPKLAKTKPVPPPR 220 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXP 815 P P APP PP PP P+ P Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGP 254 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP PP APP P +PP + PP Sbjct: 104 PPPPATTSAPPPPTTTAPPAT-TSPPTTTDSPPTTAAETLPP 144 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 28.3 bits (60), Expect = 9.5 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 6/65 (9%) Frame = +3 Query: 726 KKTXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-----PPSXXXXPPPXXXXPXX 887 +K PP P P R R PP+ P PP PP PP P Sbjct: 296 QKPGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPH 355 Query: 888 XPXPP 902 P P Sbjct: 356 EPGRP 360 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG +GGGG G G GG GGGG Sbjct: 46 GGGVGDDDGGGGGCGGGDDDDDGGGGGDDDDDDDDDDGGGGGG 88 >SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) Length = 545 Score = 28.3 bits (60), Expect = 9.5 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GG GG G G GG GGA GG Sbjct: 450 GIAGGSLGGADLGGATNSFADNGGMSLGNLGSQGMAGMNEMGGGSMGGASMAGGSMGGLG 509 Query: 721 GXGRGGGGXLG 689 G G GG G Sbjct: 510 GLGGFGGAQQG 520 >SB_9191| Best HMM Match : TolA (HMM E-Value=1) Length = 541 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPY 797 ++ PPPP PPR PPY Sbjct: 67 RRGSPPPPMAPPPRSASPNHRPPY 90 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLP 847 PG + PP P P PP P P Sbjct: 174 PGVAPPPSSQPAPAPAPPQPAP 195 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 766 RGGAXXGGGGXVFXXGXGRGGGGXLGXXXRXR 671 RGG GGGG G GR GGG + R R Sbjct: 163 RGGGGGGGGGG----GGGRRGGGSMSPPRRSR 190 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 P + PP PPPP P PPPPP+ Sbjct: 194 PEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPPK 235 >SB_39661| Best HMM Match : KOW (HMM E-Value=1.1e-07) Length = 487 Score = 28.3 bits (60), Expect = 9.5 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG G GG AR GG GG GGG G GRG GG Sbjct: 88 GGGKNATTGFGGFGTFAPASPRISSPARDGGG--GGNVRGGGQSPRAVGRGRGRGG 141 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 28.3 bits (60), Expect = 9.5 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 6/65 (9%) Frame = +3 Query: 726 KKTXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-----PPSXXXXPPPXXXXPXX 887 +K PP P P R R PP+ P PP PP PP P Sbjct: 62 QKPGPPGRPPFEPDRLQHEARIPPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPH 121 Query: 888 XPXPP 902 P P Sbjct: 122 EPGRP 126 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG GGG G G G G G GGGG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGG 460 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 23.8 bits (49), Expect(2) = 9.6 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P P PPPP P P P PP Sbjct: 794 PPPPPPPPPPPPEDLIIPLPRRGSDLFAPP 823 Score = 22.6 bits (46), Expect(2) = 9.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 698 TPPPPPXP 721 TPPPPP P Sbjct: 793 TPPPPPPP 800 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,206,201 Number of Sequences: 59808 Number of extensions: 346487 Number of successful extensions: 11278 Number of sequences better than 10.0: 211 Number of HSP's better than 10.0 without gapping: 1037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4975 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2740956230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -