BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K06 (938 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 59 4e-09 At2g05440.2 68415.m00575 glycine-rich protein 55 8e-08 At5g46730.1 68418.m05757 glycine-rich protein 54 1e-07 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 54 2e-07 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 54 2e-07 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 53 2e-07 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 52 4e-07 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 52 4e-07 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 52 6e-07 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 52 6e-07 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 51 1e-06 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 50 2e-06 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 50 2e-06 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 50 3e-06 At2g05440.1 68415.m00574 glycine-rich protein 48 7e-06 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 48 7e-06 At4g01985.1 68417.m00265 expressed protein 48 9e-06 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 48 1e-05 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 48 1e-05 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 48 1e-05 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 48 1e-05 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 47 2e-05 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 47 2e-05 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 46 3e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 46 4e-05 At1g27710.1 68414.m03387 glycine-rich protein 46 4e-05 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 46 5e-05 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 46 5e-05 At2g30560.1 68415.m03722 glycine-rich protein 46 5e-05 At1g02710.1 68414.m00222 glycine-rich protein 46 5e-05 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 45 6e-05 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 45 8e-05 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 45 8e-05 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 45 8e-05 At1g77030.1 68414.m08970 glycine-rich protein 44 1e-04 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 44 1e-04 At1g75550.1 68414.m08780 glycine-rich protein 44 1e-04 At1g26150.1 68414.m03192 protein kinase family protein similar t... 44 2e-04 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 43 3e-04 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 43 3e-04 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 43 3e-04 At1g11850.2 68414.m01364 expressed protein 43 3e-04 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 42 4e-04 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 42 4e-04 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 42 4e-04 At1g61080.1 68414.m06877 proline-rich family protein 42 4e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 42 6e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 42 6e-04 At5g38560.1 68418.m04662 protein kinase family protein contains ... 42 8e-04 At4g30460.1 68417.m04325 glycine-rich protein 42 8e-04 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 42 8e-04 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 42 8e-04 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 42 8e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 42 8e-04 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 42 8e-04 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 42 8e-04 At1g29380.1 68414.m03592 hypothetical protein 42 8e-04 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 41 0.001 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 41 0.001 At2g05510.1 68415.m00583 glycine-rich protein 41 0.001 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 41 0.001 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 41 0.001 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 41 0.001 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 40 0.002 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 40 0.002 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 40 0.002 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 40 0.002 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 40 0.002 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 40 0.002 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 40 0.002 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 40 0.002 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.002 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 40 0.002 At1g10620.1 68414.m01204 protein kinase family protein contains ... 40 0.002 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 39 0.004 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 39 0.004 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 39 0.004 At4g15460.1 68417.m02363 glycine-rich protein 39 0.004 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 39 0.004 At1g62240.1 68414.m07021 expressed protein 39 0.004 At1g04800.1 68414.m00476 glycine-rich protein 39 0.004 At1g04660.1 68414.m00463 glycine-rich protein 39 0.004 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 39 0.005 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 39 0.005 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 38 0.007 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 38 0.007 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 38 0.007 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 38 0.007 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 38 0.010 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 38 0.010 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 38 0.010 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 38 0.010 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 38 0.013 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 38 0.013 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.013 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 38 0.013 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 38 0.013 At1g15840.1 68414.m01901 expressed protein 38 0.013 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 37 0.017 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 37 0.017 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 37 0.017 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 37 0.017 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 37 0.017 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 37 0.022 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 37 0.022 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 37 0.022 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 37 0.022 At3g24550.1 68416.m03083 protein kinase family protein contains ... 37 0.022 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 37 0.022 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 36 0.029 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 36 0.029 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 36 0.029 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 36 0.029 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 36 0.029 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 36 0.029 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 36 0.029 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 36 0.029 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 36 0.039 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 36 0.039 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 36 0.039 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 36 0.039 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 36 0.039 At1g15830.1 68414.m01900 expressed protein 36 0.039 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.039 At3g42130.1 68416.m04326 glycine-rich protein 36 0.051 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 36 0.051 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 36 0.051 At1g11850.1 68414.m01363 expressed protein 36 0.051 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 0.060 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 35 0.068 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 35 0.068 At1g23540.1 68414.m02960 protein kinase family protein contains ... 35 0.068 At5g61660.1 68418.m07736 glycine-rich protein 35 0.090 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 35 0.090 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 35 0.090 At3g07560.1 68416.m00903 glycine-rich protein 35 0.090 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 35 0.090 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 35 0.090 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 34 0.12 At3g50180.1 68416.m05486 hypothetical protein 34 0.12 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 34 0.12 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 34 0.12 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 34 0.12 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 34 0.12 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 34 0.16 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 34 0.16 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.16 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 34 0.16 At3g15400.1 68416.m01954 anther development protein, putative si... 34 0.16 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 34 0.16 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 34 0.16 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 34 0.16 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 33 0.21 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 33 0.21 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.21 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 33 0.21 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.21 At4g33660.1 68417.m04781 expressed protein 33 0.21 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 33 0.21 At4g08230.1 68417.m01358 glycine-rich protein 33 0.21 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 33 0.21 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 33 0.21 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 33 0.21 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 33 0.21 At1g70990.1 68414.m08190 proline-rich family protein 33 0.21 At1g65440.1 68414.m07424 glycine-rich protein 33 0.21 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 33 0.21 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 33 0.21 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 33 0.21 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 33 0.21 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 33 0.27 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.27 At4g34440.1 68417.m04894 protein kinase family protein contains ... 33 0.27 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 33 0.27 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 33 0.27 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 33 0.27 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 33 0.27 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 33 0.27 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 33 0.27 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 33 0.27 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 33 0.27 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 31 0.29 At4g21720.1 68417.m03145 expressed protein 30 0.33 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 33 0.36 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 33 0.36 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.36 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 33 0.36 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 33 0.36 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 33 0.36 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 33 0.36 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 33 0.36 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 32 0.48 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 32 0.48 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.48 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 32 0.48 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 32 0.48 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 32 0.48 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 0.49 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 32 0.63 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 32 0.63 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 32 0.63 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 32 0.63 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 32 0.63 At1g76965.1 68414.m08961 glycine-rich protein 32 0.63 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 32 0.63 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 32 0.63 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 32 0.63 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 32 0.63 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 0.83 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 31 0.83 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.83 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 31 0.83 At3g51290.1 68416.m05614 proline-rich family protein 31 0.83 At2g05530.1 68415.m00585 glycine-rich protein 31 0.83 At1g49270.1 68414.m05524 protein kinase family protein contains ... 31 0.83 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 0.83 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 31 0.83 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 31 1.1 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At4g16240.1 68417.m02464 hypothetical protein 31 1.1 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 31 1.1 At2g41420.1 68415.m05111 proline-rich family protein contains pr... 31 1.1 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 31 1.1 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 31 1.1 At1g53625.1 68414.m06096 expressed protein 31 1.1 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 1.1 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 31 1.1 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 27 1.4 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 31 1.5 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 31 1.5 At5g56890.1 68418.m07099 protein kinase family protein contains ... 31 1.5 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 31 1.5 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 31 1.5 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 31 1.5 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 31 1.5 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 31 1.5 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 31 1.5 At4g22740.2 68417.m03281 glycine-rich protein 30 1.9 At4g22740.1 68417.m03280 glycine-rich protein 30 1.9 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 30 1.9 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 30 1.9 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 30 1.9 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 30 1.9 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 30 2.5 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 30 2.5 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 30 2.5 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 30 2.5 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 30 2.5 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 30 2.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 30 2.5 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 30 2.5 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 30 2.5 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 30 2.5 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 30 2.5 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 30 2.5 At1g07135.1 68414.m00759 glycine-rich protein 30 2.5 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 27 3.0 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 29 3.4 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 3.4 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 3.4 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 3.4 At5g24620.1 68418.m02908 thaumatin-like protein, putative simila... 29 3.4 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 29 3.4 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 3.4 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 29 3.4 At4g37900.1 68417.m05360 glycine-rich protein 29 3.4 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 29 3.4 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 29 3.4 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 29 3.4 At3g24250.1 68416.m03044 glycine-rich protein 29 3.4 At3g08640.1 68416.m01003 alphavirus core protein family contains... 29 3.4 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 3.4 At3g04570.1 68416.m00485 DNA-binding protein-related contains Pf... 29 3.4 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 3.4 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 29 3.4 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 3.4 At1g26110.1 68414.m03186 expressed protein 29 3.4 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 3.4 At5g28300.1 68418.m03436 trihelix DNA-binding protein, putative ... 29 4.4 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 29 4.4 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 29 4.4 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 4.4 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 29 4.4 At4g15150.1 68417.m02326 glycine-rich protein 29 4.4 At3g56590.1 68416.m06293 hydroxyproline-rich glycoprotein family... 29 4.4 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 29 4.4 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 4.4 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 29 4.4 At2g11005.1 68415.m01177 glycine-rich protein 29 4.4 At1g36675.1 68414.m04563 glycine-rich protein 29 4.4 At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family... 29 4.4 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 24 4.9 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 29 5.9 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 29 5.9 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 5.9 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 5.9 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 29 5.9 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 5.9 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 29 5.9 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 29 5.9 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 29 5.9 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 29 5.9 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 29 5.9 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 29 5.9 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 29 5.9 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 29 5.9 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 29 5.9 At1g76010.1 68414.m08825 expressed protein 29 5.9 At1g27090.1 68414.m03302 glycine-rich protein 29 5.9 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 29 5.9 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 24 7.7 At5g51680.1 68418.m06407 hydroxyproline-rich glycoprotein family... 28 7.8 At5g51300.2 68418.m06360 splicing factor-related contains simila... 28 7.8 At5g51300.1 68418.m06359 splicing factor-related contains simila... 28 7.8 At5g11550.1 68418.m01347 expressed protein 28 7.8 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 28 7.8 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 28 7.8 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 28 7.8 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 28 7.8 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 28 7.8 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 28 7.8 At1g02170.1 68414.m00145 latex-abundant family protein (AMC1) / ... 28 7.8 At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putat... 24 8.5 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 24 8.7 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 25 9.1 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 25 9.3 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 59.3 bits (137), Expect = 4e-09 Identities = 26/65 (40%), Positives = 28/65 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP P PP P P P +PPPPS PPP P P PP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVY 510 Query: 918 ARPXP 932 + P P Sbjct: 511 SPPPP 515 Score = 56.8 bits (131), Expect = 2e-08 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P PP P P PPPP P PPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPPPP P PP Sbjct: 499 PPPPPPPPPPVYSPPPPP 516 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/65 (38%), Positives = 26/65 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP P P P +PPPP PPP P PP Sbjct: 438 PPPP---PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPV 494 Query: 918 ARPXP 932 P P Sbjct: 495 YSPPP 499 Score = 52.0 bits (119), Expect = 6e-07 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPPP PP P PP P P P PPPP PPP P P PP Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP---PPPPPPPPPPVY 480 Query: 912 XXARPXP 932 P P Sbjct: 481 SPPPPSP 487 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/82 (32%), Positives = 28/82 (34%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP P P S PP P P PPP PPP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP---PPPVYSPPPPPPP 503 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 504 PPPPPVYSPPPPPVYSSPPPPP 525 Score = 51.2 bits (117), Expect = 1e-06 Identities = 27/67 (40%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP-PXXX 911 PPPP +PP PP PP P + P P PPPP PPP P P P P Sbjct: 475 PPPPVYSPP--PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPV 532 Query: 912 XXARPXP 932 RP P Sbjct: 533 YCTRPPP 539 Score = 50.8 bits (116), Expect = 1e-06 Identities = 35/120 (29%), Positives = 37/120 (30%), Gaps = 6/120 (5%) Frame = +2 Query: 593 PPXPGXPXXKNXSXXXXXXXXXXXXXXXXAXXPQXTPPPP---PXPXXKNXXXXXXXXXX 763 PP P P S + P +PPPP P P Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPV 598 Query: 764 XXXXXXPGXSXPPXGXPXPXXXPPPPLP---XXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S PP P P PPPP P PPP P PPPPP P PP Sbjct: 599 SSPPPTPVYSPPP---PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/64 (37%), Positives = 25/64 (39%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP PP PP P P P +PPPP PPP P P P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP---PPSPAPTPVYCTRPP 538 Query: 921 RPXP 932 P P Sbjct: 539 PPPP 542 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/64 (37%), Positives = 25/64 (39%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP PP +PP P P P PPP PPP P P PP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP----PVYSPPPPPVYSSP 521 Query: 921 RPXP 932 P P Sbjct: 522 PPPP 525 Score = 48.0 bits (109), Expect = 9e-06 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 6/84 (7%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL-PXXXPPPXPXX 877 PPPPP P S PP P P PPPP+ P PPP P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Query: 878 XXXXPP-----PPPRXXXGXPXPP 934 PP PPP P PP Sbjct: 598 VSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/82 (35%), Positives = 29/82 (35%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P T PPPP P P PP P P PPPP P PPP Sbjct: 421 PTLTSPPPPSPPPP-----------VYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P PP Sbjct: 470 PPP---PPPPPPVYSPPPPSPP 488 Score = 46.8 bits (106), Expect = 2e-05 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 10/93 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX-----GXPXPXXXPPPPLPXX 853 P PPPPP P P S PP P P PPPP P Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP-PVY 510 Query: 854 XPPPXPXXXXXXPPPPPR-----XXXGXPXPPH 937 PPP P PPP P P PPH Sbjct: 511 SPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPH 543 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/66 (37%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +PP PP +PP P P P PPP PPP P P PP Sbjct: 505 PPPPVYSPP-PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP----PQFSPPPPEPYY 559 Query: 915 XARPXP 932 + P P Sbjct: 560 YSSPPP 565 Score = 45.2 bits (102), Expect = 6e-05 Identities = 25/69 (36%), Positives = 27/69 (39%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPPP PP PP + P P P P PP PPP P P PP Sbjct: 535 TRPPPP---PPHSPPPPQFSPPP----PEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYP 587 Query: 912 XXARPXPXT 938 + P P T Sbjct: 588 YLSPPPPPT 596 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP P P PPP PPP P PP Sbjct: 431 PPPPVYSPPPPPPPP--PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Query: 918 ARPXP 932 P P Sbjct: 489 PPPPP 493 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXX---PPPXXXXPXXXPXPP 902 PPPP P R PP P P P +PPPP PPP P P PP Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPP 578 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/65 (33%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP P P PPPP PPP P PP Sbjct: 611 PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYS 670 Query: 918 ARPXP 932 + P P Sbjct: 671 SPPPP 675 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/69 (34%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY----PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPP +PP P PP P P P +PPPP PPP P P PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP---PPPPPVYSPPPPPPPPP 459 Query: 906 XXXXARPXP 932 P P Sbjct: 460 PPPVYSPPP 468 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +PP PP PP Y P PPPPS P P P P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ 549 Query: 915 XARPXP 932 + P P Sbjct: 550 FSPPPP 555 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P +PP PP PP P P PPPP PP P PP Sbjct: 602 PPTPVYSPPPPPPCIEPPPPPPCIEYSPP--PPPPVVHYSSPPPPPVYYSSPPPPPVYYS 659 Query: 918 ARPXP 932 + P P Sbjct: 660 SPPPP 664 Score = 41.9 bits (94), Expect = 6e-04 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P + P PP P PPP PPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPS 526 Query: 869 P---XXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P PP Sbjct: 527 PAPTPVYCTRPPPPP---PHSPPPP 548 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/70 (32%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 ++ P P P PP + PP P P +PPPPS PPP P P PP Sbjct: 390 RSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPS---PPPPVYSPPPPPPPPP 446 Query: 903 XXXXXARPXP 932 P P Sbjct: 447 PVYSPPPPPP 456 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +PP P P Y P P +PPPP PPP P PP Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ--FSPPPPEPYYYSSPPPP 566 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP + P PP P P P + PPP PPP P P Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Query: 918 ARPXP 932 P P Sbjct: 573 HSPPP 577 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/82 (28%), Positives = 25/82 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP S PP PPPP+ PPP Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPP 664 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P P Sbjct: 665 PPVHYSSPPPPEVHYHSPPPSP 686 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/91 (31%), Positives = 30/91 (32%), Gaps = 8/91 (8%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGX---SXPPXGXPXPXXX----PPPPLP 847 P +PPPPP P P S PP P P PPPP P Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Query: 848 XXXPPPXPXXXXXXPPPPPR-XXXGXPXPPH 937 PPP PPPP P PPH Sbjct: 543 HSPPPPQ------FSPPPPEPYYYSSPPPPH 567 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/81 (27%), Positives = 25/81 (30%) Frame = +2 Query: 692 QXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 + +PPPPP + S PP P PPPP PP Sbjct: 626 EYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPS 685 Query: 872 XXXXXXPPPPPRXXXGXPXPP 934 PPPPP PP Sbjct: 686 PVHYSSPPPPPSAPCEESPPP 706 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P P PP L PP P PPPPP PP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP P + S PP P PPP P P P Sbjct: 661 PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVH 720 Query: 884 XXPPPPPRXXXGXPXPP 934 PPPP P PP Sbjct: 721 HSPPPP--VIHQSPPPP 735 Score = 35.1 bits (77), Expect = 0.068 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP AP P PP P H P P + PPPP PPP P PP Sbjct: 692 PPPPPSAPCEESP----PPAPVVHHSPPPPMVHHSPPPPVIHQSPPP-PSPEYEGPLPP 745 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/77 (25%), Positives = 22/77 (28%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP + S PP PP P+ PPP P Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPC 700 Query: 884 XXPPPPPRXXXGXPXPP 934 PPP P PP Sbjct: 701 EESPPPAPVVHHSPPPP 717 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/79 (29%), Positives = 25/79 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPP P PP P PPPP+ PPP Sbjct: 671 SPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPA-PVVHHSPPPPMVHHSPPPP--V 727 Query: 878 XXXXPPPPPRXXXGXPXPP 934 PPPP G P PP Sbjct: 728 IHQSPPPPSPEYEG-PLPP 745 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLP-XXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPPP P PP PPPP P PP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPP 445 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 54.8 bits (126), Expect = 8e-08 Identities = 31/72 (43%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXE-GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GGG GGGG G G +G GG GG GG GGGG Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG--GGHYGGGGGHYGG 112 Query: 724 XGXGRGGGGXLG 689 G G GGGG G Sbjct: 113 GGGGHGGGGHYG 124 Score = 51.2 bits (117), Expect = 1e-06 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---G 761 G G GG G G GGG GGGG G G G GG GG G Sbjct: 56 GGGHGHGGHNGGGGH--GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 113 Query: 760 GAXXGGGGXVFXXGXGRGGGG 698 G GGGG G G GGGG Sbjct: 114 GGGHGGGGHYGGGGGGYGGGG 134 Score = 49.6 bits (113), Expect = 3e-06 Identities = 32/82 (39%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXX-GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G GGG GGGG G G +G GG GG GG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHY-GGGGGHYGGGG----GGHGGGG 121 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GGGG + G G GGG G Sbjct: 122 HYGGGGGGYGGGGGHHGGGGHG 143 Score = 45.2 bits (102), Expect = 6e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GG G G +G GG GG GG GGGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG--GGHYGGGGGHYGGG 99 Query: 721 GXGRGGGG 698 G GGGG Sbjct: 100 GGHYGGGG 107 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGGGG G GG G GGGG + G G GG Sbjct: 87 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 132 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGGGG G GG GGGG + G G GG Sbjct: 94 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGG 139 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGGGG G GG GGGG G G GG Sbjct: 80 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGG 125 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 G G GGGGG GGG GGGG G G Sbjct: 101 GHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGG G G GG G GGG G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGG 84 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGG--GGXFXGXGXP 805 G G GGGG G GGG G GG GG G P Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLNEP 147 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 54.4 bits (125), Expect = 1e-07 Identities = 31/81 (38%), Positives = 31/81 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG GGGG G G G G GG GG Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGA 247 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG G G G GGGG G Sbjct: 248 AGGYGG--GGGGGEGGGGSYG 266 Score = 53.6 bits (123), Expect = 2e-07 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GGG GGGG G G G GG GG GG Sbjct: 168 GGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Query: 751 XGGGGXVFXXGXGRG-GGGXLG 689 GGG G G G GGG G Sbjct: 228 AHGGGYGSGGGEGGGYGGGAAG 249 Score = 51.6 bits (118), Expect = 7e-07 Identities = 28/81 (34%), Positives = 29/81 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G GGG GGGG G G GG G GG+ Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSH 203 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G GG G G GGGG G Sbjct: 204 GGAGGYGGGGGGGSGGGGAYG 224 Score = 51.6 bits (118), Expect = 7e-07 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG EGGG G G GG GG GG Sbjct: 214 GGGSGGGGAYGGGGAHGGGYGSGGG----EGGGYGGGAAGGYGGGGGGGEGGGGSYGGEH 269 Query: 751 XGGGGXVFXXGXGRGGGG 698 GG G G G GGGG Sbjct: 270 GGGSGGGHGGGGGHGGGG 287 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + GG G G GG G GG G G G GGA GG GG Sbjct: 175 GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGS-GGGGAYGGGGAHGGGY 233 Query: 751 XGGGGXVFXXGXGRGGG 701 GGG G G GG Sbjct: 234 GSGGGEGGGYGGGAAGG 250 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GGG G G G GG G + GGG Sbjct: 110 GGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGG 169 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 170 GHGGGGGG 177 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/79 (34%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G G EGGG G G +G GG GG G A Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSA 180 Query: 754 XXGGGGXVFXXGXGRGGGG 698 GG + G G G GG Sbjct: 181 GGAHGGSGYGGGEGGGAGG 199 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/76 (36%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-----GXRGGAXXGG-GG 737 G G G G GGGG G G +G GG G G GGA G GG Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGG 162 Query: 736 XVFXXGXGRGGGGXLG 689 + G G GGGG G Sbjct: 163 GAYGGGGGHGGGGGGG 178 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGG G G GG GG GG GGGG Sbjct: 71 GGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGG----- 125 Query: 721 GXGRGGGGXLG 689 G G GGG G Sbjct: 126 GSGGGGGSAYG 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 28/81 (34%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + G G GG G GG G G G GG GG GG+ Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSG 188 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG G G GGGG G Sbjct: 189 YGGG-----EGGGAGGGGSHG 204 Score = 44.0 bits (99), Expect = 1e-04 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG GG G G G GG G GGA Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGA-GEGGGAGASGYGGGAY 165 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G G GG G Sbjct: 166 GGGGGHGGGGGGGSAGGAHGG 186 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG-GGGXVFXX 722 G G G GG GG G G G G G GG GG G GGG + Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Query: 721 GXGRGGG 701 G GGG Sbjct: 226 GGAHGGG 232 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG--GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF 728 GG G G GGG G GGG G G GGA G GG GGGG Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Query: 727 XXGXGRGGGGXLG 689 G GGG G Sbjct: 267 GEHGGGSGGGHGG 279 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/81 (35%), Positives = 32/81 (39%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + GG G G GG EG GG G + GG GG GGA Sbjct: 41 GGGGSGGVSSGGYGGESGGGYGGGSG---EGAGGGYGGA--EGYASGGGSGHGGGGGGAA 95 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG + G G GGGG G Sbjct: 96 SSGG---YASGAGEGGGGGYG 113 Score = 42.7 bits (96), Expect = 3e-04 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG--GXXXGXGXXXWGXGGARXXGGXRGG 758 G G G G G GGG GGG G G G GG GG GG Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG 205 Query: 757 A---XXGGGGXVFXXGXGRGGGGXLG 689 A GGGG G GGGG G Sbjct: 206 AGGYGGGGGGG-SGGGGAYGGGGAHG 230 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXX 749 G A G G G GG EGGGG G G GG GG G A Sbjct: 78 GYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGG-GSAYG 136 Query: 748 GGGGXVFXXGXGRGGGGXLG 689 GG G G G GG G Sbjct: 137 AGGEHASGYGNGAGEGGGAG 156 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/79 (31%), Positives = 26/79 (32%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G + GG G G GG GGG G G GG G GG G Sbjct: 55 GESGGGYGGGSGEGAGGGY-GGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYG 113 Query: 745 GGGXVFXXGXGRGGGGXLG 689 G G G G GG G Sbjct: 114 GAAGGHAGGGGGGSGGGGG 132 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/82 (32%), Positives = 28/82 (34%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G GG G G GGG G GGGG G G GG G Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGG--GGGGSGGGGAYG 224 Query: 753 XXXXXXGFFXXGXGGGGGVXWG 688 G + G G GGG G Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGG 246 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GGG G GG G G G G GG G G G G GGG Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90 Query: 700 G 698 G Sbjct: 91 G 91 Score = 36.7 bits (81), Expect = 0.022 Identities = 29/85 (34%), Positives = 29/85 (34%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G GGGG G GGG G GGG G G GG E G Sbjct: 213 GGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAA-GGYGGGGGGGEGGGGSYGGEHGG 271 Query: 753 XXXXXXGFFXXGXGGGGGVXWGXXA 679 G GGGGG G A Sbjct: 272 GS-------GGGHGGGGGHGGGGYA 289 Score = 35.5 bits (78), Expect = 0.051 Identities = 26/77 (33%), Positives = 28/77 (36%), Gaps = 2/77 (2%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE--XPGXXXXXXXXXXXXXXXGF 730 GGGGG G GG G GGG G G GG E G G Sbjct: 40 GGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGG 99 Query: 729 FXXGXGGGGGVXWGXXA 679 + G G GGG +G A Sbjct: 100 YASGAGEGGGGGYGGAA 116 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 GG G GGGG G G G G GG G G GG P Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 Score = 31.9 bits (69), Expect = 0.63 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGX---XXGRGGGGXFXGXGXPXGGXEXPGXXXXXX 763 GG G G G G GGG G GGGG G GG G Sbjct: 138 GGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGA 197 Query: 762 XXXXXXXXXGFFXXGXGGGGG 700 G + G GGG G Sbjct: 198 GGGGSHGGAGGYGGGGGGGSG 218 Score = 31.5 bits (68), Expect = 0.83 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -3 Query: 903 GGGGGXXXXXXGX-GGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFF 727 GGGGG G GGG GGGG G G G + Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYG 166 Query: 726 XXGXGGGGG 700 G GGGG Sbjct: 167 GGGGHGGGG 175 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG----GGGXFXGXGXPXGG 796 GG G G GG G G G G G GGG + G G GG Sbjct: 125 GGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGG 174 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGG G G G G GGG G G GG Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGG 71 Score = 29.1 bits (62), Expect = 4.4 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G GGG G GG GGG G G GG G Sbjct: 51 GGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGG---GGAASSGGYASGAGEG 107 Query: 753 XXXXXXGFFXXGXGGGGG 700 G GGGGG Sbjct: 108 GGGGYGGAAGGHAGGGGG 125 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXX 751 G G G GG G GG G G G G G G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGA 94 Query: 750 XXXXXGFFXXGXGGGGG 700 G GGGGG Sbjct: 95 ASSGGYASGAGEGGGGG 111 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/58 (41%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPP 902 PPPP +PP PP +PP P P P +PPPP PP P P P PP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/56 (42%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP P H P P +PPPP PP P P PP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP---PPVFSPPPP 578 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP P PP P P P PPP PPP P PP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPV 602 Query: 918 ARPXP 932 P P Sbjct: 603 HSPPP 607 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P PP P P P +PPPP PPP P PP Sbjct: 582 PPPPVHSPP-PPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 45.6 bits (103), Expect = 5e-05 Identities = 24/56 (42%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX-PXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP PP H P P +PPPP PPP P P PP Sbjct: 575 PPPPVYSPP--PPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP----PVYSPPPP 624 Score = 45.2 bits (102), Expect = 6e-05 Identities = 25/66 (37%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPPXXXX 914 PPPP +PP PP PP P P P +PPPP PP P P PP Sbjct: 561 PPPPVHSPP--PPVFSPPP-PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Query: 915 XARPXP 932 P P Sbjct: 618 VYSPPP 623 Score = 44.8 bits (101), Expect = 8e-05 Identities = 21/59 (35%), Positives = 26/59 (44%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 +++ PP P +PP PP P P P +PPPP PPP P P PP Sbjct: 515 RRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP--PPPVHSPPPP 571 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/83 (28%), Positives = 27/83 (32%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP P + P P P P PPPP+ PP Sbjct: 529 PVYSPPPPPPPVH-SPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVH 587 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 PPPP P P H Sbjct: 588 SPPPPVHSPPPPAPVHSPPPPVH 610 Score = 44.8 bits (101), Expect = 8e-05 Identities = 24/68 (35%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP +PP PP PP Y P P +PPPP PP P PP Sbjct: 536 PPPPVHSPP--PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 909 XXXARPXP 932 P P Sbjct: 594 HSPPPPAP 601 Score = 44.8 bits (101), Expect = 8e-05 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P PP H P P PPP PPP P PP Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP-PVFSPPPSQSPPVVYSPPP 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPPP P PP P PPPPP P PP Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVH---SPPPPPVYSPPPPPPP 564 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXP---PPPPRXXXGXPXPP 934 P P PPPP+ PPP P P PPPP P PP Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/55 (36%), Positives = 23/55 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP P P P +PP PP P PP Sbjct: 605 PPPPVHSPP-PPPPVYSPP-PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/92 (28%), Positives = 28/92 (30%), Gaps = 10/92 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX----GXPXPXXXPPPPL---- 844 P +PPPPP P P S PP P P PPPP+ Sbjct: 554 PVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP 613 Query: 845 --PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P PP P PP Sbjct: 614 PPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P P PPP P PPP PPPPP P P H Sbjct: 501 PQPDDPYDQSPVTKRRSPPPAPVNSPPPP----VYSPPPPPPPVHSPPPPVH 548 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/73 (28%), Positives = 23/73 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P S PP P P PPPP+ P Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP---PPPVYSPPPPVFSPPPSQS 633 Query: 869 PXXXXXXPPPPPR 907 P PP PP+ Sbjct: 634 PPVVYSPPPRPPK 646 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/69 (27%), Positives = 24/69 (34%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 K + P P+ P P P+ P PPP+ PPP P P PP Sbjct: 482 KPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPP----PVYSPPPPP 537 Query: 906 XXXXARPXP 932 + P P Sbjct: 538 PPVHSPPPP 546 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/74 (31%), Positives = 27/74 (36%), Gaps = 9/74 (12%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAP--------PYPHXXXPXPXXNPPPPSX-XXXPPPXXXXPXXX 890 P PP +P P ++P P P P P +PPPP PPP P Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSP--- 550 Query: 891 PXPPXXXXXARPXP 932 P PP P P Sbjct: 551 PPPPVYSPPPPPPP 564 Score = 33.1 bits (72), Expect = 0.27 Identities = 24/86 (27%), Positives = 27/86 (31%), Gaps = 4/86 (4%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL-PXXXPPP 865 P P P P ++ P P P P PPPP+ PPP Sbjct: 496 PPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHS---PPP 552 Query: 866 XPXXXXXXPPPP---PRXXXGXPXPP 934 P PPPP P P PP Sbjct: 553 PPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS-XXXXPPPXXXXPXXXPXPP 902 PPP PP PP P P + P PS PP P PP Sbjct: 640 PPPRPPKINSPPVQSPPPAPVEKKETPPAHAPAPSDDEFIIPPFIGHQYASPPPP 694 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G S P P P P P P P P P P P P P Sbjct: 415 GSSTPSKPSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSP 463 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/65 (24%), Positives = 19/65 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P P P P P P P +P P + P P P P P Sbjct: 432 PTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVDKPSPVPSRPV 491 Query: 918 ARPXP 932 +P P Sbjct: 492 QKPQP 496 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/64 (25%), Positives = 19/64 (29%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 P P P P P P P +P P + P P P P P Sbjct: 422 PSPVHKPTPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPVD 481 Query: 921 RPXP 932 +P P Sbjct: 482 KPSP 485 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/65 (38%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PPY + P P +PPPP PPP P PP Sbjct: 529 PPPPLSPPPPSPP----PPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYE 584 Query: 918 ARPXP 932 P P Sbjct: 585 QTPSP 589 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/67 (35%), Positives = 28/67 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP + P P P +PPPP P P P P PP Sbjct: 549 PPPPSPSPP--PPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYP--SPSPPYYQYT 604 Query: 918 ARPXPXT 938 + P P T Sbjct: 605 SSPPPPT 611 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/67 (35%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP--XXXXPXXXPXPPXXX 911 PPPP P PP P P P +PPPPS PPP P P PP Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPS---PPPPYIYSSPPPPSPSPPPPY 560 Query: 912 XXARPXP 932 + P P Sbjct: 561 IYSSPPP 567 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/69 (31%), Positives = 27/69 (39%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPP +P PP ++PP P +PPPPS PP P P Sbjct: 687 TQSPPP--SPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPV 744 Query: 912 XXARPXPXT 938 + P P T Sbjct: 745 TQSPPPPST 753 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/70 (28%), Positives = 24/70 (34%), Gaps = 1/70 (1%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 + T PPP P PP P + P P + PS PPP P PP Sbjct: 483 RATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPP 542 Query: 903 XXXXXARPXP 932 + P P Sbjct: 543 PYIYSSPPPP 552 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-----PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPPP P PP P P PPP P PP Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY--PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP + PP P Y P P PP + PPP P PP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 663 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPH-XXXPXPXXNPPPPS--XXXXPP--PXXXXPXXXPXPP 902 PPPP +P PP ++PP P P +PPPPS PP P P PP Sbjct: 718 PPPP--SPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPP 775 Score = 32.3 bits (70), Expect = 0.48 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K PPPP PP P PP P PPPP PPP P P Sbjct: 498 KAYPPPPP--PPEYEPSP--PPPSSEMSPSVRAYPPPPPL--SPPPPSPPPPYIYSSPPP 551 Query: 909 XXXARPXP 932 + P P Sbjct: 552 PSPSPPPP 559 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/65 (29%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP P P ++PP P +PPPP PP P P Sbjct: 647 PPPP---PVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQS 703 Query: 918 ARPXP 932 P P Sbjct: 704 PPPPP 708 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/65 (30%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP P PP ++PP P +PPPP P P P P Sbjct: 675 PPPPP--PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPP---PSPVYYPPV 729 Query: 918 ARPXP 932 A+ P Sbjct: 730 AKSPP 734 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS-------XXXXPPPXXXXPXXXPX 896 PPPP P PP +PP P +PPPP PPP P Sbjct: 632 PPPPP--PVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQS 689 Query: 897 PP 902 PP Sbjct: 690 PP 691 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAP----PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P PP PP P P PP + PPP P PP Sbjct: 663 PPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYY-PPVTQSPPPPPVYYLPVTQSPPP 720 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 741 PPPXXAPPRXP----PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP +PP P P ++PP P P PPP PP P P Sbjct: 698 PPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEY 757 Query: 909 XXXARP 926 A P Sbjct: 758 HPPASP 763 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX---PXPXXNPPPPSXXXXPPP 866 PPPP +P PP ++PP P P N PP PPP Sbjct: 733 PPPP--SPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 776 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPX----PXXXXXXPPPPPRXXXGXPXPPH 937 P P P PPP PPP P PPPP P PP+ Sbjct: 489 PSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPY 544 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS-------XXXXPPPXXXXPXXXPX 896 PPPP PP PP P P +PPPP PPP P Sbjct: 618 PPPPP--PPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSP 675 Query: 897 PP 902 PP Sbjct: 676 PP 677 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P T PPP P + S PP PPPP PPP Sbjct: 572 PPTTQSPPP-PKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPP-----PPPT 625 Query: 869 PXXXXXXPPPPP 904 PPPPP Sbjct: 626 YYAVQSPPPPPP 637 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +PP H P P PPP PP P PP Sbjct: 767 PPPEYQSPPPKGCNDSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPPP 821 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/65 (38%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PPY + P P +PPP PPP P P PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP--PPSPPYVYPP 446 Query: 918 ARPXP 932 P P Sbjct: 447 PPPSP 451 Score = 52.4 bits (120), Expect = 4e-07 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P P PP P P PPPP P PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP-PYVYPPPPPPYVYPPPP 438 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PPPP P PP Sbjct: 439 SPPYVYPPPPPSPQPYMYPSPP 460 Score = 51.6 bits (118), Expect = 7e-07 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP P P P P PPPP PPP P PP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPY 454 Query: 918 ARPXP 932 P P Sbjct: 455 MYPSP 459 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XPPXX 908 PPPP PP PP PP P P P P PP PPP P P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Query: 909 XXXARPXP 932 P P Sbjct: 440 PPYVYPPP 447 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P PPPP P PPP P PPPPP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP P P PPPPS P P P PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYV 443 Query: 918 ARPXP 932 P P Sbjct: 444 YPPPP 448 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P PP PP PP P P P PPPP PPP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPP---PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 Query: 918 ARPXP 932 P P Sbjct: 433 VYPPP 437 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPPP P PPP P PPPPP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPP----PPPPPPPYVYPSPPPPP 417 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXP-----PPXPXXXXXXPPPPPRXXXGXPXPPH 937 P PP P P PPPP P P PP P PPPPP P PP+ Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 +PP PP PP P P P PPPP PPP P P PP P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPP-----PPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P PPPP P PPP PPPP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPP PP PP PP P P P P PP P Sbjct: 429 PPPYVYPPPPSPPYVYPPPPPS---PQPYMYPSPPCNDLPTP 467 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 738 PPPPXXAP---PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP P P PP PP P P P P PP P Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLP 465 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/58 (37%), Positives = 26/58 (44%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 ++ PPPP +PP P PP P P P +PPPP PPP P PP Sbjct: 732 QSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 Score = 52.4 bits (120), Expect = 4e-07 Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPP----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP P P P +PPPPS PPP P P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/71 (36%), Positives = 30/71 (42%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPP----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XP 899 PPPP +PP PP +PP P P P +PPPP PPP P P P Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSP 751 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 752 PPPPVHSPPPP 762 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/65 (38%), Positives = 28/65 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP +PP P P P +PPPP PPP P PP Sbjct: 677 PPPPVHSPP--PPPVHSPPPPVHSPPPPVHSPPPP-VHSPPPPVHSPPPPVHSPPPPVQS 733 Query: 918 ARPXP 932 P P Sbjct: 734 PPPPP 738 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/65 (36%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP P P P +PPPP PP P PP Sbjct: 752 PPPPVHSPP--PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIY 809 Query: 918 ARPXP 932 + P P Sbjct: 810 SPPPP 814 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/59 (38%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPP----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP P P P +PPPP PPP P PP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P PP P + P P +PPPP PPP P PP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPP 782 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP PP H P P +PPPP PP P PP Sbjct: 663 PPPPMHSPP--PPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP PP P P P +PPPP PP P PP Sbjct: 670 PPPPVYSPP--PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/65 (36%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP H P P + PPP PPP P PP Sbjct: 685 PPPPVHSPP--PPVHSPPPPVH--SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVF 740 Query: 918 ARPXP 932 + P P Sbjct: 741 SPPPP 745 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/66 (36%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P +PP PP +PP P H P P +PPPP PP P PP Sbjct: 744 PPAPIYSPP--PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Query: 915 XARPXP 932 P P Sbjct: 802 PPPPSP 807 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/66 (37%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPPXX 908 PPPP +PP PP +PP P P P +PPPP PP P P P PP Sbjct: 759 PPPPVHSPP-PPPV-HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVF 816 Query: 909 XXXARP 926 +P Sbjct: 817 SPPPKP 822 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/67 (35%), Positives = 27/67 (40%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP +PP PP PP P P P +PPPP PPP P P Sbjct: 720 PPPPVHSPP--PPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Query: 912 XXARPXP 932 + P P Sbjct: 778 VHSPPPP 784 Score = 44.8 bits (101), Expect = 8e-05 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K T P P P PP +PP P P P +PPPP PP P PP Sbjct: 635 KTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XPPXXX 911 PPPP +PP PP PP H P PPPP PP P P PP Sbjct: 706 PPPPVHSPP--PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPV 763 Query: 912 XXARPXP 932 P P Sbjct: 764 HSPPPPP 770 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/66 (34%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSX-XXXPPPXXXXPXXXPXPPXXXX 914 PPPP +PP PP PP P P +PPPP+ PPP P P Sbjct: 713 PPPPVHSPP--PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Query: 915 XARPXP 932 P P Sbjct: 771 VHSPPP 776 Score = 43.6 bits (98), Expect = 2e-04 Identities = 32/130 (24%), Positives = 36/130 (27%), Gaps = 7/130 (5%) Frame = +3 Query: 564 PPPXGXXXXXPXPRGXPXXKTFXXXXXXXXXXXKXGRXRXXFPXXXXXXXXXXXKKTXPP 743 P P P P P + K G P KK P Sbjct: 566 PKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQ 625 Query: 744 PPXXAP-------PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP + P+ PP PP P P P PPP PPP P PP Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 903 XXXXXARPXP 932 + P P Sbjct: 686 PPPVHSPPPP 695 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX-PXXNPPPPSXXXXPPPXXXXP 881 PPPP +PP PP PP H P P +PPPP P P P Sbjct: 781 PPPPVHSPP--PPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLP 827 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 8/90 (8%) Frame = +2 Query: 689 PQXTPPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX---GXPXPXXXPPPPLP 847 P +PPPP P P P PP P P PPPP+ Sbjct: 666 PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVH 725 Query: 848 XXXPP-PXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPPP P PP Sbjct: 726 SPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP +PP P PP P P P +PPP PP Sbjct: 788 PPPPVHSPP-PPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 37.1 bits (82), Expect = 0.017 Identities = 29/90 (32%), Positives = 30/90 (33%), Gaps = 8/90 (8%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX--GXPXPXXXPPPPLPXXXPP 862 P +PPPPP P P S PP P P PPP P PP Sbjct: 643 PVHSPPPPP-PVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP-PVHSPP 700 Query: 863 P---XPXXXXXXPPPP---PRXXXGXPXPP 934 P P PPPP P P PP Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 36.7 bits (81), Expect = 0.022 Identities = 27/91 (29%), Positives = 30/91 (32%), Gaps = 9/91 (9%) Frame = +2 Query: 689 PQXTPPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P +PPPP P P ++ P P P PPPP P P Sbjct: 716 PVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP-PVHSP 774 Query: 860 PP---XPXXXXXXPPPP---PRXXXGXPXPP 934 PP P PPPP P P PP Sbjct: 775 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 36.7 bits (81), Expect = 0.022 Identities = 24/84 (28%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP PP P P PPP PPP Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPS 806 Query: 869 PXXXXXXP--PPPPRXXXGXPXPP 934 P P PPP+ P PP Sbjct: 807 PIYSPPPPVFSPPPKPV--TPLPP 828 Score = 35.9 bits (79), Expect = 0.039 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 4/87 (4%) Frame = +2 Query: 689 PQXTPPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXX 856 P +PPPP P P P PP P P PPPP P Sbjct: 702 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP--PAPIYSPPPP-PVHS 758 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPP PPPPP P P H Sbjct: 759 PPP----PVHSPPPPP--VHSPPPPVH 779 Score = 35.9 bits (79), Expect = 0.039 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P P PP P P PPP PPP Sbjct: 737 PPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP----PPVHSPPPPVHSPPPPVHSPPPPV 792 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PPP P PP Sbjct: 793 HSPPPPVHSPPPPSPIYSPPPP 814 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPP--XPXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PPP PPP P PPPPP P P H Sbjct: 651 PPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP--VHSPPPPVH 697 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P S PP P P PPPP+ PPP PPP P P H Sbjct: 643 PVHSPPP---PPPVHSPPPPV-FSPPPPMHSPPPPVYSPPPPVHSPPPPPVH 690 Score = 32.3 bits (70), Expect = 0.48 Identities = 26/91 (28%), Positives = 30/91 (32%), Gaps = 9/91 (9%) Frame = +2 Query: 689 PQXTPPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P +PPPP P P + P + P P PPPP+ P Sbjct: 709 PVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPV-HSPP 767 Query: 860 PP---XPXXXXXXPPPP---PRXXXGXPXPP 934 PP P PPPP P P PP Sbjct: 768 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/68 (27%), Positives = 23/68 (33%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 KT P P P+ + P P P P +P S PP P P PP Sbjct: 474 KTEQPKPKPESPKQESPKQEAPKPEQPKPKP-ESPKQESSKQEPPKPEESP--KPEPPKP 530 Query: 909 XXXARPXP 932 +P P Sbjct: 531 EESPKPQP 538 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/72 (25%), Positives = 19/72 (26%), Gaps = 2/72 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PP P +P PP P P P P P PP P P Sbjct: 524 KPEPPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPK 583 Query: 903 XXXXXARPXPXT 938 P T Sbjct: 584 PQPPKQEQPPKT 595 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 52.4 bits (120), Expect = 4e-07 Identities = 22/55 (40%), Positives = 24/55 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP PP P P P + PPP PPP P PP Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Score = 52.0 bits (119), Expect = 6e-07 Identities = 25/69 (36%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPP----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP +PP PP +PP P P P +PPPP PPP P PP Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Query: 906 XXXXARPXP 932 P P Sbjct: 612 PVYSPPPPP 620 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/65 (38%), Positives = 28/65 (43%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP +PP P P P +PPPP PPP P PP Sbjct: 529 PPPPVYSPP-PPPPVHSPPPPVHSPPPPVHSPPPP-VHSPPPPVHSPPPPVHSPPPPVYS 586 Query: 918 ARPXP 932 P P Sbjct: 587 PPPPP 591 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/63 (36%), Positives = 27/63 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP +PP P P P +PPPP PP P PP Sbjct: 609 PPPPVYSPP-PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVY 667 Query: 918 ARP 926 + P Sbjct: 668 SPP 670 Score = 48.8 bits (111), Expect = 5e-06 Identities = 23/65 (35%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP + P P +PPPP PP P PP Sbjct: 566 PPPPVHSPP--PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVH 623 Query: 918 ARPXP 932 + P P Sbjct: 624 SPPPP 628 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/70 (34%), Positives = 28/70 (40%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPP-----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP P P P +PPPP PPP P P Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSP 639 Query: 903 XXXXXARPXP 932 + P P Sbjct: 640 PPPVYSPPPP 649 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 +++ PPPP +PP P PP P P P +PPPP PPP P P P Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPP--PPPVHSPPP 547 Query: 900 P 902 P Sbjct: 548 P 548 Score = 48.0 bits (109), Expect = 9e-06 Identities = 23/65 (35%), Positives = 26/65 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP + P P + PPP PPP P PP Sbjct: 595 PPPPVHSPP--PPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYS 652 Query: 918 ARPXP 932 P P Sbjct: 653 PPPPP 657 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/65 (36%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP P PP P P P +PPPP PPP P PP Sbjct: 602 PPPPVHSPP-PPVYSPPPPPPVHSPPPPVFSPPPP-VHSPPPPVYSPPPPVYSPPPPPVK 659 Query: 918 ARPXP 932 + P P Sbjct: 660 SPPPP 664 Score = 46.0 bits (104), Expect = 4e-05 Identities = 27/76 (35%), Positives = 30/76 (39%), Gaps = 9/76 (11%) Frame = +3 Query: 738 PPPPXX-APP----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--- 893 PPPP +PP PP +PP P P P +PPPP PPP P P Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKM 676 Query: 894 -XPPXXXXXARPXPXT 938 PP P P T Sbjct: 677 SSPPTQTPVNSPPPRT 692 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP H P PPPP PP P PP Sbjct: 559 PPPPVHSPP--PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 616 Query: 918 ARPXP 932 P P Sbjct: 617 PPPPP 621 Score = 45.2 bits (102), Expect = 6e-05 Identities = 24/68 (35%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP---HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP +PP PP PP P P P +PPPP PPP P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP--VHSPPPPVHSPPPPVHSPPP 568 Query: 909 XXXARPXP 932 + P P Sbjct: 569 PVHSPPPP 576 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P PP N P PP P P PPPP P PPP Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPP--PSPIHSPPPP-PVYSPPPP 521 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPPP P P H Sbjct: 522 PPVYS-PPPPPPVYSPPPPPPVH 543 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 6/64 (9%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPP------YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXX 890 K+ PPPP +PP PP +PP P P PPPS PP Sbjct: 659 KSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYAS 718 Query: 891 PXPP 902 P PP Sbjct: 719 PPPP 722 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/85 (30%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPX--PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P +PPPPP P P P P P PPPP+ PP Sbjct: 583 PVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Query: 863 P-XPXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P PP Sbjct: 643 VYSPPPPVYSPPPPP--VKSPPPPP 665 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 9/88 (10%) Frame = +2 Query: 698 TPPPPPX---PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP- 865 +PPPPP P P S PP P P PPPP P PPP Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPP---PPPVYSPPPPPPVHSPPPP 548 Query: 866 --XPXXXXXXPPPP---PRXXXGXPXPP 934 P PPPP P P PP Sbjct: 549 VHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 37.9 bits (84), Expect = 0.010 Identities = 30/94 (31%), Positives = 32/94 (34%), Gaps = 11/94 (11%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX--GXPXPXXXPPPPL------ 844 P +PPPPP P P S PP P P PPPP+ Sbjct: 532 PVYSPPPPP-PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 590 Query: 845 PXXXPPPXPXXXXXXP---PPPPRXXXGXPXPPH 937 P PPP P P PPPP P P H Sbjct: 591 PVHSPPP-PVHSPPPPVHSPPPPVYSPPPPPPVH 623 Score = 37.9 bits (84), Expect = 0.010 Identities = 29/95 (30%), Positives = 31/95 (32%), Gaps = 13/95 (13%) Frame = +2 Query: 689 PQXTPPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX---GXPXPXXXPPPPLP 847 P +PPPP P P P S PP P P PPPP+ Sbjct: 548 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVH 607 Query: 848 XXXPP---PXPXXXXXXPPPP---PRXXXGXPXPP 934 PP P P PPPP P P PP Sbjct: 608 SPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 6/88 (6%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP- 865 P PPPP P P P P P PP P PPP Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Query: 866 --XPXXXXXXPPPP---PRXXXGXPXPP 934 P PPPP P P PP Sbjct: 556 VHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP----YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP ++PP Y P +PP + PPP PP Sbjct: 646 PPPPVYSPP--PPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPP 702 Score = 35.1 bits (77), Expect = 0.068 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 16/80 (20%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAP-----PYPHXXXPXP-----------XXNPPPPSXXXXPPPXX 872 PPP +PP PP P P P P P +PPPP PPP Sbjct: 447 PPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPP-- 504 Query: 873 XXPXXXPXPPXXXXXARPXP 932 P P PP P P Sbjct: 505 -SPIHSPPPPPVYSPPPPPP 523 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX--GXPXPXXXPPPPLPXXXPP 862 P +PPPPP P P S PP P P PPP P PP Sbjct: 612 PVYSPPPPP-PVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 Query: 863 PXPXXXXXXPPPPP 904 P P P Sbjct: 671 LLPPKMSSPPTQTP 684 Score = 31.5 bits (68), Expect = 0.83 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP---PPRXXXGXPXPPH 937 P S PP P PP P PPP P PPP PP P P H Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSP---PPPPPVYSPPPPPPVHSPPPPVHSPPPPVH 557 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXP----PPXPXXXXXXPPPPPRXXXGXPXPPH 937 P S P P P P PP P P PPPPP P P H Sbjct: 453 PPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIH 508 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP P PP P P PPPP PPP P PP Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYP 173 Query: 918 ARPXPXT 938 P P T Sbjct: 174 PPPKPET 180 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/69 (34%), Positives = 27/69 (39%), Gaps = 2/69 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX--NPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP P PP + PP P+ P P PPPP+ PPP P P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 Query: 912 XXARPXPXT 938 P P T Sbjct: 149 PVVTPPPPT 157 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/67 (35%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX--NPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP P PP + PP P P P PPPP+ PPP P P P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPC 164 Query: 912 XXARPXP 932 P P Sbjct: 165 PPPPPTP 171 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/70 (37%), Positives = 28/70 (40%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX--NPPPPSXXXXPPP---XXXXPXXXPXPP 902 PPPP P PP + PP P P P PPPP+ PPP P P PP Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Query: 903 XXXXXARPXP 932 A P P Sbjct: 157 TPTPEA-PCP 165 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/67 (37%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP P PP + PP P+ P P PPPP PPP P P PP Sbjct: 76 PPPPYTPK--PPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP---PPPPTPYTP 130 Query: 918 ARPXPXT 938 P P T Sbjct: 131 PPPTPYT 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 P PP PP PP + PP P+ P P P PP+ PPP P P Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPP-PYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPP 107 Query: 909 XXXARPXP 932 +P P Sbjct: 108 PPYVKPPP 115 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXPXXXPXP 899 P PP PP PP + PP P P P PPPP PPP P P Sbjct: 82 PKPPTVKPP-PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PP A P PP + P H P P PPPP PPP P PP Sbjct: 41 PPKHPAKPPKPPTVKPPT--HTPKP-PTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Query: 921 RPXP 932 P P Sbjct: 98 PPPP 101 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 1/68 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSX-XXXPPPXXXXPXXXPXPPXXXX 914 P PP PP PP PP P+ P PPPP PP P PP Sbjct: 61 PKPPTVKPP--PPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPT 118 Query: 915 XARPXPXT 938 P P T Sbjct: 119 VKPPPPPT 126 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP PP P PP P P P PPPP+ PP P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCP---PPPPTPYPPPPKPETCP 182 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP----PPPSXXXXPPP 866 T PPP PP PP + PP P P P P PPP PPP Sbjct: 129 TPPPPTPYTPP--PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PP P PP P PP P P PPPP+ P P P PP Sbjct: 120 KPPPPPTPYTPPP--PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 35.9 bits (79), Expect = 0.039 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 5/83 (6%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX---PPPPLPXXXPPPXP 871 PPPP P PP P P PPPP P PPP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Query: 872 XXXXXXP--PPPPRXXXGXPXPP 934 PPPP P P Sbjct: 136 YTPPPPTVKPPPPPVVTPPPPTP 158 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP--XPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P PPP PPP P PPPPP P PP Sbjct: 51 PPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP--YVKPPPPP 101 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +2 Query: 800 PXGXPXPXXXPPP---PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PP P P PP P PP P+ P PP Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP 92 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 52.0 bits (119), Expect = 6e-07 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGG-XXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G GGG EGGGG G G G GG GG R G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 156 Query: 754 XXGGGGXVFXXGXGRGGGG 698 GGG G GGGG Sbjct: 157 GGYGGGEGGGYGGSGGGGG 175 Score = 46.0 bits (104), Expect = 4e-05 Identities = 28/67 (41%), Positives = 29/67 (43%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GGG GGGG G G +G GG R GG GG GGGG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGS--YGGGGGRREGG--GGYSGGGGGYSSRGG 143 Query: 718 XGRGGGG 698 G GG Sbjct: 144 GGGSYGG 150 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GG GGGG G G G GG GG GG Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG--GGGS 147 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG G G G GG G Sbjct: 148 YGGGRREGGGGYGGGEGGGYG 168 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/66 (42%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR---GGAXXGGGGXVFXXGXGRGGGGX 695 GGG GGGG G G G GG+ GG R GG GGGG G GGGG Sbjct: 91 GGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG---GGGGS 147 Query: 694 LGXXXR 677 G R Sbjct: 148 YGGGRR 153 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXG---GGXXXGRGGGGXFXGXGXPXGG 796 G G RGGGGG G G GG G GGG G G GG Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 135 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -3 Query: 933 GGXGXPXXXRG--GGGGXXXXXXGXGGGXXXGR--GGGGXFXGXGXPXGG 796 GG G G GGGG G GG GR GGGG G G GG Sbjct: 120 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG 169 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RG GGG G GGG G GGGG G G GG Sbjct: 87 RGSGGGGGHRGGG-GGGYRSG-GGGGYSGGGGSYGGG 121 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGGG GGG G GGG G G Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 29.5 bits (63), Expect = 3.4 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 4/82 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXG----RGGGGXFXGXGXPXGGXEXPGXXXXX 766 GG G GGG G GGG G GGGG + G GG G Sbjct: 98 GGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRG--GGGGSYGGGRREG 155 Query: 765 XXXXXXXXXXGFFXXGXGGGGG 700 G+ G GGGGG Sbjct: 156 GGGYGGGEGGGY--GGSGGGGG 175 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 787 ARXXGGXRGGAXXGGGGXVFXXGXG---RGGGGXLG 689 A+ G GG GGGG + G G GGGG G Sbjct: 84 AQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYG 119 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR-APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP +PP+ P P +PPPPS P P P PP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPP 88 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPP--XXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP P PP PP PH P P P PP P P PP Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVL 84 Query: 912 XXARPXP 932 P P Sbjct: 85 PPPPPTP 91 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = +2 Query: 689 PQXTP-PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 P +P PPPP P PP P P PP P P PP Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPP 78 Query: 866 XPXXXXXXPPPPP 904 P PPP P Sbjct: 79 PPPHVLPPPPPTP 91 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PP P P PP P PP P P PPP Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Query: 869 -PXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P P Sbjct: 69 SPYPHPHQPPPPPHVLPPPPPTP 91 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +2 Query: 818 PXXXPPP---PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P PP PLP PPP PPPPP P PPH Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHI---SPPPPPFSPPHHPPPPH 48 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/69 (42%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGG-XXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GGG EGGGG G G G GG GG R G GGG Sbjct: 90 GGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Query: 724 XGXGRGGGG 698 G GGGG Sbjct: 150 YGGSGGGGG 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/77 (37%), Positives = 30/77 (38%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG GGG G G +G GG R GG GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG-GGRREGGGGYGGGE 146 Query: 751 XGGGGXVFXXGXGRGGG 701 GG G G G GGG Sbjct: 147 GGGYG-----GSGGGGG 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/59 (38%), Positives = 25/59 (42%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G GGG G G G GG GG G + GGGG + G GGGG G Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGG--YSGGGGGYSSRGGGGGSYGGGRREGGGGYGG 144 Score = 36.3 bits (80), Expect = 0.029 Identities = 24/55 (43%), Positives = 25/55 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 GGGG G G +G GG R GG G GGGG G GGGG G R Sbjct: 90 GGGGGHRGGGS--YGGGGGRREGG---GGYSGGGGGYSSRG---GGGGSYGGGRR 136 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGX--GGGXXXGRGGGGXFXGXGXPXGG 796 GG GGGGG G GGG RGGGG G G GG Sbjct: 92 GGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 139 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -3 Query: 933 GGXGXPXXXRG--GGGGXXXXXXGXGGGXXXGR--GGGGXFXGXGXPXGG 796 GG G G GGGG G GG GR GGGG G G GG Sbjct: 103 GGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG 152 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 1/73 (1%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFF 727 RG GGG G GG R GGG + G G G G Sbjct: 87 RGSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGE 146 Query: 726 XXGXGG-GGGVXW 691 G GG GGG W Sbjct: 147 GGGYGGSGGGGGW 159 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGGG GGG G GGG G G Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/65 (38%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP PP PP APP P P +PPP S PPP P P PP Sbjct: 79 PPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEP---PPPPADEDE 135 Query: 918 ARPXP 932 + P P Sbjct: 136 SPPAP 140 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/65 (33%), Positives = 25/65 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP APP PP +PP P +PPP PPP P P P Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSP--PPPPDLTPPP 87 Query: 918 ARPXP 932 + P P Sbjct: 88 SSPPP 92 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP + P PP +PP P P P +PPPP PP P PP + Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTP-PPSSPPPPD--APPPIPIVFPPPIDSPPPESTNS 117 Query: 921 RPXP 932 P P Sbjct: 118 PPPP 121 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP--XPXXXXXXPPPPPRXXXGXPXP 931 P + PP P P PPP+P PPP P PPPP P P Sbjct: 81 PDLTPPPSSPPPPDA--PPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPP 130 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP P P PP P P + PPP PPP P P P Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/93 (27%), Positives = 28/93 (30%), Gaps = 8/93 (8%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX------PXPXXXPPP- 838 A P + PPP P + P S PP P P PPP Sbjct: 29 APPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPS 88 Query: 839 -PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPP P PP P PP Sbjct: 89 SPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP P P P P +PP PS PP Sbjct: 140 PPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPP 182 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/53 (35%), Positives = 22/53 (41%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +PP P +PP P P PPPP+ PP P P P Sbjct: 104 PPPIDSPP--PESTNSPPPPEVFEP-----PPPPADEDESPPAPPPPEQLPPP 149 Score = 35.5 bits (78), Expect = 0.051 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = +2 Query: 689 PQXTPPP--PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P TPPP PP P S PP P PPPP P Sbjct: 81 PDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP---PEVFEPPPPPADEDESP 137 Query: 863 PXPXXXXXXPPPPPRXXXGXPXP 931 P P PPP G P Sbjct: 138 PAPPPPEQLPPPASSPQGGPKKP 160 Score = 33.1 bits (72), Expect = 0.27 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXP-PXGXPXPXXXPPPPLPXXXPPP 865 P PPP P + P P P P P PPP PP Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPE--STNSPP 119 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 120 PPEV-FEPPPPPADEDESPPAPP 141 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPP + P PP P PPPP PPP Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP---PESTNSPPPPEVFEPPPPPADED 134 Query: 881 XXXPPPPP 904 P PPP Sbjct: 135 ESPPAPPP 142 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP--PXXXXPXXXPXPPX 905 PPPP PP +PP P P P PPP S P P P PP Sbjct: 118 PPPPEVFEPPPPPADEDESPPAP----PPPEQLPPPASSPQGGPKKPKKHHPGPATSPPA 173 Query: 906 XXXXARPXP 932 A P Sbjct: 174 PSAPATSPP 182 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 49.6 bits (113), Expect = 3e-06 Identities = 25/58 (43%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP PP PP P P P +PPPPS PPP P P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP----PSHSPPPP 628 Score = 48.8 bits (111), Expect = 5e-06 Identities = 26/66 (39%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPH-XXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +PP PP +PP PH P P +PPPPS PPP P P Sbjct: 552 PPPPVHSPP--PPVYSSPPPPHVYSPPPPVASPPPPS---PPPPVHSPPPPPVFSPPPPV 606 Query: 915 XARPXP 932 + P P Sbjct: 607 FSPPPP 612 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/55 (38%), Positives = 23/55 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P PP P P +PPPPS PP P PP Sbjct: 587 PPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP +P P PP H P +PPPP PPP P P PP Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 + PP P P P +PP P P P + PPP PPP P P PP Sbjct: 532 RVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP-PPPSPPPP 590 Query: 909 XXXARPXP 932 P P Sbjct: 591 VHSPPPPP 598 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP R PP PP P P P +PPPP PP P P Sbjct: 523 PPPPKVEDTRVPPP--QPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVA 580 Query: 918 ARPXP 932 + P P Sbjct: 581 SPPPP 585 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 6/60 (10%) Frame = +3 Query: 738 PPPPXXAPP------RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +PP PP +PP P P P +PPP PP P P P Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMGAPTPTQAPTP 661 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP P S PP P P PPPP P PPP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP-PVFSPPP-----P 605 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPP P P H Sbjct: 606 VFSPPPPSPVYSPPPPSH 623 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P PP P P P +PPPP PP P P Sbjct: 595 PPPPVFSPP-PPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQP 648 Score = 36.7 bits (81), Expect = 0.022 Identities = 25/88 (28%), Positives = 27/88 (30%), Gaps = 6/88 (6%) Frame = +2 Query: 689 PQXTPPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX--GXPXPXXXPPPPLPX 850 P +PPPP P P + P S PP P P PPP Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVF 607 Query: 851 XXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP P P P P PP Sbjct: 608 SPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPP----PXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PPPP+ PP P P PPP P PP Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXP---PPPPRXXXGXPXPPH 937 PP PPP P P PP P P PPPP P PPH Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPP--VYSSPPPPH 571 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/82 (25%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX-PXPXXXPPPPLPXXXPPP 865 P +PPPPP P S PP P P PPP PP Sbjct: 590 PVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPP 649 Query: 866 XPXXXXXXPPPPPRXXXGXPXP 931 P P P P Sbjct: 650 MGAPTPTQAPTPSSETTQVPTP 671 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 48.4 bits (110), Expect = 7e-06 Identities = 27/68 (39%), Positives = 28/68 (41%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GG G G +G GG GG GG GGGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG--GGHYGGGGGHYGGG 99 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 100 GGGYGGGG 107 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/75 (40%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXGG-GXXXXEGGGGXXX---GXGXXXWGXGGARXXGGXRGGAXXGGGGX 734 GG G G GG G GGGG G G +G GG GG GG GGGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHY-GG--GGGHYGGGGG 101 Query: 733 VFXXGXGRGGGGXLG 689 + G G GGG G Sbjct: 102 GYGGGGGHHGGGGHG 116 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -2 Query: 865 GGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG G GGG G G G GG G GG GGGG + G G GGG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHN-GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 Score = 38.7 bits (86), Expect = 0.005 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG GGGG G G G GG GG GG Sbjct: 56 GGGHGHGGHNGGGGH--GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG--YGG--GGGH 109 Query: 751 XGGGG 737 GGGG Sbjct: 110 HGGGG 114 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGX--GGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GGGG G G GG Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGG G GGG G GGG + G G GG Sbjct: 55 GGGGHGHGGHNGGGGHGLDGYGGGGGHYGG--GGGHYGGGGGHYGG 98 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG-GXFXGXGXPXGG 796 GG G GGGG G GG G GGG G + G G GG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGG 91 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFFX 724 GGG G G GG G GGG G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG---G 100 Query: 723 XGXGGGGG 700 G GGGGG Sbjct: 101 GGYGGGGG 108 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 48.4 bits (110), Expect = 7e-06 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 8/80 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX----GXPXPXXXPPPPLPXXX 856 P PPPPP P N P PP P P PPPP P Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPP 602 Query: 857 PPPXP----XXXXXXPPPPP 904 PPP P PPPPP Sbjct: 603 PPPPPSSRSIPSPSAPPPPP 622 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP P PP P P PPPP P P P PP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 44.4 bits (100), Expect = 1e-04 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL-PXXXPPP 865 P TPPPPP P K S G P P PPPPL PPP Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPP---SSTRLGAPPPP--PPPPLSKTPAPPP 730 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP G P Sbjct: 731 PPLSKTPVPPPPPGLGRGTSSGP 753 Score = 42.3 bits (95), Expect = 4e-04 Identities = 28/87 (32%), Positives = 28/87 (32%), Gaps = 5/87 (5%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSX--PPXGXPXPXXXPPPPLPXXXPP 862 P PPPPP P P S P P PPP P PP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPP-PPPPPP 580 Query: 863 PXPXXXXXXP---PPPPRXXXGXPXPP 934 P P P PPPPR P PP Sbjct: 581 PLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP R+ P P P P PPPPS P P PP Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPP---PPPPSFGSTGNKRQAQPPPPPPPP 646 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 ++ PPP PP PP PP P P PPPP PPP Sbjct: 585 RSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP----PPPP 626 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +2 Query: 680 AXXPQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 A P PPPPP P + P S G PPPP P P Sbjct: 592 AQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP--SFGSTGNKRQAQPPPPP-PPPPP 648 Query: 860 PPXPXXXXXXPPPPP 904 P PPPPP Sbjct: 649 TRIPAAKCAPPPPPP 663 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP P R P P P P PP PS PP P P PP Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Query: 909 XXXARPXP 932 +R P Sbjct: 606 PPSSRSIP 613 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P G P PPPP P P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPP 699 Query: 881 XXXPPPPPRXXXGXPXPP 934 P PP G P PP Sbjct: 700 APPPLPPSSTRLGAPPPP 717 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 5/84 (5%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPP-----PLPXXXPP 862 TPPPPP P P + PP P P PPP P P PP Sbjct: 571 TPPPPPPPPPP----------LPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP 620 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P P R P PP Sbjct: 621 PPPPPPSFGSTGNKRQAQPPPPPP 644 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/76 (28%), Positives = 22/76 (28%), Gaps = 3/76 (3%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL---PXXXPPPXP 871 P PPP P P PP P PPP L PPP Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKT-PVPPPPPGLGRGTSSGPPPLG 757 Query: 872 XXXXXXPPPPPRXXXG 919 PPPPP G Sbjct: 758 AKGSNAPPPPPPAGRG 773 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-XXXPXPPX 905 + PP PP PP P P P PP + PPP P P PP Sbjct: 673 RVGPPSTPPPPPPPPPKANISNAPKPPAPPPL--PPSSTRLGAPPPPPPPPLSKTPAPPP 730 Query: 906 XXXXARPXP 932 P P Sbjct: 731 PPLSKTPVP 739 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP----SXXXXPPPXXXXPXXXPXPP 902 PPPP P P PP P P P PPPP PPP P PP Sbjct: 714 PPPPPPPPLSKTP--APPPPPLSKTPVP---PPPPGLGRGTSSGPPPLGAKGSNAPPPP 767 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 6/74 (8%) Frame = +3 Query: 729 KTXPPPPXXAPP------RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXX 890 K PPPP P R P PP P N P P PP Sbjct: 655 KCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAP 714 Query: 891 PXPPXXXXXARPXP 932 P PP P P Sbjct: 715 PPPPPPPLSKTPAP 728 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPPPL P PPPPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 9/90 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXP---------GXSXPPXGXPXPXXXPPPP 841 P PPPPP P P S PP P P P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDP 560 Query: 842 LPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 L P PPPPP P P Sbjct: 561 LTTLHQPINKTPPPPPPPPPPLPSRSIPPP 590 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K PPP + R PP P P P PPP S PPP Sbjct: 697 KPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP--PPPLSKTPVPPP 741 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP + P P PPPP P P PP Sbjct: 482 PPPP---PPPPPPLFTSTTSFSPSQPPPPP-PPPPLFMSTTSFSPSQPPPPPPPP 532 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 48.0 bits (109), Expect = 9e-06 Identities = 32/83 (38%), Positives = 32/83 (38%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V G GR GG G G GG GGGG G G G G GG RG Sbjct: 460 VGGGGRGSGGAGGGTGGSVG----AGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGA 515 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GG V G GRG GG G Sbjct: 516 VGGAVGGGV--GGAGRGSGGASG 536 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GGG GG G G G G GG GGA Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAG 102 Query: 751 XGGGGXVFXXGXGRGGG 701 GG G G G GGG Sbjct: 103 GGGKGRGRKGGGGAGGG 119 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWG--XGGARXXGGXRG 761 G GR G G G GGG G GGG G G G GG G RG Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG 164 Query: 760 GAXXGGGGXVFXXGXGRGGG 701 G GG G G G GGG Sbjct: 165 GKSGGGAGGGVGGGVGAGGG 184 Score = 46.4 bits (105), Expect = 3e-05 Identities = 33/81 (40%), Positives = 33/81 (40%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G GG GGG G G G GGA GG GGA Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGG---GVGGA--VGGAVGGAV 370 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G GRG GG G Sbjct: 371 GGGGGG-SVGGGGRGSGGASG 390 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/82 (36%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G G G GG G G G GG + GG GG Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Query: 751 XGG-GGXVFXXGXGRGGGGXLG 689 GG GG V G G G GG +G Sbjct: 172 GGGVGGGV---GAGGGAGGSVG 190 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/86 (37%), Positives = 33/86 (38%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWG-----XGGARXXGGX 767 G G A G G G GGG GGG G G G GGA GG Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGA--VGGG 523 Query: 766 RGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGA G GG G G G GG +G Sbjct: 524 VGGAGRGSGGASGGAGAGGGAGGGVG 549 Score = 45.6 bits (103), Expect = 5e-05 Identities = 32/85 (37%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGX--GXXXWGXGGA--RXXGGXR 764 G G + GG G G GG G GG G G G GG+ GG Sbjct: 239 GAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAV 298 Query: 763 GGAXXGGGGXVFXXGXGRGGGGXLG 689 GGA GGGG G GRG GG G Sbjct: 299 GGAVGGGGGG-SVGGGGRGSGGASG 322 Score = 45.2 bits (102), Expect = 6e-05 Identities = 32/91 (35%), Positives = 34/91 (37%), Gaps = 6/91 (6%) Frame = -2 Query: 931 GXGRAXXXXXGGX--GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G G GG G G GG + GGG G G GGA G GG Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Query: 757 AXXGGGGXVFXXGXG----RGGGGXLGXXXR 677 GGGG V G G GGGG +G R Sbjct: 195 IGSGGGGTVGAGGRGSGGASGGGGTVGAGGR 225 Score = 44.8 bits (101), Expect = 8e-05 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GR G G G GGG G GG G G G GG GG G Sbjct: 160 GKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGG---GIGS---GGGGTVGAGGRGSGGA 213 Query: 751 XGGGGXVFXXGXGRGG-GGXLG 689 GGGG V G G GG G +G Sbjct: 214 SGGGGTVGAGGRGSGGASGGVG 235 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/90 (35%), Positives = 33/90 (36%), Gaps = 5/90 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG--GXXXGXGXXXWGXGGARXXGGXRGG 758 G G G G GGG GGG G G G G G GG GG Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGG 178 Query: 757 AXXGG--GGXV-FXXGXGRGGGGXLGXXXR 677 GG GG V G G GGGG +G R Sbjct: 179 VGAGGGAGGSVGAGGGIGSGGGGTVGAGGR 208 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/79 (40%), Positives = 32/79 (40%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G A GG G GG GG G G G G GGA GG GGA G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGG-GVGGA--VGGAVGGAVGG 454 Query: 745 GGGXVFXXGXGRGGGGXLG 689 GGG G GRG GG G Sbjct: 455 GGGGSVGGG-GRGSGGAGG 472 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/81 (33%), Positives = 29/81 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + GG G G GG GGG G G G GG +G Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVG---AGGGVGGGAGGAIGGGASGGAGGGGKGRGR 110 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G G G GG G Sbjct: 111 KGGGGAGGGVGGGVGAGGGAG 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXX-EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GG GGG G G G GGA G GGA GGG V Sbjct: 193 GGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGR--GSGGASGGVGVGGGAGGSGGGSVGG 250 Query: 724 XGXGRGGGGXLG 689 G G GG G G Sbjct: 251 GGRGSGGVGASG 262 Score = 43.6 bits (98), Expect = 2e-04 Identities = 29/83 (34%), Positives = 30/83 (36%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V GR GG G G GGG GGGG G G GG GG GG Sbjct: 220 VGAGGRGSGGASGGVGVGGGAGGSGGGSV---GGGGRGSGGVGASGGAGGNVGAGGGLGG 276 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GG G G GG +G Sbjct: 277 GVGGGVGGGVGGSVGGAVGGAVG 299 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/88 (31%), Positives = 29/88 (32%), Gaps = 1/88 (1%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXX-GGXRG 761 V G GR GG GG GG G G G GG GG G Sbjct: 378 VGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVG 437 Query: 760 GAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 G G G G GGGG +G R Sbjct: 438 GGVGGAVGGAVGGAVGGGGGGSVGGGGR 465 Score = 43.6 bits (98), Expect = 2e-04 Identities = 30/85 (35%), Positives = 32/85 (37%), Gaps = 2/85 (2%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXG-GXR 764 V G GG G G G G GGGG G G G GG G Sbjct: 422 VGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAG 481 Query: 763 GGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GGGG + G G G GG +G Sbjct: 482 GGVGVGGGGGI-GGGAGGGVGGGVG 505 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/83 (33%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGX--GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G G GG G G GG +GGGG G G GGA G GG Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 G GG + G GGG G Sbjct: 140 IGGGAGGAIGGGASGGVGGGGKG 162 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/71 (42%), Positives = 31/71 (43%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G GGGG G G G GGA GG GGA G GG V Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGR--GSGGAS--GGASGGASGGAGGSV--- 336 Query: 721 GXGRGGGGXLG 689 G G G GG +G Sbjct: 337 GAGGGVGGGVG 347 Score = 43.2 bits (97), Expect = 3e-04 Identities = 33/81 (40%), Positives = 34/81 (41%), Gaps = 10/81 (12%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGG-GXXXG------XGXXXWGXGGARXXGGXR--GGAXX 749 GG G G GGG GGG G G G G GG GG R GGA Sbjct: 413 GGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGG 472 Query: 748 GGGGXV-FXXGXGRGGGGXLG 689 G GG V G G GGGG +G Sbjct: 473 GTGGSVGAGGGVGVGGGGGIG 493 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V G G G G G GG GG G G G G GG GG Sbjct: 63 VGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG 122 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GGG G G G GG G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAG 145 Score = 42.7 bits (96), Expect = 3e-04 Identities = 32/84 (38%), Positives = 33/84 (39%), Gaps = 1/84 (1%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGA-RXXGGXRG 761 V G GG G G GGG GGG G G GGA R GG G Sbjct: 478 VGAGGGVGVGGGGGIGGGAGGGV-GGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASG 536 Query: 760 GAXXGGGGXVFXXGXGRGGGGXLG 689 GA GGG G G GGG +G Sbjct: 537 GAGAGGGA-----GGGVGGGANVG 555 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/82 (36%), Positives = 33/82 (40%), Gaps = 5/82 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGG---XXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GGG GGGG G G G GG GG GG+ GGG Sbjct: 83 GGVGGGAGGAI-GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 141 Query: 730 FXXGXGRGGG--GXLGXXXRXR 671 G GGG G +G + R Sbjct: 142 GGAGGAIGGGASGGVGGGGKGR 163 Score = 42.3 bits (95), Expect = 4e-04 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 3/74 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFX 725 GG G G GG GG G G G GG GG GGA GG G V Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGI---GGGAGGAIGGGASGGVGG 158 Query: 724 XGXGRGG--GGXLG 689 G GRGG GG G Sbjct: 159 GGKGRGGKSGGGAG 172 Score = 42.3 bits (95), Expect = 4e-04 Identities = 28/79 (35%), Positives = 28/79 (35%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G A GG G G G GGG G G G GGA GG G G Sbjct: 169 GGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGR--GSGGASGGGGTVGAGGRG 226 Query: 745 GGGXVFXXGXGRGGGGXLG 689 GG G G G GG G Sbjct: 227 SGGASGGVGVGGGAGGSGG 245 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 4/82 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG GG G G G R GG GG Sbjct: 176 GGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVG 235 Query: 751 XGGG----GXVFXXGXGRGGGG 698 GGG G G GRG GG Sbjct: 236 VGGGAGGSGGGSVGGGGRGSGG 257 Score = 41.9 bits (94), Expect = 6e-04 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG--GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF 728 GG G G GG G GG G G G GGA G GGA G GG Sbjct: 494 GGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGA- 552 Query: 727 XXGXGRGGGGXLG 689 G G G GG G Sbjct: 553 NVGVGVGAGGSTG 565 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/83 (37%), Positives = 32/83 (38%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V GR GG G GG G GG G G G GG R GG G Sbjct: 203 VGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVG-GGGRGSGGV--G 259 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 A G GG V G G G GG +G Sbjct: 260 ASGGAGGNV---GAGGGLGGGVG 279 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/75 (36%), Positives = 28/75 (37%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GG G G G G G GG GG GG V Sbjct: 311 GGGGRGSGGAS-GGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAV-GG 368 Query: 721 GXGRGGGGXLGXXXR 677 G GGGG +G R Sbjct: 369 AVGGGGGGSVGGGGR 383 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/75 (36%), Positives = 28/75 (37%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GGG G G G GA G GG GGG Sbjct: 442 GAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGA---GG 498 Query: 721 GXGRGGGGXLGXXXR 677 G G G GG +G R Sbjct: 499 GVGGGVGGGVGGGVR 513 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GGG GG G G GG G RG Sbjct: 170 GAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG 229 Query: 751 XGGGGXVFXXGXGRGGGGXLGXXXR 677 GG V G G GGG +G R Sbjct: 230 ASGGVGV-GGGAGGSGGGSVGGGGR 253 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG--- 761 G G G G G G G GG G G G GG GG RG Sbjct: 199 GGGTVGAGGRGSGGASGGGGTVGAGGRG-SGGASGGVGVGGGAGGSGGGSVGGGGRGSGG 257 Query: 760 -GAXXGGGGXV-FXXGXGRGGGGXLG 689 GA G GG V G G G GG +G Sbjct: 258 VGASGGAGGNVGAGGGLGGGVGGGVG 283 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G GGGG G G G GG GGA G G Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGG 411 Query: 721 GXGRGG-GGXLG 689 G GG GG +G Sbjct: 412 VGGAGGAGGSVG 423 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G GGG GG G G G G GG GGA Sbjct: 439 GVGGAVGGAVGGAVGGGGGGSVGGGGRG-SGGAGGGTGGSVGAGGGVGVGGGGGIGGGAG 497 Query: 751 XGGGGXVFXXGXGRGGG 701 G GG V G G GGG Sbjct: 498 GGVGGGV---GGGVGGG 511 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/95 (33%), Positives = 33/95 (34%), Gaps = 8/95 (8%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGG--GGXXXGXGXXXWGXGGARXXGGXR 764 V G G GG G G GGG GG GG G G G G GG Sbjct: 486 VGGGGGIGGGAGGGVGGGVGGGV-GGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGA 544 Query: 763 GGAXXGGG------GXVFXXGXGRGGGGXLGXXXR 677 GG GG G G G GGG +G R Sbjct: 545 GGGVGGGANVGVGVGAGGSTGGGAAGGGGVGNRRR 579 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG G G G G GG R GG GGA G G Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGG 403 Query: 721 GXGRGGGGXLG 689 G GG G Sbjct: 404 ASGGASGGVGG 414 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GG G G G G GG+ GGG Sbjct: 373 GGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGV 432 Query: 721 GXGRGGG 701 G G GGG Sbjct: 433 GGGVGGG 439 Score = 39.1 bits (87), Expect = 0.004 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG G GG G G GGA GG G Sbjct: 102 GGGGKGRGRKGGGGAGGGV---GGGVGAGGGAGGSVGAGGGIGGGAGGA--IGGGASGGV 156 Query: 751 XGGG-GXVFXXGXGRGGG 701 GGG G G G GGG Sbjct: 157 GGGGKGRGGKSGGGAGGG 174 Score = 39.1 bits (87), Expect = 0.004 Identities = 29/81 (35%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG GGG GGGG G G GGA G GA Sbjct: 281 GVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSG-GASGGASGGASGGAGGSVGAG 339 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G GG V G G G GG +G Sbjct: 340 GGVGGGV-GGGVGGGVGGGVG 359 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/81 (30%), Positives = 27/81 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G GGG G G G G + G GGA Sbjct: 357 GVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAG 416 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG G G G GG +G Sbjct: 417 GAGGSVGAGGGVGGGVGGGVG 437 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/82 (34%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXX-GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G + GG G G GGG G GG G G GG GG GG Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGA--GGAIGGG 151 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G G+ GGG G Sbjct: 152 ASGGVGGGGKGRGGKSGGGAGG 173 Score = 38.7 bits (86), Expect = 0.005 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GGG GGG G G G GG GG G Sbjct: 215 GGGGTVGAGGRGSGGASGGVGVGGGAGG--SGGGSVGGGGR---GSGGVGASGGAGGNVG 269 Query: 751 XGGG-GXVFXXGXGRGGGGXLG 689 GGG G G G G GG +G Sbjct: 270 AGGGLGGGVGGGVGGGVGGSVG 291 Score = 38.3 bits (85), Expect = 0.007 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 7/78 (8%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGG-------GXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 GG G G GGG GGG G G G GG G RG G Sbjct: 157 GGGGKGRGGKS-GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASG 215 Query: 742 GGXVFXXGXGRGGGGXLG 689 GG G GRG GG G Sbjct: 216 GGGTVGAG-GRGSGGASG 232 Score = 38.3 bits (85), Expect = 0.007 Identities = 26/76 (34%), Positives = 28/76 (36%), Gaps = 5/76 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGX-----GXXXWGXGGARXXGGXRGGAXXGGGG 737 G G G GGG GGG G G G GG+ GG GG GG G Sbjct: 292 GAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVG 351 Query: 736 XVFXXGXGRGGGGXLG 689 G G GG +G Sbjct: 352 GGVGGGVGGAVGGAVG 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GG GG G G G G G GG GG G GG V Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRG 514 Query: 724 XGXGRGGGGXLG 689 G GGG G Sbjct: 515 AVGGAVGGGVGG 526 Score = 37.9 bits (84), Expect = 0.010 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 6/77 (7%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA--XXGGG--GX 734 G G G G GGGG G G G GG GG GGA GGG G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIG----GSGGVGAGGGVGGGAGGAIGGGASGG 100 Query: 733 VFXXGXGRG--GGGXLG 689 G GRG GGG G Sbjct: 101 AGGGGKGRGRKGGGGAG 117 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 3/86 (3%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG- 761 V G A G G G GG GG G G GG GG RG Sbjct: 258 VGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGS 317 Query: 760 GAXXGG--GGXVFXXGXGRGGGGXLG 689 G GG GG G G GG +G Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVG 343 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GG GGG G G G GG GG Sbjct: 252 GRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGG--GGGS 309 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G GG G Sbjct: 310 VGGGGRGSGGASGGASGGASG 330 Score = 35.5 bits (78), Expect = 0.051 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR--GGAX 752 G A G G G GG GG G G GG GG R GGA Sbjct: 330 GGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAS 389 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G G G GG G Sbjct: 390 GGASGGASGGASGGASGGASG 410 Score = 35.5 bits (78), Expect = 0.051 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GG GG G G GGA GG G Sbjct: 371 GGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG----GVGGAGGAGGSVGAGG 426 Query: 751 XGGGGXVFXXGXGRGG--GGXLG 689 GGG G G GG GG +G Sbjct: 427 GVGGGVGGGVGGGVGGAVGGAVG 449 Score = 35.5 bits (78), Expect = 0.051 Identities = 24/81 (29%), Positives = 26/81 (32%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G G GG G G G GG+ GG GG Sbjct: 374 GGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAG-GAGGSVGAGGGVGGGV 432 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG G G GG +G Sbjct: 433 GGGVGGGVGGAVGGAVGGAVG 453 Score = 32.7 bits (71), Expect = 0.36 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 3/85 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG---GGGXFXGXGXPXGGXEXPGXXXXXX 763 GG G GGGG G GGG G G GGG G G G G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Query: 762 XXXXXXXXXGFFXXGXGGGGGVXWG 688 G G GGG+ G Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGG 143 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRG-GAXXG-GGGXVFXXGXGRGGGGXLGXXXRXR 671 GGG G G G GG GG G GA G GGG G G GG G R R Sbjct: 54 GGGASGGIGVGGGGGGGG-GIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGR 110 Score = 31.9 bits (69), Expect = 0.63 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 1/86 (1%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG-GXFXGXGXPXGGXEXPGXXXXXXXX 757 G G GG G G GGG G GG G G G GG G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGG 104 Query: 756 XXXXXXXGFFXXGXGGGGGVXWGXXA 679 G G G GGGV G A Sbjct: 105 GKGRGRKGGGGAGGGVGGGVGAGGGA 130 Score = 31.9 bits (69), Expect = 0.63 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G G GG G GGG G GGGG G GG G Sbjct: 169 GGAGGGVGGGVGAGGGAGGSVGAGGGI--GSGGGGTVGAGGRGSGGASGGGGTVGAGGRG 226 Query: 753 XXXXXXGFFXXGXGGGGG 700 G G GG G Sbjct: 227 SGGASGGVGVGGGAGGSG 244 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG GGGGG G GG G GGG G G G Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Query: 753 XXXXXXGFFXXGXGGGGG 700 G GGG G Sbjct: 114 GGAGGGVGGGVGAGGGAG 131 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG---GGGXFXGXGXPXGG 796 G G GG G G GGG G G GGG G G GG Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGG 364 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G G GG G GGG G GG G GG + G Sbjct: 114 GGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG 164 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG-GGGXFXGXGXPXGG 796 GG RG GG G GG G GGG G G GG Sbjct: 306 GGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/65 (35%), Positives = 27/65 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P +PP PP +PP P P PPPP+ PP P P PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALF--PPLPPPPSQPPPPPLSPPP 1119 Query: 918 ARPXP 932 + P P Sbjct: 1120 SPPPP 1124 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPPP--PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPP PLP PPP P PPPP P PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP P P PPP P PP P PPPP P PP Sbjct: 1078 SPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 738 PPPPXXA--PPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPPP A PP PP + PP P P P PPPPS Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPS 1129 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/55 (43%), Positives = 25/55 (45%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP +PP PP PP P P P PPPPS PPP P P PP Sbjct: 1077 PSPPPPSPP-LPPSSLPPPPPAALFP-PL--PPPPS-QPPPPPLSPPPSPPPPPP 1126 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPP-PPRXXXGXPXPP 934 P PPLP PPP P PPP PP P PP Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPP-PPLPX-XXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S PP P PP PPLP PPP P PPPP P P Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 35.9 bits (79), Expect = 0.039 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP-SXXXXPPPXXXXP 881 PP P + P PP PP P P P PPPP S PPP P Sbjct: 1084 PPLPPSSLPPPPPAALFPPLP----PPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 34.7 bits (76), Expect = 0.090 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 1/73 (1%) Frame = +2 Query: 689 PQXTPPP-PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 PQ +PPP PP P P PP PPPP PP Sbjct: 1065 PQESPPPLPPLPPSP---------PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPL 1115 Query: 866 XPXXXXXXPPPPP 904 P PPPPP Sbjct: 1116 SPPPSPPPPPPPP 1128 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPP-PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PP PP P PP P PPPP P PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLP-PSSLPPPPPAALFPPLPPPP 1107 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 759 PPRXPPXXR--APPYPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXPXP 899 P PP + PP P P +PP PPS PPP P P P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 792 PYPHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P P P +PP PP PPP P PP P P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GGGG G G G GG GG GGGG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGG 152 Query: 721 GXGRGGGGXLG 689 G G G GG G Sbjct: 153 GYGGGDGGSYG 163 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG GGGG +G GG G GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Query: 751 XGGGGXVFXXGXGRGGGG 698 GGG G GGGG Sbjct: 149 REGGGYGGGDGGSYGGGG 166 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/71 (35%), Positives = 27/71 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GGG GGG G G G GG G+ GGGG + Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGG 145 Query: 721 GXGRGGGGXLG 689 G R GGG G Sbjct: 146 GGRREGGGYGG 156 Score = 37.5 bits (83), Expect = 0.013 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGG--XXXGXGXXXWGXGGARXXGGXRGG 758 G G G G GGG GGGG G G GG R GG GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGG--GG 147 Query: 757 AXXGGG-GXVFXXGXGRGGGG 698 GGG G G GGGG Sbjct: 148 RREGGGYGGGDGGSYGGGGGG 168 Score = 35.1 bits (77), Expect = 0.068 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 862 GGXXXXEG--GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG G GGG G G G GG GG GG GG + G G GG G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG--YGSGGGGGGRGYGG 145 Query: 688 XXXR 677 R Sbjct: 146 GGRR 149 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G R GG G G G G R GGG G G GG Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGG 164 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXG-GGXXXGRGGGGXFXGXGXPXGGXE 790 G G GGGGG G G GG GRG GG G GG + Sbjct: 111 GGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGD 158 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGG--GGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXX 760 GG G GGG G G GGG G GGGG G G G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Query: 759 XXXXXXXXGFFXXGXGGGGG 700 G GGGGG Sbjct: 148 RREGGGYGGGDGGSYGGGGG 167 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G RGG GG GGG G GGGG G G GG E Sbjct: 86 GSGGGGGGRGGSGG---GYRSGGGGGYSGGGGGGYSGGGG---GGYE 126 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRG--GGGXLGXXXR 677 G GG G GG GGG + G G G GGG G R Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERR 128 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 787 ARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +R GG GG GGG G G GGG G Sbjct: 84 SRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/68 (35%), Positives = 28/68 (41%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 146 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPP----PVKSPPPPVY 201 Query: 909 XXXARPXP 932 + P P Sbjct: 202 IYASPPPP 209 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/58 (37%), Positives = 26/58 (44%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P PPY + P P +PPPP PPP P P PP Sbjct: 82 KSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 135 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 50 KSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPP----PVKSPPPP 103 Score = 45.2 bits (102), Expect = 6e-05 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 66 KSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 119 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 98 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 151 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 114 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 167 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/58 (37%), Positives = 25/58 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 130 KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 183 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/55 (38%), Positives = 23/55 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P P PPY + P P +PPPP PPP P P PP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPP----PVKSPPPP 87 Score = 36.3 bits (80), Expect = 0.029 Identities = 25/88 (28%), Positives = 27/88 (30%), Gaps = 5/88 (5%) Frame = +2 Query: 689 PQXTPPPP-----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXX 853 P +PPPP P P K+ P P P PPPP Sbjct: 128 PVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYS 187 Query: 854 XPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPP PPPP P P H Sbjct: 188 SPPPP----VKSPPPPVYIYASPPPPTH 211 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/66 (27%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXPPXXXX 914 P + P P ++PP P P P PP PPP P PP Sbjct: 30 PYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYV 89 Query: 915 XARPXP 932 + P P Sbjct: 90 YSSPPP 95 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 47.6 bits (108), Expect = 1e-05 Identities = 31/74 (41%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR----GGAXXGGGGXV 731 G G G GGG +GGGG G G G GG GG R GG GGGG Sbjct: 43 GYGDNGGNYNNGGGY---QGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGR- 98 Query: 730 FXXGXGRGGGGXLG 689 + G GR GGG G Sbjct: 99 YQGGGGRQGGGGSG 112 Score = 39.5 bits (88), Expect = 0.003 Identities = 28/66 (42%), Positives = 29/66 (43%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG +GGGG G G G GG R GG GG GGGG Sbjct: 54 GGGYQGGGGNYQGGGGNY-QGGGGNYQGGGGRYQG-GGGRYQGG--GGRYQGGGGR--QG 107 Query: 721 GXGRGG 704 G G GG Sbjct: 108 GGGSGG 113 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 GG G GG +GGGG G G G GG R GG GG+ Sbjct: 67 GGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQG-GGGRQGGGGSGGS 114 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 +GGGG GG +GGGG + G G GG Sbjct: 72 QGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGG 108 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 G G +GGGG GG +GGGG + G G Sbjct: 56 GYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGG 96 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/65 (35%), Positives = 26/65 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +PP PP PP P P +PPP PPP P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSP------PVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHS 464 Query: 918 ARPXP 932 + P P Sbjct: 465 SPPPP 469 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PPP P PPP P PPPPP P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSP--PVYSPPPPPSIHYSSPPPP 459 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P PP P PPP + PPP P Sbjct: 412 PPPPPSPPLP--------PPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHH 463 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPP P P PP Sbjct: 464 SSPPPPSPEFE--GPLPP 479 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXPXXXPXPP 902 P PP +PP P + P P P +PPPPS PP P PP Sbjct: 438 PSPPVYSPPPPPSIHYSSPPP---PPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPP 491 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPP---XPXXXXXXPPPPPRXXXGXPXPP 934 G S P PPPP PPP P PPP P PP Sbjct: 397 GRSVVKPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 T PPPP +PP PP + PP Y P P PP P S PPP P PP Sbjct: 56 TTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPP 115 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/68 (33%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP + PP Y P P PP PS PP P P P Sbjct: 107 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPS---YSPPVKPPPVQMPPTPTY 163 Query: 909 XXXARPXP 932 +P P Sbjct: 164 SPPIKPPP 171 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 5/68 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP Y P P PP P S PPP P PP Sbjct: 360 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 Query: 903 XXXXXARP 926 +P Sbjct: 420 IKLPPVKP 427 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP + PP Y P P PP P+ PP P P P Sbjct: 90 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPT---YSPPIYPPPIQKPPTPSY 146 Query: 909 XXXARPXP 932 +P P Sbjct: 147 SPPVKPPP 154 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP + PP Y P P PP P+ PP P P P Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPT---YSPPVKSPPVQKPPTPTY 315 Query: 909 XXXARPXP 932 +P P Sbjct: 316 SPPIKPPP 323 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 5/68 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP---XPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP P P P PP P S PPP P PP Sbjct: 276 PPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPP 335 Query: 903 XXXXXARP 926 +P Sbjct: 336 IKPPPVKP 343 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/67 (32%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P +PP PP PP P P P PP P+ PP P P P Sbjct: 444 PPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPT---YSPPVQPPPVQKPPTPTYS 500 Query: 912 XXARPXP 932 +P P Sbjct: 501 PPVKPPP 507 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/71 (32%), Positives = 26/71 (36%), Gaps = 4/71 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR--APPYPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPPX 905 PP P +PP PP + P Y P P PP P S PPP P PP Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPI 520 Query: 906 XXXXARPXPXT 938 +P T Sbjct: 521 KPPPVKPPTPT 531 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/67 (32%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P +PP PP + PP P P P PP P+ PP P P P Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPT---YSPPIKPPPVHKPPTPTYS 550 Query: 912 XXARPXP 932 +P P Sbjct: 551 PPIKPPP 557 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/59 (37%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP + PP P P P PP P S PPP P PP Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPP 368 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/67 (32%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX--PXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P +PP PP + PP P P P PP P PP P P P Sbjct: 394 PPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP---IYSPPVKPPPVHKPPTPIYS 450 Query: 912 XXARPXP 932 +P P Sbjct: 451 PPVKPPP 457 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPT---YSPPIKPPPVQKPPTPTY 668 Query: 909 XXXARPXP 932 +P P Sbjct: 669 SPPVKPPP 676 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPT---YSPPVKPPPVQLPPTPTY 685 Query: 909 XXXARPXP 932 +P P Sbjct: 686 SPPVKPPP 693 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/68 (33%), Positives = 26/68 (38%), Gaps = 5/68 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP + PP Y P P PP P S PPP P PP Sbjct: 124 PPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPP 183 Query: 903 XXXXXARP 926 +P Sbjct: 184 IKPPVHKP 191 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP P P P PP P S PPP P PP Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 216 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPT---YSPPVKPPPVHKPPTPIY 247 Query: 909 XXXARPXP 932 +P P Sbjct: 248 SPPIKPPP 255 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP Y P P PP P S PPP P PP Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 267 Query: 903 XXXXXARPXP 932 + P Sbjct: 268 VKPPPVQTPP 277 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP Y P P PP P S PPP P PP Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Query: 903 XXXXXARPXP 932 + P Sbjct: 302 VKSPPVQKPP 311 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 527 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPT---YSPPIKPPPVHKPPTPTY 583 Query: 909 XXXARPXP 932 +P P Sbjct: 584 SPPIKPPP 591 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPT---YSPPIKPPPVHKPPTPTY 600 Query: 909 XXXARPXP 932 +P P Sbjct: 601 SPPIKPPP 608 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPT---YSPPIKPPPVHKPPTPTY 617 Query: 909 XXXARPXP 932 +P P Sbjct: 618 SPPIKPPP 625 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPT---YSPPIKPPPVHKPPTPTY 634 Query: 909 XXXARPXP 932 +P P Sbjct: 635 SPPIKPPP 642 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPT---YSPPIKPPPVHKPPTPTY 651 Query: 909 XXXARPXP 932 +P P Sbjct: 652 SPPIKPPP 659 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP Y P P PP P S PPP P PP Sbjct: 225 PPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPP 284 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 5/60 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP PP Y P P PP P S PPP P PP Sbjct: 343 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPP 402 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP + PP P P PPP P PP P P P Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTY---SPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTY 702 Query: 909 XXXARPXP 932 +P P Sbjct: 703 SPPVKPPP 710 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP + PP Y P P PP P S PPP P P Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 Query: 903 XXXXXARPXP 932 P P Sbjct: 740 PQGGYGTPPP 749 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP PP + PP P P PPP P PP P P P Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTY---SPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTY 719 Query: 909 XXXARPXP 932 +P P Sbjct: 720 SPPIKPPP 727 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/67 (31%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR--APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P +PP PP + P Y P P PP P+ PP P P P Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYS---PPIKPPPIHKPPTPTYS 567 Query: 912 XXARPXP 932 +P P Sbjct: 568 PPIKPPP 574 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP P +PP PP + P Y P P PP P S PPP P PP Sbjct: 175 PPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPP 233 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P +PP PP + P Y P P PP P PP P P P Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP---IYSPPVKPPPVHKPPTPIYS 383 Query: 912 XXARPXP 932 +P P Sbjct: 384 PPVKPPP 390 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP-XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P +PP PP + PP P P P PP+ PP P P P Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP--IKLPPVKPPTPIYSP 434 Query: 915 XARPXP 932 +P P Sbjct: 435 PVKPPP 440 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPP--SXXXXPPPXXXXPXXXPXPP 902 PP +PP PP + PP Y P P PP P S PPP P PP Sbjct: 75 PPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPP 132 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP-XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P +PP PP + PP P P P PP+ PP P P P Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPP--IKPPPVKPPTPTYSP 534 Query: 915 XARPXP 932 +P P Sbjct: 535 PIKPPP 540 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP-XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P +PP PP + PP P P P PP+ PP P P P Sbjct: 141 PPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPP--IKPPVHKPPTPIYSP 198 Query: 915 XARPXP 932 +P P Sbjct: 199 PIKPPP 204 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP P +PP PP PP Y P P PP P+ PP P P P Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPT---YSPPIKPPPVKPPTP 480 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 3/74 (4%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P PPP PP P P PP P P PP P Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHK 443 Query: 860 PPXPXXXXXXPPPP 901 PP P PPP Sbjct: 444 PPTPIYSPPVKPPP 457 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/66 (30%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP-XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP P +PP P + PP P P P PP+ PP P P P Sbjct: 293 PPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPP--IKPPPVKPPTPIYSP 350 Query: 915 XARPXP 932 +P P Sbjct: 351 PVKPPP 356 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP APP PP +PP P P PP S PPP P PP Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPI----YPPPIQKPPTYSPPIYPPPIQKPPTPTYSPP 98 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPP---PSXXXXPPPXXXXPXXXPXPPX 905 PPP PP P PP P P PPP P PP P P P Sbjct: 69 PPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPT 128 Query: 906 XXXXARPXP 932 P P Sbjct: 129 YSPPIYPPP 137 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = +2 Query: 689 PQXTPP--PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P +PP PP P P PP P P PP P P Sbjct: 301 PVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKP 360 Query: 863 PXPXXXXXXPPPP 901 P P PPP Sbjct: 361 PTPIYSPPVKPPP 373 Score = 32.7 bits (71), Expect = 0.36 Identities = 22/85 (25%), Positives = 23/85 (27%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P PPP PP P P P P P PP P Sbjct: 401 PPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHK 460 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP + PP Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 32.7 bits (71), Expect = 0.36 Identities = 22/85 (25%), Positives = 23/85 (27%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P PPP PP P P P P P PP P Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQK 510 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP + PP Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPP 535 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/86 (26%), Positives = 24/86 (27%), Gaps = 4/86 (4%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQ 325 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP + PP Sbjct: 326 KPPTPTYSPPIKPPPVKPPTPIYSPP 351 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +2 Query: 785 GXSXPPX--GXPXPXXXPPPPL--PXXXPPPXPXXXXXXPP--PPP 904 G + PP G P PPPP+ P PPP PP PPP Sbjct: 41 GHAHPPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPP 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 6/88 (6%) Frame = +2 Query: 689 PQXTPPP--PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXXP 859 P PPP PP P P PP P P PP P P Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKP 527 Query: 860 PPXPXXXXXXPPP---PPRXXXGXPXPP 934 P PPP PP P P Sbjct: 528 PTPTYSPPIKPPPVHKPPTPTYSPPIKP 555 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXG-XPXPXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 653 PPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQ 712 Query: 857 PPPXPXXXXXXPPPP 901 PP P PPP Sbjct: 713 VPPTPTYSPPIKPPP 727 Score = 29.9 bits (64), Expect = 2.5 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 7/89 (7%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 114 PPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVH 173 Query: 857 PPPXPXXXXXXPPP---PPRXXXGXPXPP 934 PP P PP PP P P Sbjct: 174 KPPTPTYSPPIKPPVHKPPTPIYSPPIKP 202 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 6/70 (8%) Frame = +3 Query: 741 PPPXXAPPR---XPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP P P PPP P PP P P P Sbjct: 169 PPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Query: 903 XXXXXARPXP 932 +P P Sbjct: 229 TYSPPVKPPP 238 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +3 Query: 741 PPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXPPXX 908 PPP PP P + PP P P +PP PP P P P P Sbjct: 674 PPPVQLPPTPTYSPPVKPPPV--QVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVP 731 Query: 909 XXXARPXP 932 P P Sbjct: 732 PTPTTPSP 739 Score = 29.5 bits (63), Expect = 3.4 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 7/89 (7%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 283 PPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVK 342 Query: 857 PPPXPXXXXXXPPP---PPRXXXGXPXPP 934 PP PPP PP P P Sbjct: 343 PPTPIYSPPVKPPPVHKPPTPIYSPPVKP 371 Score = 29.1 bits (62), Expect = 4.4 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 7/89 (7%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 131 PPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHK 190 Query: 857 PPPXPXXXXXXPPP---PPRXXXGXPXPP 934 PP PPP PP P P Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKP 219 Score = 28.3 bits (60), Expect = 7.8 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +2 Query: 689 PQXTPPP---PPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPX-PXXXPPPPLPXXX 856 P PPP PP P P PP P P PP P Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQ 409 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PP + PP Sbjct: 410 KPPTPTYSPPIKLPPVKPPTPIYSPP 435 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 46.4 bits (105), Expect = 3e-05 Identities = 31/81 (38%), Positives = 32/81 (39%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG GGGG G G G GG GG G Sbjct: 337 GYGGPSGSYGGGYGSS-GIGGYGGGMGG-AGGGGYRGGGGYDMGGVGGG-GAGGYGAGGG 393 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG + G GRGG G G Sbjct: 394 GNGGGSFYGGGGGRGGYGGGG 414 Score = 39.5 bits (88), Expect = 0.003 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXG--GARXXGGXRGG 758 G R GG G G GG E GGG G G G G GG GG Sbjct: 305 GYNRGGYSMGGGGGYGGGPGDMYGGSYG-EPGGGYGGPSGSYGGGYGSSGIGGYGGGMGG 363 Query: 757 AXXG---GGGXVFXXGXGRGGGGXLG 689 A G GGG G G GG G G Sbjct: 364 AGGGGYRGGGGYDMGGVGGGGAGGYG 389 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 3/64 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGX--RGGAXXGGGGXV 731 GG G G GGG G GGG G G G GG GG RGG GG G Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRY 418 Query: 730 FXXG 719 G Sbjct: 419 HPYG 422 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG GGG G G G GA GG GG+ GGGG G Sbjct: 353 GIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGA-GGGGNGGGSFYGGGGG--RGG 409 Query: 718 XGRGGGG 698 G GG G Sbjct: 410 YGGGGSG 416 Score = 38.7 bits (86), Expect = 0.005 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G P GG GG G GG G GGGG G G P G G Sbjct: 245 GGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVG-PYRGEPALGYSGRYGGGG 303 Query: 753 XXXXXXGFFXXGXGGGGG 700 G+ G GG GG Sbjct: 304 GGYNRGGYSMGGGGGYGG 321 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G G G G GG GG GG GG G G GGGG G Sbjct: 233 GDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGG 282 Score = 35.1 bits (77), Expect = 0.068 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 1/68 (1%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXG-XGXPXGGXEXPGXXXXXXXXXXXXXXXGFF 727 GGGGG GGG G G G + G G P GG P G Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 726 XXGXGGGG 703 G GGGG Sbjct: 361 MGGAGGGG 368 Score = 33.9 bits (74), Expect = 0.16 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR--G 761 G G GG G G GG G G G G GG GG G Sbjct: 256 GYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGG 315 Query: 760 GAXXGGG-GXVFXXGXGRGGGGXLG 689 G GGG G ++ G GGG G Sbjct: 316 GGGYGGGPGDMYGGSYGEPGGGYGG 340 Score = 33.5 bits (73), Expect = 0.21 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 8/79 (10%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG-ARXXGGXRG------GAXXGG 743 GG G G GGG GG G +G GG G RG GG Sbjct: 242 GGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGG 301 Query: 742 GGXVF-XXGXGRGGGGXLG 689 GG + G GGGG G Sbjct: 302 GGGGYNRGGYSMGGGGGYG 320 Score = 32.7 bits (71), Expect = 0.36 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 4/75 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXG----XGXXXWGXGGARXXGGXRGGAXXGGGGX 734 GG G G G GGGG G G +G G GG G G GG Sbjct: 282 GGVGPYRGEPALGYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGP 341 Query: 733 VFXXGXGRGGGGXLG 689 G G G G G Sbjct: 342 SGSYGGGYGSSGIGG 356 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 GG G GGGG G G G GGGG G G G P Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHP 420 Score = 32.3 bits (70), Expect = 0.48 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGX-GXXXWGXGG-ARXXGGXRGGAXXGGGGXVF 728 GG G G GGG G G G G G GG + GG G + GG G Sbjct: 302 GGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGG-- 359 Query: 727 XXGXGRGGGG 698 G G GGG Sbjct: 360 --GMGGAGGG 367 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG--GGGXFXGXGXPXGG 796 GG G GGG G GG G G GGG F G G GG Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = -3 Query: 933 GGXGXPXXXRGGG---GGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G P GGG G G GG G GGG + G GG Sbjct: 336 GGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGG 384 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXXXXXXXGFFX 724 GGG G GGG GR GG + G G GG G Sbjct: 241 GGGYGGPGGPYKSGGGYGGGRSGG--YGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGR 298 Query: 723 XGXGGGG 703 G GGGG Sbjct: 299 YGGGGGG 305 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXG 811 GG G GGGG G GGG G GG G + G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHPYG 422 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-GXRGGAXXGGGGXVFXXGXG 713 GGG GG G G G GG R G G GG G GG + G G Sbjct: 237 GGGHGGGYGGPGGPYKSGG---GYGGGRSGGYGGYGGEFGGYGGGGYGGGVG 285 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP PP P P P PPPP PPP P P P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQL-PPPPQ---LPPPAPPKPQPSPPTP 115 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP +P P PP P P P PPP PP P P PP A Sbjct: 46 PPPSPSPEPEPEPADCPP-PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPA 104 Query: 921 RPXP 932 P P Sbjct: 105 PPKP 108 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/66 (37%), Positives = 26/66 (39%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 P P PP PP PP P P P PPPPS PPP P PP Sbjct: 56 PEPADCPPPPPP----PPCPPPPSPPPC--PPPPSPPPSPPP-PQLPPPPQLPPPAPPKP 108 Query: 921 RPXPXT 938 +P P T Sbjct: 109 QPSPPT 114 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P PP P P PP P P PP P PP PP+ P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 41.5 bits (93), Expect = 8e-04 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPP 902 P P PP PP PP P P P P PP PP P P P PP Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P P PPPP P PPP PP PP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P PPPP P PP P PPP P PP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PP P P PP P PPPP+ PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP P PP P P P P PP P PP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P P P P PPP P PPP P P PP Sbjct: 41 GNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G GG G G GG G GGGG G G G GG G GG Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGG 181 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 G GG G G GG G G Sbjct: 182 GGGCGGSCSGGGGGGGGYGHGG 203 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/73 (39%), Positives = 31/73 (42%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG--GAXXGGGGXVF 728 GG G G GGG GGGG G G +G G GG G G GGG Sbjct: 105 GGYGGG-GPGYGGGGYGPGGGGGGVVIGGG---FGGGAGYGSGGGLGWDGGNGGGGPGYG 160 Query: 727 XXGXGRGGGGXLG 689 G G GGGG +G Sbjct: 161 SGGGGIGGGGGIG 173 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 5/86 (5%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG---GXXXGXGXXXWGXGGA--RXXGGX 767 G G GG G GGG GGG G G +G GG GG Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGI 172 Query: 766 RGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GGGG GGGG G Sbjct: 173 GGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/76 (36%), Positives = 31/76 (40%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G++ G G GGG GGGG G G GG GG GGA G Sbjct: 89 GKSIRHVTGFKGELTAGGYGGGGPGY--GGGGYGPGG-----GGGGVVIGGGFGGGAGYG 141 Query: 745 GGGXVFXXGXGRGGGG 698 GG + G G GGGG Sbjct: 142 SGGGLGWDG-GNGGGG 156 Score = 36.7 bits (81), Expect = 0.022 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G GG GG G G G G GGGG G G GG G Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG--PGYGSGGGGIGGGGGIGGGVIIG 179 Query: 753 XXXXXXGFFXXGXGGGGG 700 G G GGGGG Sbjct: 180 GGGGGCGGSCSGGGGGGG 197 Score = 36.3 bits (80), Expect = 0.029 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWG--XGGARXXGGXR 764 V G G G G GGG GGG G G G GG GG Sbjct: 129 VIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGG---GGGC 185 Query: 763 GGAXXGGGGXVFXXGXGRGG 704 GG+ GGGG G G GG Sbjct: 186 GGSCSGGGGG--GGGYGHGG 203 Score = 35.9 bits (79), Expect = 0.039 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G A GG G G G G GG G G G GG GG G G Sbjct: 136 GGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGG 195 Query: 745 GGGXVFXXGXGRGGG 701 GGG +G G Sbjct: 196 GGGYGHGGVSTKGSG 210 Score = 32.7 bits (71), Expect = 0.36 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXG-GARXXGGXRGGA 755 G G G G G GGG GGGG G G G G GG GG Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGG---IGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGG 197 Query: 754 XXGGGGXVFXXGXGR 710 G GG V G G+ Sbjct: 198 GYGHGG-VSTKGSGK 211 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGGG G GGG G G GG Sbjct: 170 GGIGGGVIIGGGGGGCGGSCSG-GGGGGGGYGHGG 203 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P AP PP + P P P P P PP P P P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPK 87 Query: 918 ARPXP 932 +P P Sbjct: 88 PKPAP 92 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP-PXXXX 914 PP P AP PP + P P P P P PP+ P P P P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Query: 915 XARPXP 932 +P P Sbjct: 121 KPKPAP 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P P PP + P P P P P PP P P P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPK 98 Query: 918 ARPXP 932 P P Sbjct: 99 PTPAP 103 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR-AP-PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP P P PP + AP P P P P PP P P P P P PP Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPK 109 Query: 912 XXARPXP 932 P P Sbjct: 110 PAPAPAP 116 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 P P AP P + P P P P PP P P P P P PP Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Query: 921 RPXP 932 P P Sbjct: 102 APTP 105 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 747 PXXAPPRXPPXXRAP-PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXAR 923 P PP+ P AP P P P P PP P P P P P PP Sbjct: 24 PAPKPPKPKP---APAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPA 80 Query: 924 PXP 932 P P Sbjct: 81 PTP 83 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 AP PP + P P P P P PP P P P P P P P Sbjct: 23 APAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAP 81 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PP P P P PP P PP P+ P PP+ Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPA-PTPPN 96 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P P P PP P PP P+ P PP Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPA-PTPP 73 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P P P PP P PP P+ P PP Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPA-PTPP 84 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P P P PP P PP P+ P PP Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPA-PTPP 106 Score = 33.1 bits (72), Expect = 0.27 Identities = 20/72 (27%), Positives = 20/72 (27%), Gaps = 1/72 (1%) Frame = +2 Query: 689 PQXTPPPP-PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 P TPP P P P PP P P PP P P P P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 Query: 866 XPXXXXXXPPPP 901 P P P Sbjct: 117 TPAPKPKPAPKP 128 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 S P P P P P P P P P P P P P P Sbjct: 22 SAPAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 818 PXXXPPPPLPXXXP-PPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P P P PP P PP P+ P PP Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPA-PTPP 62 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 3/82 (3%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXX---PPPX 868 +PPPPP P P P P P PPP P PP Sbjct: 734 SPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPP 793 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPPP P PP Sbjct: 794 PPAVHYSPPPPPVIHHSQPPPP 815 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/70 (31%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGX--SXPPXGXPXPXXXPPPPLPXXXPPPXPX 874 PPPPP P + P S PP PPPP+ PP P Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPG 827 Query: 875 XXXXXPPPPP 904 PPPPP Sbjct: 828 ISYASPPPPP 837 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP PPPP PPP P PPPPP P H Sbjct: 704 PPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSH 750 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX--PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P PPPP PPP P PPPPP P PP Sbjct: 774 PAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP--IYEGPLPP 824 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P P P PPLP P P PPP G PH Sbjct: 584 PPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPGTLLHPH 630 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP---XPXXXXXXPPPPPRXXXGXPXPP 934 P S PP PPPP PP P PPPPP P PP Sbjct: 719 PHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPP 772 Score = 34.7 bits (76), Expect = 0.090 Identities = 22/73 (30%), Positives = 24/73 (32%), Gaps = 6/73 (8%) Frame = +3 Query: 738 PP--PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP---- 899 PP P P PP P P P P +P PP PP P P P Sbjct: 494 PPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPT 553 Query: 900 PXXXXXARPXPXT 938 P + P P T Sbjct: 554 PSSPIPSPPTPST 566 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY---PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P P P +PP P P P +P PP P P P PP Sbjct: 561 PPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPP 618 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP A P P N PPPP+ PPP P PP Sbjct: 759 PPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPP 815 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/59 (30%), Positives = 21/59 (35%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 + T PP +PP P +PP P P P P P P P P PP Sbjct: 402 RSTRPPVVVPSPPTTPSPGGSPPSP-SISPSPPITVPSPPTTPSPGGSPPSPSIVPSPP 459 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +3 Query: 741 PPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P +PP P P P P P +PP PS PP P P P Sbjct: 488 PTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSP 543 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR--APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP + P P +PP P P PP PPP P PP Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPA 775 Query: 912 XXARP 926 + P Sbjct: 776 HYSPP 780 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX-----NPPPPSXXXXPPPXXXXP---XXXP 893 PPPP P + PP PH P P +PPPP PP P P Sbjct: 702 PPPPA---PYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSP 758 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 759 PPPPTVHYNPPPP 771 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXX--PPPXPXXXXXXPPP---PPRXXXGXPXPP 934 P P P PPP P PP P PPP PP P PP Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPX------XNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP +P PP P P P P +PP PS PP P P P Sbjct: 413 PPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSP 472 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXPXXXPXPPXXX 911 PP +PP P +PP P P P P S P P P P P Sbjct: 432 PPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPG 491 Query: 912 XXARPXPXT 938 P T Sbjct: 492 GSPPSSPTT 500 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 13/68 (19%) Frame = +3 Query: 738 PPPPXXA----PPRXPP-XXRAPPYP---HXXXPXP----XXNPPPPSXXXXP-PPXXXX 878 PPPP A PP P +PP P H P P PPPP P PP Sbjct: 769 PPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGI 828 Query: 879 PXXXPXPP 902 P PP Sbjct: 829 SYASPPPP 836 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 5/72 (6%) Frame = +3 Query: 732 TXPPPPXXAP--PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXP-XXXPX 896 T P P P P P +PP P P P PPS P PP P P Sbjct: 499 TTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPI 558 Query: 897 PPXXXXXARPXP 932 P P P Sbjct: 559 PSPPTPSTPPTP 570 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 P PP P PP +PP P P P P S PPP P Sbjct: 582 PSPPFTGPS--PPSSPSPPLPPVIPSPPIVGPTPSS----PPPSTPTP 623 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/69 (27%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXX-RAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 ++ PP +PP P PP P P P PP PP P PP Sbjct: 748 QSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPP--PSPPVYYYNSPPPPPAVHYSPPPPP 805 Query: 906 XXXXARPXP 932 ++P P Sbjct: 806 VIHHSQPPP 814 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +3 Query: 741 PPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P +PP P P P P P +PP P P P PP Sbjct: 475 PTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPP 530 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 T P PP P PP +PP P + P P P Sbjct: 587 TGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPGTLLHP 629 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/67 (38%), Positives = 27/67 (40%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G GGG GG G G G G GG G GG GGGG G G Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNG--GGCGGGGGGKGGKSGGG 133 Query: 712 RGGGGXL 692 GGGG + Sbjct: 134 SGGGGYM 140 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG +GGGG G G G GG GG + G GGGG G G GGGG G Sbjct: 75 GGSGGGGKGGGG---GGGISGGGAGGKSGCGGGKSGG--GGGGGKNGGGCGGGGGGKGG 128 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGAR--XXGGXRGGAXXGGGGXVFXXG 719 G G GGG +GGGG G G G GGA+ GG + G GGGG + G Sbjct: 2 GGKGGSGSGGGG----KGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Query: 718 XGR 710 R Sbjct: 58 SNR 60 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/58 (43%), Positives = 27/58 (46%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXL 692 GG GGGG G G G GG GG +GG GGGG G G GGGG + Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGG-GGGGAKGGC--GGGGK---SGGGGGGGGYM 53 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX--GRGGGGXFXGXGXPXGGXEXPGXXXXXXX 760 GG G +GGGGG G GGG G GGGG G G G PG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYI 64 Query: 759 XXXXXXXXGFFXXGXGGGGG 700 G GG GG Sbjct: 65 SRDNFESDPKGGSGGGGKGG 84 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 +GG G G GGG GRGGGG G GG + G Sbjct: 4 KGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG 45 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/71 (30%), Positives = 25/71 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G + GGG G G GG G GG+ Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGS- 134 Query: 751 XGGGGXVFXXG 719 GGGG + G Sbjct: 135 -GGGGYMVAPG 144 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGGGG G GGG G+ GGG G Sbjct: 100 GCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = -2 Query: 844 EGGGGX--XXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +GG G G G GGA G GG GGGG G GGGG G Sbjct: 74 KGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKG 127 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GG GG G GG G GG G G GG G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G G G+ GGG G G GG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGG---GGGGKNGG 117 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GG GG G GGG G GGGG G G GG Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGK-NGGGCGGGG 123 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G G G GGG GG G G G GG + GG GG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G GGGGG G GGG G G GG G G PG Sbjct: 97 GKSGCGGGKSGGGGGGGKNGGGCGGG---GGGKGGKSGGGSGGGGYMVAPG 144 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 P GGGG G GG G+ G G G GG G Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGG 118 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 45.6 bits (103), Expect = 5e-05 Identities = 27/68 (39%), Positives = 28/68 (41%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GG EGGGG G G GG GG R + GGGG Sbjct: 34 GGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG----- 88 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 89 GEGDGGGG 96 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -2 Query: 835 GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G G W GG GG GG GGGG G G GG G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSG 75 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G G G G GG GG GG GGG + G G G GG Sbjct: 30 GGNGGGSGKGQWLHG-GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGG 76 Score = 36.3 bits (80), Expect = 0.029 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG------GGGXXXGXGXXXWGXGGARXX 776 + G A GG G GG G GGG G G G GG Sbjct: 5 IVGEASAAVIMIGGLGLFGTHSLQAGGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQK 64 Query: 775 GGXRGGAXXGGGGXVFXXGXGRGGG 701 GG GGG G G GGG Sbjct: 65 ISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 31.5 bits (68), Expect = 0.83 Identities = 24/66 (36%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXX-XEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G+ G G G GGG +GGGG G G GG GG GG Sbjct: 37 GKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGG----GG--GGE 90 Query: 754 XXGGGG 737 GGGG Sbjct: 91 GDGGGG 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXX---GXGGGXXXGRGGGG 829 GG G GGGGG G GGG G GGGG Sbjct: 59 GGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXG--GGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGG G G GG GGG G G GG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 1/84 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXP-PPPLPXXXPPP 865 PQ PPP P P P + PP P P P PPP P PPP Sbjct: 38 PQPKPPPAPSPSP-----CPSPPPKPQPKPVPPPACPPT-PPKPQPKPAPPPEPKPAPPP 91 Query: 866 XPXXXXXXPPPPPRXXXGXPXPPH 937 P PP P P PPH Sbjct: 92 APKPVPCPSPPKPPAPTPKPVPPH 115 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXP-PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 PG S P P P P PPP P PPP P PPP P P Sbjct: 16 PGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/67 (32%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPPXXXXPXXXPXP-PXXX 911 P PP P+ PP P P P P P PPP+ PP P P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCP-SPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Query: 912 XXARPXP 932 +P P Sbjct: 91 PAPKPVP 97 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXP 899 K PP P APP P P P P P PP PP P P P P Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 Query: 900 P 902 P Sbjct: 138 P 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXPXPPXXXX 914 P PP P PP P P P P +PP PP+ P P P P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP 129 Query: 915 XARPXP 932 +P P Sbjct: 130 SPKPAP 135 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXPPPXXXXPXXXPXP-PXXXXX 917 PP +P PP P P P P +PPP P PPP P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPE 84 Query: 918 ARPXP 932 +P P Sbjct: 85 PKPAP 89 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXP---PXXRAPPYPH-XXXPXPXXNPPPPSXXXXP-PPXXXXPXXXPXPP 902 PP P PP P P PP P P P P PP P PP P P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPK 94 Query: 903 XXXXXARPXP 932 + P P Sbjct: 95 PVPCPSPPKP 104 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 8/63 (12%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP-----PPPSXXXXP---PPXXXXPXXXP 893 P PP P+ P PP P P P P PPP+ P PP P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Query: 894 XPP 902 PP Sbjct: 112 VPP 114 Score = 36.3 bits (80), Expect = 0.029 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPH---XXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXP 899 P P APP APP P P P PPP PS PPP P P P Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP---KPQPKPVP 64 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 65 PPACPPTPPKP 75 Score = 35.1 bits (77), Expect = 0.068 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 5/74 (6%) Frame = +3 Query: 726 KKTXPPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXP-PPXXXXPXXX 890 K PP P APP P PP P P P +P P PS P P P Sbjct: 11 KPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPP-PAPSPSPCPSPPPKPQPKPVPPPACP 69 Query: 891 PXPPXXXXXARPXP 932 P PP P P Sbjct: 70 PTPPKPQPKPAPPP 83 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP---PPPSXXXXPPPXXXXPXXXPXP 899 K PPP P P APP P P P P P P P P P Sbjct: 61 KPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPK 120 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 121 PAPAPTPAPSP 131 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PQ P PPP P + P P P PP P P PP Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPK-PPAPTPKPVPPHG 116 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P P P P PP Sbjct: 117 PPPKPAPAPTPAPSPKPAPSPP 138 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P +P P PP + P P P P PP PP P P PP Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVA---PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 K P P PP PP AP P P +PP P P Sbjct: 103 KPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P P P P P P P P PPP P PP Sbjct: 6 PDPSPKPVAPPGPSSKPVAP-PGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P P +PP+ P P PH P P P P+ P P P P Sbjct: 95 PVPCPSPPKPPAPTPKPVPPHGPPPKPAP-APTPAPSPKPAPSPPKPENKTIP 146 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = +3 Query: 726 KKTXPPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K P P P P PP + P P P P P P PP P P P Sbjct: 74 KPQPKPAPPPEPKPAPPPAPKPVPCPSPPKP-PAPTPKPVPPHGPPPKPAPAPTPAPSPK 132 Query: 903 XXXXXARPXPXT 938 +P T Sbjct: 133 PAPSPPKPENKT 144 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/76 (34%), Positives = 27/76 (35%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 GR G G G GGG GGG G G G GG G Sbjct: 93 GRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYG 152 Query: 745 GGGXVFXXGXGRGGGG 698 GGG + G G GGGG Sbjct: 153 GGGGGYGGGGGYGGGG 168 Score = 41.5 bits (93), Expect = 8e-04 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 2/83 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG--GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G GR GG G G GG G + G G G GG GG Sbjct: 102 GGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGG 161 Query: 757 AXXGGGGXVFXXGXGRGGGGXLG 689 GGGG + G GRGGGG G Sbjct: 162 GGYGGGGGGY-GGGGRGGGGGGG 183 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 G GGG G G G GG R GG GG GGGG G GRGG Sbjct: 79 GAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGG---GGGGYGGRGGGGRGG 128 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G P GGG G GGG GRG GG + G G GG Sbjct: 76 GPDGAPVQGNSGGGSSGGRG-GFGGGRGGGRGSGGGYGGGGGGYGG 120 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 EGGGG G G G G GG GG GGGG G G Sbjct: 146 EGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGGGG G GGG G GGGG G Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GA G GG+ G GG G GRG GG G Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYG 112 Score = 31.9 bits (69), Expect = 0.63 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGG-GXXXGXGXXXWGXGGARXXGGXRGGA 755 G G + G G GGG GGG G G G G GG GG GG+ Sbjct: 125 GRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGGS 184 Query: 754 XXGGG 740 G Sbjct: 185 CYSCG 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG 761 GG G G GGG GGGG G G G GG+ G G Sbjct: 147 GGGGYGGGGGGYGGGGGYG-GGGGGYGGGGRGGGGGGGSCYSCGESG 192 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 GG GG RGG GGG G G GG G G R Sbjct: 92 GGRGGFGGGRGGGRGSGGGY----GGGGGGYGGRGGGGR 126 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G + G G GGG G GGGG G G GG Sbjct: 124 GGRGGSDCYKCGEPGHMARDCSEGGGGYGG-GGGGYGGGGGYGGGG 168 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 44.8 bits (101), Expect = 8e-05 Identities = 26/80 (32%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP--PXP 871 +PPP P P + P PP P PPPPLP PP P P Sbjct: 40 SPPPSPPPSPSSPPRLPPPFPALFPPEPP---LPPRFELPPPLFPPPPLPRLPPPLLPPP 96 Query: 872 XXXXXXPPPPPRXXXGXPXP 931 PPPPP P P Sbjct: 97 EEPPREPPPPPPPPEEPPPP 116 Score = 35.9 bits (79), Expect = 0.039 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +PPR PP P+P P PP P PPP P PP Sbjct: 45 PPPSPSSPPRLPP-----PFPALFPP----EPPLPPRFELPPPLFPPPPLPRLPP 90 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P P PPP P PP PPR P P Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFP 81 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPP PP PP R PP P P P PPPP+ Sbjct: 89 PPPLLPPPEEPP--REPPPP----PPPPEEPPPPA 117 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP P PP PP P P P P PPP S P Sbjct: 83 PPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPASCLRTKSP 125 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P PP PP +P P P P PP P PP P P PP Sbjct: 35 PLLPLSPPPSPPPSPSSP--PRLPPPFPALFPPEP---PLPPRFELPPPLFPPPP 84 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPP P PPP P PPP P PP Sbjct: 60 PALFPPEPPLPPRFELPPPLFP---PPPLPRLPPPLLPPPEEPPREPPPPP 107 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 44.8 bits (101), Expect = 8e-05 Identities = 25/78 (32%), Positives = 27/78 (34%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PPP P Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP--PYVYKSPPPPPYVYSPPPPPPYVY 177 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 178 QSPPPPPYVYSSPPPPPY 195 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/80 (30%), Positives = 28/80 (35%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP ++ S PP P PPPP PP P Sbjct: 168 SPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPY 225 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 226 VYSSPPPPPYVYKSPPPPPY 245 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/80 (30%), Positives = 26/80 (32%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP P PP P PPPP PP P Sbjct: 139 SPPPPPYVYSS---PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPY 195 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 196 VYKSPPPPPYVYSSPPPPPY 215 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 207 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 208 SSPPPPPYVYKSPPPPPY 225 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 247 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 248 SSPPPPPYVYKSPPPPPY 265 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 267 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 268 SSPPPPPYVYKSPPPPPY 285 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 287 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 288 SSPPPPPYVYSSPPPPPY 305 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYSSPPPPPYVY 307 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 308 SSPPPPPYVYKSPPPPPY 325 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 327 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 328 TSPPPPPYVYKSPPPPPY 345 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P N PP P PPPP PP Sbjct: 74 PYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP-PPYVYSSPPPPPYVYKSPPP 132 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPPP P PP+ Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPY 155 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 69 SPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 125 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 126 VYKSPPPPPYVYSSPPPPPY 145 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/83 (28%), Positives = 26/83 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + S PP P PPPP PP Sbjct: 154 PYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP-PPYVYKSPPPPPYVYSSPPP 212 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPPP P PP+ Sbjct: 213 PPYVYKSPPPPPYVYSSPPPPPY 235 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 179 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 235 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 236 VYKSPPPPPYVYSSPPPPPY 255 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 199 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 255 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 256 VYKSPPPPPYVYSSPPPPPY 275 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 219 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 275 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 276 VYKSPPPPPYVYSSPPPPPY 295 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 239 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 295 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 296 VYSSPPPPPYVYSSPPPPPY 315 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 259 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYSSPPPPPYVYSSPPPPPY 315 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 316 VYKSPPPPPYVYTSPPPPPY 335 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 S PP P PPPP PP P PPPPP P PP+ Sbjct: 68 SSPPP-PPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPY 115 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/77 (29%), Positives = 25/77 (32%) Frame = +2 Query: 707 PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXX 886 PPP P + S PP PPPP PPP P Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP-PPYVYS 148 Query: 887 XPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 149 SPPPPPYVYKSPPPPPY 165 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PPP PPP P PPPPP P PP+ Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYS-SPPPPPYVYNSPPPPPY 95 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA----PPYPHXXXPXP---XXNPPPPSXXXXPPPXXXXPXXXPX 896 PPP + P PP + PPY + P P +PPPP PP P Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 121 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 122 PPPYVYKSPPPP 133 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +3 Query: 729 KTXPPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPPP +PP P + PPY + P PPP+ PP P Sbjct: 338 KSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPA 397 Query: 900 P 902 P Sbjct: 398 P 398 Score = 36.3 bits (80), Expect = 0.029 Identities = 22/83 (26%), Positives = 24/83 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + S PP PPPP PPP Sbjct: 274 PYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPP 333 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPP P P+ Sbjct: 334 PYVYKSPPPPPYVDSYSPPPAPY 356 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP PPY + P +PPPP PP P PP + P P Sbjct: 46 PPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPP 103 Score = 33.1 bits (72), Expect = 0.27 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 5/73 (6%) Frame = +3 Query: 729 KTXPPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--- 893 K+ PPPP +PP P ++PP P +PPP PPP P Sbjct: 318 KSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSY---SPPPAPYVYKPPPYVYKPPPYVYNY 374 Query: 894 XPPXXXXXARPXP 932 PP +P P Sbjct: 375 SPPPAPYVYKPPP 387 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPP-YPHX-XXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 P P P P +PP Y + P P PPP PPP P PP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYN 88 Query: 915 XARPXP 932 P P Sbjct: 89 SPPPPP 94 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/68 (30%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX-N--PPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP +PP +PP P+ P P + PPPP PPP P PP Sbjct: 38 PPYVYNSPPPYVYNSPSPP-PYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYV 96 Query: 909 XXXARPXP 932 P P Sbjct: 97 YSSPPPPP 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P +PP P P PPPP PP P PP Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSP---PPPPYVDSYSPP--PAPYVYKPPP 362 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP--PPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP P+ P P PPP+ PP P P Sbjct: 360 PPPYVYKPPPYVYNYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAP 416 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PP PPP PPPPP P PP+ Sbjct: 47 PYVYNSPSPPPYVYKPPPY---IYSSPPPPPYVYSSPPPPPY 85 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +3 Query: 741 PPPXX---APPRXPPXXRAPPYPHX--XXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +PP P + PPY + P P PPP P P P PP Sbjct: 385 PPPYVYSYSPPPAPYVYKPPPYVYSYSPPPAPYVYKPPPYVYSSPSPPPY--YSSPSPP 441 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G G G GGGG G G G R GG RGGA G Sbjct: 212 GARGGRGGGARGGRGGSRDFGGGGRDFGSSSDRGGRSGGRDFGGRRGGASTSSRGG--KR 269 Query: 721 GXGRGGG 701 G GRGGG Sbjct: 270 GGGRGGG 276 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 RGG GG G GGG GRGG F G G G G Sbjct: 204 RGGRGGRGGARGGRGGGARGGRGGSRDFGGGGRDFGSSSDRG 245 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +3 Query: 729 KTXPPPPXXAPP-RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PPPP PP + PP + P+P P P PPP PPP P PP Sbjct: 73 KKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPP--IKKYPPPEQYPPPIKKYPP 129 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/64 (35%), Positives = 26/64 (40%), Gaps = 6/64 (9%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXPXXX 890 K PPP +PP + PP + PP P P P PPP P PPP P Sbjct: 125 KKYPPPEQYSPPFKKYPPPEQYPP-PIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPE 183 Query: 891 PXPP 902 PP Sbjct: 184 KYPP 187 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PPP PP + PP + PP P P P PPP PPP P PP Sbjct: 151 KKYPPPEHYPPPIKKYPPQEQYPP-PIKKYPPPEKYPPP--IKKYPPPEQYPPPIKKYPP 207 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 6/64 (9%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXPXXX 890 KT P PP PP + PP + P P P PPP P PPP P Sbjct: 92 KTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIK 151 Query: 891 PXPP 902 PP Sbjct: 152 KYPP 155 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P PP PP P P P P PP PP P PP Sbjct: 233 PPPPYKTYPH-PPIKTYPP-PKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPP 285 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 6/64 (9%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXPXXX 890 K PPP PP + PP + P P P P PPP P PPP P Sbjct: 112 KKYPPPEQYPPPIKKYPPPEQYSP-PFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQE 170 Query: 891 PXPP 902 PP Sbjct: 171 QYPP 174 Score = 35.9 bits (79), Expect = 0.039 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PPP PP + PP + PP P P P PPP PPP P P Sbjct: 177 KKYPPPEKYPPPIKKYPPPEQYPP-PIKKYPPPIKKYPPPE--EYPPPIKTYPHPPVKYP 233 Query: 903 XXXXXARPXP 932 P P Sbjct: 234 PPPYKTYPHP 243 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/70 (31%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXP-PXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPPXXXXPXXXPX 896 K PPP PP P P + PP P+ P P PPP PP P Sbjct: 210 KKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKY 269 Query: 897 PPXXXXXARP 926 PP + P Sbjct: 270 PPPVEYPSPP 279 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PP PP + PP + PP P P P PPP PPP P PP Sbjct: 164 KKYPPQEQYPPPIKKYPPPEKYPP-PIKKYPPPEQYPPP--IKKYPPPIKKYPPPEEYPP 220 Query: 903 XXXXXARP 926 P Sbjct: 221 PIKTYPHP 228 Score = 34.7 bits (76), Expect = 0.090 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 7/65 (10%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPP----YP-HXXXPXPXXNPPPPSXXXXPPPXXXXPXX 887 K PPP PP + PP PP YP P P PPP PPP P Sbjct: 138 KKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPPE--KYPPPIKKYPPP 195 Query: 888 XPXPP 902 PP Sbjct: 196 EQYPP 200 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP + PP PP P PPPP PP P PP Sbjct: 199 PPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPP 256 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 5/63 (7%) Frame = +3 Query: 729 KTXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPP--XXXXPXXXP 893 K PPP PP PP + P+P P P P P PPP P P Sbjct: 203 KKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYP 262 Query: 894 XPP 902 PP Sbjct: 263 WPP 265 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 7/61 (11%) Frame = +3 Query: 741 PPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXPXXXPXP 899 PPP PP + PP + PP P P P PP P PPP P P Sbjct: 102 PPPEQYPPPIKKYPPPEQYPP-PIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYP 160 Query: 900 P 902 P Sbjct: 161 P 161 Score = 32.7 bits (71), Expect = 0.36 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 6/61 (9%) Frame = +3 Query: 738 PPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPP---PPSXXXXPPPXXXXPXXXPXP 899 PPP PP PP + PP P PP PP PPP P P Sbjct: 108 PPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYP 167 Query: 900 P 902 P Sbjct: 168 P 168 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 9/58 (15%) Frame = +3 Query: 756 APPRXPPXXRAPP---YP---HXXXPXPXXNPP---PPSXXXXPPPXXXXPXXXPXPP 902 +PP+ PP + PP YP P P +PP PP P P P PP Sbjct: 52 SPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPP 109 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P PP PP YP P PPP PP P PP Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPP 110 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 KT P PP P PP PP H P PPP PP P P Sbjct: 238 KTYPHPPIKTYP--PPKECPPPPEHYPWPPKKKYPPPVEY--PSPPYKKYPPADP 288 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P+ P PP P P P PPP PPP P PP Sbjct: 41 PPFKWGPKFPYSPPKPP-PIEKYPPPVQYPPP--IKKYPPPPYEHPPVKYPPP 90 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPL-----PXXXPPP---XPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPP+ P PPP P PPPP + P PP Sbjct: 194 PPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKT---YPHPP 244 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 820 GXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G G WG GG GG GG GGGG G G GGGG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG GGGG G G WG GG GG GGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG-----K 114 Query: 721 GXGRGGGG 698 G GR G G Sbjct: 115 GKGREGRG 122 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GGGG G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGG--GGGGGGWGWGGGGGGGG 103 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GGGGG G GG G GGGG + G GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 R GG G GGG G GGGG G G GG Sbjct: 56 RSYNGGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGGGG G GGG G GG G G G Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 G G G GGG GGGG G G G GG +G G G V Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRGEFV 125 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF 823 GG G GGGGG G GGG GR G G F Sbjct: 89 GGGGWGWGGGGGGGGWYKWGCG-GGGKGKGREGRGEF 124 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 802 WGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 + G G GG GGGG G G GGGG Sbjct: 58 YNGGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGG 92 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/64 (34%), Positives = 24/64 (37%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP +PP PP APP P P NPPPP P P PP + Sbjct: 118 PPPESSPP-PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPS 176 Query: 921 RPXP 932 P Sbjct: 177 HSPP 180 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/67 (32%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXPPXXX 911 PPP +PP P PP P P +PPPP PP P P PP Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPES 153 Query: 912 XXARPXP 932 + P P Sbjct: 154 PPSLPAP 160 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXX----PXXXPXPPXX 908 PPP +PP P PP P P +PPPP PPP P P PP Sbjct: 71 PPPEPSPPS-PSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Query: 909 XXXARPXPXT 938 P T Sbjct: 130 TEAPPTTPIT 139 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP-XPPXXXX 914 P P PP PP P P P PPP + PPP P P P Sbjct: 78 PSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Query: 915 XARPXPXT 938 P P T Sbjct: 138 ITSPSPPT 145 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY---PHXXXPXPXXNPPPPSXXXXP----PPXXXXPXXXPX 896 PPPP APP P +PP P P P PPS P PP P P Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPS 185 Query: 897 PP 902 PP Sbjct: 186 PP 187 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXAR 923 PP P PP +PP P P P P P PPP P PP + Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPP----PLPTEAPPPANPVSS 117 Query: 924 PXP 932 P P Sbjct: 118 PPP 120 Score = 36.3 bits (80), Expect = 0.029 Identities = 23/70 (32%), Positives = 27/70 (38%), Gaps = 5/70 (7%) Frame = +3 Query: 732 TXPPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPP----PPSXXXXPPPXXXXPXXXPX 896 T PPPP +PP P P + P P P +PP P PPP P P Sbjct: 145 TNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPP----PRHLPS 200 Query: 897 PPXXXXXARP 926 PP + P Sbjct: 201 PPASERPSTP 210 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPX--PXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPP PP PP P P P +P PP+ PPP P PP Sbjct: 106 TEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTN-PPPPPESPPSLPAPDPP 163 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXN-PPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP P P P P P + P PP+ P P PP Sbjct: 168 PPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP P PP P P P PP P PPP P P PP Sbjct: 192 PPPPRHLP--SPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRP--TPSPPSPS 247 Query: 912 XXARP 926 RP Sbjct: 248 DSKRP 252 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P P PP LP PP P PP P PP Sbjct: 137 PITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/59 (27%), Positives = 20/59 (33%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ P PP + + P P P P P +P P PP P PP Sbjct: 237 KRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPP 295 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ PPP P K P PP P P PLP P Sbjct: 225 PKRREQPPP-PGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPP 283 Query: 869 ---PXXXXXXPPPPPRXXXGXPXPP 934 P PP PPR P P Sbjct: 284 TLLPPSSVVSPPSPPRKSVSGPDNP 308 Score = 31.5 bits (68), Expect = 0.83 Identities = 25/88 (28%), Positives = 28/88 (31%), Gaps = 6/88 (6%) Frame = +2 Query: 689 PQXTPPPP-PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX---PXPXXXPPPP--LPX 850 P+ +PPPP P P PP P P PPPP P Sbjct: 96 PEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPP 155 Query: 851 XXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PPP+ PP Sbjct: 156 SLPAPDP---PSNPLPPPKLVPPSHSPP 180 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +2 Query: 782 PGXSXPPXGXPX--PXXXPPPPLPX-XXPPP--XPXXXXXXPPPPPRXXXGXPXP 931 P S PP P P P PP P PPP P P PPP P P Sbjct: 57 PAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/87 (25%), Positives = 22/87 (25%), Gaps = 5/87 (5%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXX---- 856 P PP P P K PP P P P P Sbjct: 158 PAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHP 217 Query: 857 -PPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP PPPP P PP Sbjct: 218 SPPPPGHPKRREQPPPPGSKRPTPSPP 244 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 19/70 (27%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-----XXXPXPP 902 P PP P PP P P PPP P P P P PP Sbjct: 199 PSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPP 258 Query: 903 XXXXXARPXP 932 P P Sbjct: 259 SPPEETLPPP 268 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP R P P P P + P PP P P P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSP 272 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 744 PPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP P +PP P P P PPS PP P P P Sbjct: 45 PTNGNPPETTNTPAQSSPP-PETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEP 98 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 6/56 (10%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP------PPPRXXXGXPXP 931 P P P P P P P PPP P PP PPP P P Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPP-PLPTEAPPPANPVSSPPPESSPPPPPP 129 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 732 TXPPPPXXAPP--RXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 T PPP APP PP +PP P P P +PPPP PPP P P P Sbjct: 56 TSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP--VASPPPATPPPVATPPP 113 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 3/72 (4%) Frame = +3 Query: 732 TXPPPPXXAPP-RXPPXXRAPPYPHXXXPXPXXNPPPPS--XXXXPPPXXXXPXXXPXPP 902 T PPP PP PP P P P P PPP S PPP P P PP Sbjct: 37 TTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Query: 903 XXXXXARPXPXT 938 A P P T Sbjct: 97 ----VASPPPAT 104 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = +3 Query: 732 TXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 T PP PP PP APP P P P PPP+ PPP P P P Sbjct: 30 TPAPPTPTTPPPAATPPPVSAPP-PVTTSPPPVTTAPPPA--NPPPPVSSPPPASPPPAT 86 Query: 906 XXXXARPXP 932 A P P Sbjct: 87 PPPVASPPP 95 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPP PP PP PP P P PPP P P P P P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTT 130 Query: 912 XXARPXP 932 P P Sbjct: 131 KPDSPSP 137 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PP APP A P P P PPP PPP P PP Sbjct: 24 TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP-VTTAPPPANPPPPVSSPPPASP 82 Query: 912 XXARPXP 932 A P P Sbjct: 83 PPATPPP 89 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP---PPPRXXXGXPXPP 934 P + PP P P PPP+ PP P PP PPP PP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPP 94 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/78 (25%), Positives = 22/78 (28%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 TPPP P + P + PP P PPP P P P Sbjct: 38 TPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPV 97 Query: 878 XXXXPPPPPRXXXGXPXP 931 P PP P P Sbjct: 98 ASPPPATPPPVATPPPAP 115 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/80 (26%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL--PXXXPPPXPX 874 PP P P P + PP P P PPP P PPP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVAS 92 Query: 875 XXXXXPPPPPRXXXGXPXPP 934 PPP PP Sbjct: 93 PPPPVASPPPATPPPVATPP 112 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 2/74 (2%) Frame = +2 Query: 689 PQXTPPPPPX--PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P T PPP P P PP P P PP P P Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Query: 863 PXPXXXXXXPPPPP 904 P P PPP Sbjct: 94 PPPVASPPPATPPP 107 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 T PP P +PP P P P P +PP PS P Sbjct: 110 TPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGP 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXPXXXPXPPX 905 T PP PP P PP P P +PP P+ P P PP Sbjct: 86 TPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPL 145 Query: 906 XXXXARPXPXT 938 A P P T Sbjct: 146 PSSDA-PGPST 155 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P PPP PPP P P Sbjct: 26 PPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 732 TXPPPPXXAPP--RXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 T PPP APP PP +PP P P P +PPPP PPP P P P Sbjct: 56 TSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP--VASPPPATPPPVATPPP 113 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 3/72 (4%) Frame = +3 Query: 732 TXPPPPXXAPP-RXPPXXRAPPYPHXXXPXPXXNPPPPS--XXXXPPPXXXXPXXXPXPP 902 T PPP PP PP P P P P PPP S PPP P P PP Sbjct: 37 TTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Query: 903 XXXXXARPXPXT 938 A P P T Sbjct: 97 ----VASPPPAT 104 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = +3 Query: 732 TXPPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 T PP PP PP APP P P P PPP+ PPP P P P Sbjct: 30 TPAPPTPTTPPPAATPPPVSAPP-PVTTSPPPVTTAPPPA--NPPPPVSSPPPASPPPAT 86 Query: 906 XXXXARPXP 932 A P P Sbjct: 87 PPPVASPPP 95 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPP PP PP PP P P PPP P P P P P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTT 130 Query: 912 XXARPXP 932 P P Sbjct: 131 KPDSPSP 137 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PP APP A P P P PPP PPP P PP Sbjct: 24 TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP-VTTAPPPANPPPPVSSPPPASP 82 Query: 912 XXARPXP 932 A P P Sbjct: 83 PPATPPP 89 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP---PPPRXXXGXPXPP 934 P + PP P P PPP+ PP P PP PPP PP Sbjct: 41 PAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPP 94 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/78 (25%), Positives = 22/78 (28%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 TPPP P + P + PP P PPP P P P Sbjct: 38 TPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPV 97 Query: 878 XXXXPPPPPRXXXGXPXP 931 P PP P P Sbjct: 98 ASPPPATPPPVATPPPAP 115 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/80 (26%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL--PXXXPPPXPX 874 PP P P P + PP P P PPP P PPP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVAS 92 Query: 875 XXXXXPPPPPRXXXGXPXPP 934 PPP PP Sbjct: 93 PPPPVASPPPATPPPVATPP 112 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 2/74 (2%) Frame = +2 Query: 689 PQXTPPPPPX--PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P T PPP P P PP P P PP P P Sbjct: 34 PTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Query: 863 PXPXXXXXXPPPPP 904 P P PPP Sbjct: 94 PPPVASPPPATPPP 107 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 T PP P +PP P P P P +PP PS P Sbjct: 110 TPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLPSSDAPGP 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXPXXXPXPPX 905 T PP PP P PP P P +PP P+ P P PP Sbjct: 86 TPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPL 145 Query: 906 XXXXARPXPXT 938 A P P T Sbjct: 146 PSSDA-PGPST 155 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP P PPP PPP P P Sbjct: 26 PPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/83 (30%), Positives = 26/83 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P N S PP PPPP PPP Sbjct: 324 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP 383 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPPP P PP+ Sbjct: 384 PYVYK-SPPPPPYVYSSPPPPPY 405 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/83 (30%), Positives = 26/83 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P N S PP P PPPP PP Sbjct: 124 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP-PPYVYKSPPPPPYVYSSPPP 182 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P PPPPP P PP+ Sbjct: 183 PPYVYKSPPPPPYVYSSPPPPPY 205 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYNSPPPPPYVYKSPPPPPYVY 157 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 158 SSPPPPPYVYKSPPPPPY 175 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 177 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 178 SSPPPPPYVYKSPPPPPY 195 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 197 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 198 SSPPPPPYVYKSPPPPPY 215 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 217 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 218 SSPPPPPYVYKSPPPPPY 235 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 237 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 238 SSPPPPPYVYKSPPPPPY 255 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 257 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 258 SSPPPPPYVYKSPPPPPY 275 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 277 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 278 SSPPPPPYVYKSPPPPPY 295 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 297 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 298 SSPPPPPYVYKSPPPPPY 315 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 317 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 318 SSPPPPPYVYKSPPPPPY 335 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 337 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 338 NSPPPPPYVYKSPPPPPY 355 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 397 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 398 SSPPPPPYVYKSPPPPPY 415 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP--PYVYSSPPPPPYIYKSPPPPPYVY 117 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 118 SSPPPPPYVYKSPPPPPY 135 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 137 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 138 NSPPPPPYVYKSPPPPPY 155 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/67 (34%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP +PP P ++PP P P PPPP PPP P PP Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSP---PPPPYIYKSPPPPPYVYSSPPPPPYIY 107 Query: 912 XXARPXP 932 P P Sbjct: 108 KSPPPPP 114 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 89 SPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYNSPPPPPY 145 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 146 VYKSPPPPPYVYSSPPPPPY 165 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 109 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP---PYVYKSPPPPPYVYSSPPPPPY 165 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 166 VYKSPPPPPYVYSSPPPPPY 185 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 149 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 205 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 206 VYKSPPPPPYVYSSPPPPPY 225 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 169 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 225 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 226 VYKSPPPPPYVYSSPPPPPY 245 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 189 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 245 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 246 VYKSPPPPPYVYSSPPPPPY 265 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 209 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 265 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 266 VYKSPPPPPYVYSSPPPPPY 285 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 229 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 285 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 286 VYKSPPPPPYVYSSPPPPPY 305 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 249 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 305 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 306 VYKSPPPPPYVYSSPPPPPY 325 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 269 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 325 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 326 VYKSPPPPPYVYNSPPPPPY 345 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 349 SPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 405 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 406 VYKSPPPPPYVYSSPPPPPY 425 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 369 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 425 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 426 VYKSPPPPPYVYSSPPPPPY 445 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/67 (34%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP +PP P +PP P P PPPP PPP P PP Sbjct: 321 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSP---PPPPYVYSSPPPSPYVYKSPPPPPYVY 377 Query: 912 XXARPXP 932 P P Sbjct: 378 SSPPPPP 384 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 S PP P PPPP PP P PPPPP P PP+ Sbjct: 48 SSPPP-PPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPY 95 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 S PP PPPP PPP P PPPPP P PP+ Sbjct: 58 SSPPPPPYIYKSPPPPPYVYSSPPP-PPYIYKSPPPPPYVYSSPPPPPY 105 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/78 (29%), Positives = 25/78 (32%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP PP P Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPPPPPYVY 437 Query: 884 XXPPPPPRXXXGXPXPPH 937 PPPPP PP+ Sbjct: 438 SSPPPPPYVYKSPSPPPY 455 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/80 (27%), Positives = 24/80 (30%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 289 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYNSPPPPPY 345 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P P+ Sbjct: 346 VYKSPPPPPYVYSSPPPSPY 365 Score = 36.3 bits (80), Expect = 0.029 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP PP P PPPP PP P Sbjct: 389 SPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPY 445 Query: 878 XXXXPPPPPRXXXGXPXPP 934 P PPP P PP Sbjct: 446 VYKSPSPPPYVYKSPPPPP 464 Score = 34.7 bits (76), Expect = 0.090 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP K+ S PP P PPPP P P Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP--PYVYSSPPPPPYVYKSPSPPPYVY 457 Query: 884 XXPPPPPRXXXGXPXPP 934 PPPPP PP Sbjct: 458 KSPPPPPSYSYSYSSPP 474 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +3 Query: 729 KTXPPPP-XXAPPRXPP-XXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPPP + P PP ++PP P P PPPP P P P PP Sbjct: 408 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP---PPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPX-XRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP + P PP +PP P P PPPP PPP P PP Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSP---PPPPYVYSSPPPPPYIYKSPPPPPYVYS 98 Query: 915 XARPXP 932 P P Sbjct: 99 SPPPPP 104 Score = 33.1 bits (72), Expect = 0.27 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP PP P PPPPP P PP+ Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPY 75 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPPXXXXPXXXPXPP 902 PPP P PP + P P P +P PPP PPP PP Sbjct: 422 PPPYVYKSPPPPPYVYSSPPP---PPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPP 474 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PPPPP P PP+ Sbjct: 32 PPSPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPY 65 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/67 (25%), Positives = 19/67 (28%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP + S PP PPP + PPP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYS 469 Query: 884 XXPPPPP 904 PPPP Sbjct: 470 YSSPPPP 476 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/65 (38%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXW-GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 G G G GGG G G G G GG GG GGGG + G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGA 100 Query: 703 GGXLG 689 GG LG Sbjct: 101 GGGLG 105 Score = 37.1 bits (82), Expect = 0.017 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GG G G G G G G GG GG GG GGGG F Sbjct: 43 GGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGG-LGGG--GGGLLGGGG--FG 97 Query: 724 XGXGRGGGG 698 G G G GG Sbjct: 98 GGAGGGLGG 106 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + G G G G G G G G G G GG GG GG Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGA 100 Query: 751 XGGGG 737 GG G Sbjct: 101 GGGLG 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GG G G G G GGG G GGGG G G G Sbjct: 55 GGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGG 99 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGGGG G GG G G GG G Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGG-GXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G G G G G GGG GGGG G G GG Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/78 (34%), Positives = 29/78 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G GGG + G G G +G G GG RG Sbjct: 9 GGGGAPIPSYGGDG-----YGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Query: 751 XGGGGXVFXXGXGRGGGG 698 GGGG GRG GG Sbjct: 64 GGGGGYQGGDRGGRGSGG 81 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G GGG GG G G G G GG + GG RGG GGGG Sbjct: 31 GGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQ--GGDRGGRGSGGGG 83 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GG G G G G G GG+ G GG G G GGG G Sbjct: 10 GGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG--GGGXFXGXGXPXGG 796 GG G P GG G G G GRG GGG + G G GG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG RG GGG G GGG G GGG G GG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG 76 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 924 GXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 G RGG GGG G GGG G GG G G G P Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCP 91 Score = 29.1 bits (62), Expect(2) = 0.17 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR 764 G G + GG G G GGG GGGG G G GG G R Sbjct: 38 GRGASGGGSYGGRGGYGG----GGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWR 89 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXGXPXGG 796 GG G GGG G GG GRGG G G G GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGG 65 Score = 25.0 bits (52), Expect(2) = 8.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGAR 782 G G G G G GG GGGG G GG R Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGR 84 Score = 23.4 bits (48), Expect(2) = 0.17 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 790 GARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G RGG GG G GRGG G Sbjct: 116 GTSSGANDRGGGGYSRGGGDSDRGGGRGGRNDSG 149 Score = 21.4 bits (43), Expect(2) = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -2 Query: 790 GARXXGGXRGGAX-XGGGGXVFXXGXGRGGGGXLG 689 GA G GA GGGG G GGG G Sbjct: 110 GALAPSGTSSGANDRGGGGYSRGGGDSDRGGGRGG 144 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 42.3 bits (95), Expect = 4e-04 Identities = 27/78 (34%), Positives = 29/78 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A GG G GGG + G G G +G G GG RG Sbjct: 9 GGGGAPIPSYGGDG-----YGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Query: 751 XGGGGXVFXXGXGRGGGG 698 GGGG GRG GG Sbjct: 64 GGGGGYQGGDRGGRGSGG 81 Score = 41.9 bits (94), Expect = 6e-04 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G GGG GG G G G G GG + GG RGG GGGG Sbjct: 31 GGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQ--GGDRGGRGSGGGG 83 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GG G G G G G GG+ G GG G G GGG G Sbjct: 10 GGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGG 68 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG--GGGXFXGXGXPXGG 796 GG G P GG G G G GRG GGG + G G GG Sbjct: 9 GGGGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG RG GGG G GGG G GGG G GG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGG 76 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 924 GXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 G RGG GGG G GGG G GG G G G P Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWRCP 91 Score = 29.1 bits (62), Expect(2) = 0.17 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXR 764 G G + GG G G GGG GGGG G G GG G R Sbjct: 38 GRGASGGGSYGGRGGYGG----GGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGDWR 89 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXX-GRGGGGXFXGXGXPXGG 796 GG G GGG G GG GRGG G G G GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGG 65 Score = 25.0 bits (52), Expect(2) = 8.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGAR 782 G G G G G GG GGGG G GG R Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGR 84 Score = 23.4 bits (48), Expect(2) = 0.17 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 790 GARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G RGG GG G GRGG G Sbjct: 116 GTSSGANDRGGGGYSRGGGDSDRGGGRGGRNDSG 149 Score = 21.4 bits (43), Expect(2) = 8.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -2 Query: 790 GARXXGGXRGGAX-XGGGGXVFXXGXGRGGGGXLG 689 GA G GA GGGG G GGG G Sbjct: 110 GALAPSGTSSGANDRGGGGYSRGGGDSDRGGGRGG 144 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP P PPP P PPPP P PP Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPP 104 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/73 (27%), Positives = 22/73 (30%) Frame = +2 Query: 707 PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXX 886 P P P ++ P PP P P PPPP P P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL 109 Query: 887 XPPPPPRXXXGXP 925 PPPPP P Sbjct: 110 PPPPPPPLHFSSP 122 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPP---PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + PP P P PPP P P PPP PPPPR P PP Sbjct: 65 PPQTPPPP--PPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P P P P P PPP P PP P P PP+ Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPY 95 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P P P PP + PP P P +P P PPP P PP Sbjct: 54 PEPEDYLP--LPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPP 111 Query: 918 ARPXP 932 P P Sbjct: 112 PPPPP 116 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP P + PP P P PPPP+ P P P PP Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTI 520 Query: 918 ARPXP 932 A P P Sbjct: 521 AAPPP 525 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPP P K + PP P PPP P PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPP---PPPGTAAA 548 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPPPP P PP Sbjct: 549 PPPPPPPPGTQAAPPPPP 566 Score = 41.9 bits (94), Expect = 6e-04 Identities = 26/69 (37%), Positives = 27/69 (39%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 K + PPPP PP P APP P P PPPP PPP P PP Sbjct: 504 KGSAPPPPP--PPPLPTTIAAPP-PPPPPPRAAVAPPPP-----PPPPGTAAAPPPPPPP 555 Query: 906 XXXXARPXP 932 A P P Sbjct: 556 PGTQAAPPP 564 Score = 41.9 bits (94), Expect = 6e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP--XXXPXPP 902 PPP PPR PP P P PPPP PPP P P PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P PP P PPPP PPP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP---PGTAAAPPPP-----PPPPGTQA 560 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPPPP P PP Sbjct: 561 APPPPPPPPMQNRAPSPP 578 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 3/81 (3%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXP---GXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 PPPPP P P PP P P PP P PPP Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPP--PPPRA 532 Query: 872 XXXXXXPPPPPRXXXGXPXPP 934 PPPPP P PP Sbjct: 533 AVAPPPPPPPPGTAAAPPPPP 553 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXR-APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K PPPP PP P APP P P PP P P P PP Sbjct: 470 KHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Query: 903 XXXXXARPXP 932 A P P Sbjct: 530 PRAAVAPPPP 539 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 5/86 (5%) Frame = +2 Query: 692 QXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 Q PPPPP P +N G PP P PPP P P Sbjct: 559 QAAPPPPPPPPMQNRAPSPPPMPMGNSGSG-GPPPPPPPMPLANGATPPPPPP--PMAMA 615 Query: 872 XXXXXXPPPPPR-----XXXGXPXPP 934 PPPPPR G P PP Sbjct: 616 NGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 2/71 (2%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXX--NPPPPSXXXXPPPXXXXPXXXPXP 899 K PPPP PP P + P P P P PPPP PPP P P Sbjct: 488 KHFAPPPP--TPPAFKPLKGSAPPPPPPPPLPTTIAAPPPP----PPPPRAAVAPPPPPP 541 Query: 900 PXXXXXARPXP 932 P A P P Sbjct: 542 PPGTAAAPPPP 552 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 5/70 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP-----XXXXPXXXPXPP 902 PPPP P PP P P PPP + PPP P P PP Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Query: 903 XXXXXARPXP 932 P P Sbjct: 570 MQNRAPSPPP 579 Score = 37.1 bits (82), Expect = 0.017 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 13/91 (14%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPL-------PXXXP 859 PPPPP P P PP P PP P+ P P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP-PPMPMGNSGSGGPPPPP 594 Query: 860 PPXPXXXXXXPPPPP------RXXXGXPXPP 934 PP P PPPPP G P PP Sbjct: 595 PPMPLANGATPPPPPPPMAMANGAAGPPPPP 625 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +2 Query: 692 QXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 Q PPPPP P P + PP PPPP P P P Sbjct: 413 QLFPPPPPPPPPP---PLSFIKTASLPLPSPPPT-PPIADIAISMPPPPPPPPPPPAVMP 468 Query: 872 XXXXXXPPPPP 904 PPPPP Sbjct: 469 LKHFAPPPPPP 479 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXA---PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPP PP PP A P P P PPPP PP P P P Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP---PPPPMQNRAPSPPPMPMGN 584 Query: 909 XXXARPXP 932 P P Sbjct: 585 SGSGGPPP 592 Score = 33.1 bits (72), Expect = 0.27 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 10/65 (15%) Frame = +3 Query: 738 PPPPXXA----PPRXPPXXRAPPYPHXXXPXPXXNPPPP------SXXXXPPPXXXXPXX 887 PPPP A PP PP A P P P PPPP + PPP Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSG 586 Query: 888 XPXPP 902 PP Sbjct: 587 SGGPP 591 Score = 32.7 bits (71), Expect = 0.36 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 11/93 (11%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXP--------PPPL 844 P PPPPP K S PP P P PPP Sbjct: 418 PPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP 477 Query: 845 PXXXPPPXPXXXXXXPPPPP---RXXXGXPXPP 934 P P P PPP P + G PP Sbjct: 478 PPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPP 510 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/65 (33%), Positives = 24/65 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP P PPPP P P P PP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP----PPVTDMIKPLSSPPPPQPPPR 99 Query: 918 ARPXP 932 ++P P Sbjct: 100 SQPPP 104 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP----RXXXGXPXPP 934 PP P PPPP P PPP P PPPPP G P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPP------PPPPPAVNMSVETGIPPPP 78 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PQ PPPPP P PP P P P PPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSP---PPPQ 95 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PP PP+ PP Sbjct: 96 PPPRSQPPPKPPQKNLPRRHPP 117 Score = 35.9 bits (79), Expect = 0.039 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 8/73 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXR--------APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPPP PP PP PP P P +PPPP PPP P P Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQ----PPPRSQPP---P 104 Query: 894 XPPXXXXXARPXP 932 PP R P Sbjct: 105 KPPQKNLPRRHPP 117 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 4/77 (5%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPX----XX 856 P PPPPP P P P P PPPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP 103 Query: 857 PPPXPXXXXXXPPPPPR 907 P P PPPPR Sbjct: 104 PKPPQKNLPRRHPPPPR 120 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 PP+ PP + PP P P +PPPP P Sbjct: 93 PPQPPPRSQPPPKPPQKN-LPRRHPPPPRSPEKP 125 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 41.9 bits (94), Expect = 6e-04 Identities = 24/80 (30%), Positives = 26/80 (32%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP P P P P PPPP PPP Sbjct: 423 SPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPP-PPPPSPSPPPPYVYSSPPPP--Y 479 Query: 878 XXXXPPPPPRXXXGXPXPPH 937 PPPPP P PP+ Sbjct: 480 VYSSPPPPPYVYSSPPPPPY 499 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRA---PPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP + PPY + P P +PPPP PPP Sbjct: 495 PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPP 540 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/53 (39%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN-PPPPSXXXXPPPXXXXPXXXP 893 PPPP +P PP ++PP P P N PPPPS PP P P Sbjct: 552 PPPP--SPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/68 (35%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-PXPXXNPPPPSXXXXPPPXXXXPXXXP--XPPXX 908 PPPP +P PP +PP P P +PPPPS PP P P PP Sbjct: 582 PPPP--SPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVT 639 Query: 909 XXXARPXP 932 P P Sbjct: 640 PSPPPPSP 647 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/74 (32%), Positives = 26/74 (35%), Gaps = 9/74 (12%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP-------XXNPPPPSXXXXPPPXXXXPXXXP- 893 PPP + P PP PP P P P +PPPPS PP P P Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPV 573 Query: 894 -XPPXXXXXARPXP 932 PP P P Sbjct: 574 YYPPVTNSPPPPSP 587 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-PXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P PP +P PP +PP P P +PPPPS PP P P Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 + PPPP +P PP PPY + P P +PPPP PP P PP Sbjct: 454 RAYPPPPPPSPS--PP----PPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/68 (33%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-PXPXXNPPPPSXXXXPPPXXXXPXXXP--XPPXX 908 PPPP +P PP +PP P P +PPPPS P P P PP Sbjct: 567 PPPP--SPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVT 624 Query: 909 XXXARPXP 932 P P Sbjct: 625 PSPPPPSP 632 Score = 36.3 bits (80), Expect = 0.029 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 4/72 (5%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGX----SXPPXGXPXPXXXPPPPLPXXXPPPX 868 PPPPP P P S PP P PPPP PPP Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPP-PPYVYSSPPPPYVYSSPPP- 515 Query: 869 PXXXXXXPPPPP 904 P PPPPP Sbjct: 516 PYVYSSPPPPPP 527 Score = 36.3 bits (80), Expect = 0.029 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 7/59 (11%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP-------PRXXXGXPXPPH 937 P S PP P PPPP PPP P PPPP P P PP+ Sbjct: 462 PSPSPPP---PYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPY 517 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/65 (27%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP +P P ++PP P P +PPP P P P P Sbjct: 655 PSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSS 714 Query: 918 ARPXP 932 + P P Sbjct: 715 SPPPP 719 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP +P + PP +A H P PPP PP P P Sbjct: 672 PPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSV 731 Query: 909 XXXARPXP 932 A P P Sbjct: 732 SYDASPPP 739 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 8/90 (8%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX-----GXPX---PXXXPPPPL 844 P TP PPP P S PP G P P PPP Sbjct: 651 PPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEY 710 Query: 845 PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PP P P PP Sbjct: 711 SYSSSPPPPSPTSYFPPMPSVSYDASPPPP 740 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-PXPXXNPPPPSXXXXPPPXXXXP 881 P PP +P PP +PP P P +PPPPS P P Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPP 673 Score = 33.1 bits (72), Expect = 0.27 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XPPXXX 911 PPP P+ P PP P P +PPPPS PP P P PP Sbjct: 598 PPPSPVYYPQVTPSP-PPPSP-LYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTP 655 Query: 912 XXARPXP 932 P P Sbjct: 656 SPPPPSP 662 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX-PXPXXNPPPPSXXXXPPPXXXXP 881 P PP +P PP +PP P P +PPPP+ P P Sbjct: 640 PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPP 688 Score = 32.7 bits (71), Expect = 0.36 Identities = 24/80 (30%), Positives = 26/80 (32%), Gaps = 8/80 (10%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP-- 862 P PP PP P ++ P S P P PPPP P PP Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPS--PVYYPPVTQSPPPPSPVYYPPVT 579 Query: 863 --PXPXXXXXXPP----PPP 904 P P PP PPP Sbjct: 580 NSPPPPSPVYYPPVTYSPPP 599 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX---PXPXXXPPPPLPXXXP 859 P PPPP P S PP P PPPP P P Sbjct: 577 PVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYP 636 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PP P P PP Sbjct: 637 PVTP---SPPPPSPVYYPPVTPSPP 658 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/68 (27%), Positives = 23/68 (33%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K P +PP P +P P P + PS PPP P P PP Sbjct: 414 KMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPP----PPPSPSPPPP 469 Query: 909 XXXARPXP 932 + P P Sbjct: 470 YVYSSPPP 477 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXP--XPPXX 908 PPP + P P +PP P P P + PPP P P P PP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVT 564 Query: 909 XXXARPXP 932 P P Sbjct: 565 QSPPPPSP 572 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX---PXPXXXPPPPLPXXXP 859 P PPPP P S PP P PPPP P P Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 651 Query: 860 PPXPXXXXXXPPPP 901 P P PPPP Sbjct: 652 PVTP-----SPPPP 660 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPPXXXXPXXXPXPP 902 PP +PP P P P P P PP PS P P PP Sbjct: 621 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 5/72 (6%) Frame = +3 Query: 732 TXPPPPXXAP--PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---X 896 T PPP P P PP PP P P + PPP PPP P P Sbjct: 20 TAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITS 79 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 80 PPPTVASSPPPP 91 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/65 (30%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPPXXXXX 917 PP +PP P +PP P P P +P PP PP P P P Sbjct: 109 PPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTT 168 Query: 918 ARPXP 932 P P Sbjct: 169 TSPPP 173 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/64 (34%), Positives = 25/64 (39%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP +PP PP +PP P +PPPP PPP P P P Sbjct: 64 PPPSSSPPPSPPVITSPP------PTVASSPPPPVVIASPPP--STPATTPPAPPQTVSP 115 Query: 921 RPXP 932 P P Sbjct: 116 PPPP 119 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPP P P APP P P P +PPP PPP P PP Sbjct: 19 TTAPPPLQTQPTTPS---APP-PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Query: 912 XXARPXPXT 938 P T Sbjct: 75 PVITSPPPT 83 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX--PPPPLPXXXPP 862 P +PPP P P S P P P PPPP P Sbjct: 66 PSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSP 125 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P P P PP Sbjct: 126 PAPTTTNPPPKPSPSPPGETPSPP 149 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = +3 Query: 738 PPP--PXXAPPRXPPXXRAPPYPHXXX--PXPXXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPP P PP P PP P P P PPP PP P P Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPP 156 Query: 906 XXXXARPXPXT 938 + P P T Sbjct: 157 KPSPSTPTPTT 167 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPP + PP +PP P P PPP+ PPP P P Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP 107 Query: 918 ARP 926 A P Sbjct: 108 APP 110 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP PP P PP P P PPPS PP P PP Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP-APPQTVSPPPPPDAS 122 Query: 915 XARPXPXT 938 + P P T Sbjct: 123 PSPPAPTT 130 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPP 902 PPPP A P P P P P P PP PP P P PP Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPP 172 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP A PP A P P P PP P PPP P P Sbjct: 80 PPPTVASSPPPPVVIASPPP----STPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP 135 Query: 921 RPXP 932 +P P Sbjct: 136 KPSP 139 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/82 (25%), Positives = 22/82 (26%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P PP P N PG + P P P P P PPP Sbjct: 118 PPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSP---PKPSPSTPTPTTTTSPPPP 174 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P P P PP Sbjct: 175 PATSASPPSSNPTDPSTLAPPP 196 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP---PPPSXXXXPPPXXXXPXXXPXPPXX 908 PP P +PP APP P P PPPS PPP P Sbjct: 5 PPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSP 64 Query: 909 XXXARPXP 932 + P P Sbjct: 65 PPSSSPPP 72 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 732 TXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 T PPP P +PP P +PP P P + P P+ PPP Sbjct: 131 TNPPPKPSPSPPGETP---SPPGETPSPPKPSPSTPTPTTTTSPPP 173 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXP 893 PP P + P PP P P NP PS PP P P P Sbjct: 155 PPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKP 207 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PQXTPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXX 856 P TPP PP P + P S P P P PP P Sbjct: 102 PATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPS 161 Query: 857 PPPXPXXXXXXPPPP 901 P P PPPP Sbjct: 162 TPT-PTTTTSPPPPP 175 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/84 (27%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPP--PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 P PP PPP P P S PP P PPP + PP Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPV-ITSPPPTVASSPPP 90 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P PPP P P Sbjct: 91 PV-----VIASPPPSTPATTPPAP 109 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/64 (26%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN-PPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PP +PP+ P P P P + PP S P P P P Sbjct: 148 PPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKP 207 Query: 915 XARP 926 A+P Sbjct: 208 IAKP 211 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G GG G GG GG GG GGGG Sbjct: 86 GGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGE 145 Query: 721 GXGRGGG 701 G G GGG Sbjct: 146 GYGEGGG 152 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG E G G G G+ G GG GGGG G GRGGGG G Sbjct: 87 GGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGG---GGGGRGGGGGSG 142 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G G GG GG GG GGGG Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGG-SGN 143 Query: 721 GXGRGGGGXLG 689 G G G GG G Sbjct: 144 GEGYGEGGGYG 154 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G G G G G G GG GG RGG G G + G G GGG Sbjct: 104 GSGSGGRSGSGRGRGSGGGG-GHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GG RG GGG G GGG G GG G G G G Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 35.1 bits (77), Expect = 0.068 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG-GAXXGGGGXVFXXGXGRGGG 701 G G GGGG G G G GG R GG G G G GG G G GGG Sbjct: 112 GSGRGRGSGGGGGHGGGG----GGGGGRGGGGGSGNGEGYGEGG---GYGGGYGGG 160 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G RG G G G GGG GGGG G G GG Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGG 151 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGGG G GG G Sbjct: 56 GSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGRSGSGR 115 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G G G G GGGG G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRG 136 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 G G G GGG GGGG G G G G GG GG GG Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGS-GNGEGYGEGGGYGGGYGGG 160 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/56 (37%), Positives = 23/56 (41%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 GR+ G G G GGG GGGG G G +G GG GG GG Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEG---YGEGGG-YGGGYGGG 160 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXX-GXGGGXXXGRGGG 832 GG G RGGGGG G GGG G GGG Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GG G G A G G+ Sbjct: 43 GIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSH 102 Query: 751 XG-GGGXVFXXGXGRGGGGXLG 689 G G G G GRG GG G Sbjct: 103 AGSGSGGRSGSGRGRGSGGGGG 124 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGGGG G G G G G GG + G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGG G GGGG G G G E G Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G G G G GGGG G G G G G GG GG G Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGG--GGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG---GGGXFXGXG 811 G G GGGG G GGG G G GGG G G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/51 (45%), Positives = 24/51 (47%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PG S PP P P PPP P PPP P PPPPP+ P PP Sbjct: 260 PGRSAPP---PPPAAAPPPQPP---PPPPP---KPQPPPPPKIARPPPAPP 301 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP APP PP APP P P PPPP PPP Sbjct: 259 PPGRSAPP--PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P + PP APP P P P PPPP PPP P PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQP-PPPPPPKPQPPPPPKIARPPPAPP 301 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP 839 PPP PP+ PP PP P P PPP Sbjct: 267 PPPAAAPPPQPPPP--PPPKPQPPPPPKIARPPP 298 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP 800 PPPP PP P R PP P Sbjct: 280 PPPPKPQPPPPPKIARPPPAP 300 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPP-PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P PPP P PPP P PPPPP P PP+ Sbjct: 44 PPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPY 91 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP PPPP PPP P PP PP P PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/79 (26%), Positives = 22/79 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P + P P P PPPP PP Sbjct: 49 PYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPP 108 Query: 869 PXXXXXXPPPPPRXXXGXP 925 P PPPPP P Sbjct: 109 PTYIYNSPPPPPYVYKSVP 127 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXX-PPPXPXXXXXXPPPPPRXXXGXPXPPH 937 S PP P PPPP P PP P PPPPP P P + Sbjct: 63 SSPPP-PPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTY 111 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P PP P PP P PPPP P PP+ Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPY 121 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/70 (30%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PP P +PP P +PP P P +PP P PP P PP Sbjct: 53 KSPPPSPYLYSSPPPPPYVYNSPPPP---PPYIYNSPPRPPYVYKSPPPPPFVYSSPPPP 109 Query: 903 XXXXXARPXP 932 + P P Sbjct: 110 TYIYNSPPPP 119 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPP---PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PP P PPP P PPPPP P PP Sbjct: 32 PQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSS-PPPPPYVYNSPPPPP 79 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXPPPXXXXPXXXPXPPXXXXXAR 923 P PP+ P +PP P P +PPP P PPP P PP + Sbjct: 32 PQSPPPQ--PYVYSPPLPS---PYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSP 86 Query: 924 PXP 932 P P Sbjct: 87 PRP 89 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPPP P PPPPP P PP+ Sbjct: 156 PPPPPYVYNSAPRVLFIYSSPPPPPYVYNSPPPPPY 191 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPP--XXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 P P +PP P PP P+ P PPP PPP P PP Sbjct: 37 PQPYVYSPPLPSPYVYKSPPPSPYLYSSPP---PPPYVYNSPPPPPPYIYNSPPRPPYVY 93 Query: 912 XXARPXP 932 P P Sbjct: 94 KSPPPPP 100 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/83 (24%), Positives = 21/83 (25%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P N P P P PPPP PP Sbjct: 59 PYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPP 118 Query: 869 PXXXXXXPPPPPRXXXGXPXPPH 937 P P P PP+ Sbjct: 119 PPYVYKSVPRITFIYSSPPPPPY 141 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX-PXX--NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP PPY + P P +PPPP P P PP Sbjct: 176 PPPPPYVYNSPPP----PPYVYESVPRIPFIYSSPPPPPYVYNSAPRIPFIYSSPPPPPY 231 Query: 909 XXXARP 926 + P Sbjct: 232 VYNSAP 237 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP P N S PP PPPP P Sbjct: 75 PPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYS 134 Query: 884 XXPPPPPRXXXGXPXPP 934 PPPPP P P Sbjct: 135 S-PPPPPYVYNSAPRIP 150 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/75 (30%), Positives = 27/75 (36%), Gaps = 4/75 (5%) Frame = +3 Query: 726 KKTXPP---PPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 K PP PP PP P + P PH P +P PP+ P P P Sbjct: 53 KPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHP 112 Query: 894 XPPXXXXXARPXPXT 938 PP +P P T Sbjct: 113 KPPIVKPPTKPPPST 127 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXPP 902 T PPP PP P P PH P P PPP P+ PP P P P Sbjct: 132 TKPPPSTPKPPTTKPPPSTPKPPH-HKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTP 190 Query: 903 XXXXXARPXP 932 P P Sbjct: 191 TPPVVTPPTP 200 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPP PP P P P P PP P+ PP P P P Sbjct: 144 TKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPP 203 Query: 912 XXARPXP 932 P P Sbjct: 204 VITPPTP 210 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 8/76 (10%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--------PSXXXXPPPXXXXPX 884 K P PP PP P + P+P P PPP P PP P Sbjct: 89 KPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPP 148 Query: 885 XXPXPPXXXXXARPXP 932 P PP P P Sbjct: 149 STPKPPHHKPPPTPCP 164 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP PP P P P P P + PPP+ P P P P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPP--STPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI 185 Query: 918 ARPXP 932 P P Sbjct: 186 TPPTP 190 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP--PPPPRXXXGXPXPP 934 P + PP P P PPP P P P P P P PP P PP Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/72 (31%), Positives = 26/72 (36%), Gaps = 2/72 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPH-XXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP-P 902 K P PP P PP + PP+P P P PP PPP P P P Sbjct: 80 KPHPKPPTVKPHPKPPTVK-PPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPST 138 Query: 903 XXXXXARPXPXT 938 +P P T Sbjct: 139 PKPPTTKPPPST 150 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP PP P PP P P PP P+ PP P P P Sbjct: 170 PTPPVVTPPTPTPPVITPPTP----TPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVV 225 Query: 918 ARPXP 932 P P Sbjct: 226 TPPTP 230 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP PP P PP P P PP P+ PP P P P Sbjct: 180 PTPPVITPPTPTPPVVTPPTP----TPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVV 235 Query: 918 ARPXP 932 P P Sbjct: 236 TPPTP 240 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/70 (28%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K P PP P PP + P+P P PP P P P P P Sbjct: 71 KPHPKPPTVKPHPKPPTVK--PHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTP 128 Query: 909 XXXARPXPXT 938 +P P T Sbjct: 129 KPPTKPPPST 138 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP PP PP P P P P PP+ PPP P PP Sbjct: 112 PKPPIVKPPTKPP----PSTPKPPTKPPPSTPKPPT--TKPPPSTPKPPHHKPPPTPCPP 165 Query: 918 ARPXP 932 P P Sbjct: 166 PTPTP 170 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPP PP PP + P P P P + P P PP P P PP Sbjct: 121 TKPPPSTPKPPTKPPP--STPKPPTTKPPP--STPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 36.3 bits (80), Expect = 0.029 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P TP PP P P PP P P P PP+ P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPPPSTPKP-PHHKPPPTPCPPPTPTPTPPV-VTPPTPT 181 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P P PP P PP Sbjct: 182 PPVITPPTPTPPVVTPPTPTPP 203 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/63 (30%), Positives = 21/63 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P AP + P PP P P PP P P P P PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKP------PAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPH 82 Query: 918 ARP 926 +P Sbjct: 83 PKP 85 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP-XPPXXXX 914 P PP PP+ PP + PP P P PP PP P PP Sbjct: 47 PKPPAVKPPK-PPAVK-PPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKP 104 Query: 915 XARPXP 932 +P P Sbjct: 105 PTKPHP 110 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P PP PP P PP P P PP P+ PP P P Sbjct: 200 PTPPVITPPTPTPPVITPPTP----TPPVVTPPTPTPPVVTPPTPTPPTPIP 247 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/89 (26%), Positives = 26/89 (29%), Gaps = 6/89 (6%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P P P + P PP P P PP P PPP Sbjct: 68 PTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPT-KPHPHPKPPIVKPPTKPPPS 126 Query: 869 PXXXXXXPPP----PP--RXXXGXPXPPH 937 PPP PP + P PPH Sbjct: 127 TPKPPTKPPPSTPKPPTTKPPPSTPKPPH 155 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPP P PP P PP P PP Sbjct: 123 PPPSTPKPPTKPPPSTP---KPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPX--XXPP 862 P PPP P P P PP P P PP P P P Sbjct: 154 PHHKPPPTPCPPPT---PTPTPPVVTPPTPTPPVITPPTPTP-PVVTPPTPTPPVITPPT 209 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PP P PP Sbjct: 210 PTPPVITPPTPTPPVVTPPTPTPP 233 Score = 31.9 bits (69), Expect = 0.63 Identities = 28/115 (24%), Positives = 28/115 (24%), Gaps = 1/115 (0%) Frame = +2 Query: 593 PPXPGXPXXKNXSXXXXXXXXXXXXXXXXAXXPQXTPPPPPXPXXKNXXXXXXXXXXXXX 772 PP P P K P PP P P K Sbjct: 62 PPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPT 121 Query: 773 XXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP-RXXXGXPXPP 934 P PP P P PP PP P PPP P P PP Sbjct: 122 KPPPSTPKPPT--KPPPSTPKPP-TTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP---PPSXXXXPPPXXXXPXXXPXPPXX 908 P P PP+ P PP P P PP PP+ P P P P PP Sbjct: 32 PSPAPHKPPKHPVKPPKPPAVKPPKP-PAVKPPTPKPPTVKPHPKPPTVKP--HPKPPTV 88 Query: 909 XXXARP 926 +P Sbjct: 89 KPHPKP 94 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P P P PP PP P PP Sbjct: 30 PKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPP 68 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP 833 P PP PP P PP P P P P Sbjct: 220 PTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/84 (28%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXP--PPPLPXXXPP 862 P PPP P P + P + PP P P P P P P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPPTPTPSVPSPTPPVPTD 172 Query: 863 PXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP P PP Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/74 (32%), Positives = 26/74 (35%), Gaps = 7/74 (9%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAP--PYPHXXXPXPXXNPPPPS---XXXXPPPXXXXPXXXPXP- 899 PPP P PP P P P P P +PPPP+ P P P P P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 143 Query: 900 -PXXXXXARPXPXT 938 P P P T Sbjct: 144 VPSPTPPVSPPPPT 157 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP--PPPSXXXXPPPXXXXP-XXXPXPPXX 908 P PP PP P P P P P P P P+ PPP P P PP Sbjct: 93 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVS 152 Query: 909 XXXARPXP 932 P P Sbjct: 153 PPPPTPTP 160 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-XXXPXPPXXXX 914 P PP PP P P P P + P P+ PPP P P PP Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 915 XARPXP 932 P P Sbjct: 137 PPTPTP 142 Score = 36.3 bits (80), Expect = 0.029 Identities = 25/87 (28%), Positives = 27/87 (31%), Gaps = 10/87 (11%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXP--PPPLPXXXPP----- 862 PPPP P + P + PP P P P P P P PP Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPPTPTPSVPSPTPPVSPPPPTPT 141 Query: 863 ---PXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPP P P PP Sbjct: 142 PSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP--PPPSXXXXPPPXXXXPXXXPXPPXXX 911 P PP PP P P P P P P P P+ PPP P P Sbjct: 111 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Query: 912 XXARPXP 932 P P Sbjct: 171 TDPMPSP 177 Score = 36.3 bits (80), Expect = 0.029 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP P P P P P P PPP P P P P PP Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP----PDVTPTPPTPSVP 208 Query: 918 ARP 926 + P Sbjct: 209 SPP 211 Score = 35.9 bits (79), Expect = 0.039 Identities = 24/84 (28%), Positives = 27/84 (32%), Gaps = 2/84 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP P P + P + P P P PPPP+ PPP Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPS--PPPPV--SPPPPT 187 Query: 869 PXXXXXXPP--PPPRXXXGXPXPP 934 P PP P P PP Sbjct: 188 PTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 738 PPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P PP PP P P P P P PPP P P P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTP-PVPTDPMPSPPPPVSPPPPTPTP 190 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 P PP PP P P +P P P P +PPPP P P P P Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVPTDPMP--SPPPPVSPPPPTPTPSVPSPPDVTPTPPT 204 Query: 915 XARPXP 932 + P P Sbjct: 205 PSVPSP 210 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P PP + P P PP P P P P PP+ P P P P Sbjct: 200 PTPPTPSVPSPPDVTPTPPTPSVPSP-PDVTPTPPTPPSVPTPSGSPPYVPP 250 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T P P P PP PP P P P P P P P P P PP Sbjct: 166 TPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSP----PDVTPTPPTPS 221 Query: 912 XXARP 926 + P Sbjct: 222 VPSPP 226 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAP--PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P P P PP P P P P PP+ PP P PP Sbjct: 183 PPPPTPTPSVPSPPDVTPTPPTPSVPSP-PDVTPTPPTPSVPSPP--DVTPTPPTPP 236 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PP P PP + P P P P P PP P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPV 133 Query: 921 RPXPXT 938 P P T Sbjct: 134 SPPPPT 139 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP-PPXXXXPXXXPXPP 902 PPP PP P +PP P P PP P P P P PP Sbjct: 178 PPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 233 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPP---LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP P P PPPP +P PP P PPP P P PP Sbjct: 70 GGYTPPA--PVPPVSPPPPTPSVPSPTPPVSP------PPPTPTPSVPSPTPP 114 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/89 (26%), Positives = 26/89 (29%), Gaps = 7/89 (7%) Frame = +2 Query: 689 PQXTPPPP------PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPX 850 P +PPPP P P P + P P P PPPP P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPV-SPPPPTPT 189 Query: 851 XXPPPXPXXXXXXPPPP-PRXXXGXPXPP 934 P P P P P P PP Sbjct: 190 PSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/65 (27%), Positives = 20/65 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P P PP PP P P + P P PP P P Sbjct: 167 PPVPTDPMPSPPPPVSPPP------PTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 220 Query: 918 ARPXP 932 + P P Sbjct: 221 SVPSP 225 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/82 (25%), Positives = 22/82 (26%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPP P P P P P P PP P PP Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPPDVT----PTPPTPSVPSP-PDVTPTPPTPSVPSPPD 227 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 PP P P P Sbjct: 228 VTPTPPTPPSVPTPSGSPPYVP 249 Score = 28.7 bits (61), Expect = 5.9 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 6/89 (6%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX--PPPPLPXXXPP 862 P TPP P P P PP P P P PP PP Sbjct: 163 PSPTPPVPTDPMPS----PPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPP 218 Query: 863 ----PXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PP PP PP+ Sbjct: 219 TPSVPSPPDVTPTPPTPPSVPTPSGSPPY 247 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP +PP PP ++PP P H P +PPPP PPP P Sbjct: 87 PPPVYKSPP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/72 (33%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP--XXXXPXXXPX 896 K+ PPP P PP ++PP P H P +PPPP PPP P Sbjct: 44 KSPPPPVKHYSP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKS 101 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 102 PPPPVKHYSPPP 113 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 8/59 (13%) Frame = +3 Query: 729 KTXPPPPXXAPP------RXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 K+ PPP +PP PP ++PP P H P +PPPP PPP P Sbjct: 92 KSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 150 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP PP ++PP P H P +PPPP PPP P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 78 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP 866 K+ PPP P PP ++PP P H P +PPPP PPP Sbjct: 116 KSPPPPVKHYSP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXP 881 K PPP P P +PP + P P +PPPP PPP P Sbjct: 67 KHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP 118 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXP 899 K PPP P P +PP + P P + PP PPP P P Sbjct: 35 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSP 94 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 95 PPPVYKSPPPP 105 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPX 896 K+ PPP P PP ++PP P + P P + PP PPP P Sbjct: 76 KSPPPPVKYYSP--PPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 133 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 134 PPPPVKHYSPPP 145 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXP 881 K PPP +PP PP P P P P PPP PPP P Sbjct: 51 KHYSPPPVYKSPP--PPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSP 102 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K PPP P P +PP + P P + PP PPP Sbjct: 107 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 152 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPP-PXXXXPXXXPXPPXX 908 PPPP P P +PP + P P + PPP PP P PP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Query: 909 XXXARPXP 932 P P Sbjct: 154 VKHYSPPP 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSX-XXXPP-PXXXXPXXXPX 896 K+ PPP P PP ++PP P + P +PPPP PP P Sbjct: 60 KSPPPPVKHYSP--PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKS 117 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 118 PPPPVKHYSPPP 129 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP +PP PP ++PP P H P +PPPP PPP P Sbjct: 87 PPPVYKSPP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 134 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/72 (33%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP--XXXXPXXXPX 896 K+ PPP P PP ++PP P H P +PPPP PPP P Sbjct: 44 KSPPPPVKHYSP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKS 101 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 102 PPPPVKHYSPPP 113 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 8/59 (13%) Frame = +3 Query: 729 KTXPPPPXXAPP------RXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 K+ PPP +PP PP ++PP P H P +PPPP PPP P Sbjct: 92 KSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 150 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP PP ++PP P H P +PPPP PPP P Sbjct: 30 PPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSP 78 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP 866 K+ PPP P PP ++PP P H P +PPPP PPP Sbjct: 116 KSPPPPVKHYSP--PPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXP 881 K PPP P P +PP + P P +PPPP PPP P Sbjct: 67 KHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSP 118 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXP 899 K PPP P P +PP + P P + PP PPP P P Sbjct: 35 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSP 94 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 95 PPPVYKSPPPP 105 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP-HXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPX 896 K+ PPP P PP ++PP P + P P + PP PPP P Sbjct: 76 KSPPPPVKYYSP--PPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKS 133 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 134 PPPPVKHYSPPP 145 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXP 881 K PPP +PP PP P P P P PPP PPP P Sbjct: 51 KHYSPPPVYKSPP--PPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSP 102 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K PPP P P +PP + P P + PP PPP Sbjct: 107 KHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP 152 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPP-PXXXXPXXXPXPPXX 908 PPPP P P +PP + P P + PPP PP P PP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 153 Query: 909 XXXARPXP 932 P P Sbjct: 154 VKHYSPPP 161 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSX-XXXPP-PXXXXPXXXPX 896 K+ PPP P PP ++PP P + P +PPPP PP P Sbjct: 60 KSPPPPVKHYSP--PPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKS 117 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 118 PPPPVKHYSPPP 129 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 41.5 bits (93), Expect = 8e-04 Identities = 26/67 (38%), Positives = 26/67 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG GGGG G G G GG G GG GGGG Sbjct: 84 GGYPPLYGTTPPGGGDV---GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDT-GA 139 Query: 721 GXGRGGG 701 G G G G Sbjct: 140 GGGVGSG 146 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GG GG G GGG GGG + G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAG 140 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G P GGGG G GGG G GGGG G G GG Sbjct: 91 GTTPPGGGDVGGGG-----GGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGG G GG G GGGG G GG G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/69 (34%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP P PP +PP P + P P +PPPP PPP P PP Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPP---PPVNLSPPPP 146 Query: 906 XXXXARPXP 932 + P P Sbjct: 147 PVLLSPPPP 155 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXX--PXPXXN--PPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP P PP +PP P P P N PPPP PPP P PP Sbjct: 108 PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP---PPVLFSPPPP 164 Query: 906 XXXXARPXP 932 P P Sbjct: 165 TVTRPPPPP 173 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/69 (34%), Positives = 27/69 (39%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXPPX 905 PPPP PP +PP P + P P N PPPP PPP P PP Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP---PPVLLSPPPP 101 Query: 906 XXXXARPXP 932 + P P Sbjct: 102 PVNLSPPPP 110 Score = 35.9 bits (79), Expect = 0.039 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 10/88 (11%) Frame = +2 Query: 701 PPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PPPP P P N S PP P PPPP PPP Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPP---PPVNLSPPPPPVLLSPPPP 128 Query: 869 PXXXXXXPPP------PPRXXXGXPXPP 934 P PPP PP P PP Sbjct: 129 PVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 35.5 bits (78), Expect = 0.051 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +2 Query: 698 TPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 +PPPPP P P PP P P PPP P PP Sbjct: 106 SPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPP---PPPVLLSPPPPPVLFSPP 162 Query: 866 XPXXXXXXPPPPPRXXXGXPXP 931 P PPPPP P P Sbjct: 163 PP--TVTRPPPPPTITRSPPPP 182 Score = 35.1 bits (77), Expect = 0.068 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +2 Query: 698 TPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 +PPPPP P P PP P P PPP P PP Sbjct: 70 SPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPP---PPPVNLSPPPPPVLLSPP 126 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 127 PPPVLLSPPPPP--VNLSPPPPP 147 Score = 34.7 bits (76), Expect = 0.090 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 4/83 (4%) Frame = +2 Query: 698 TPPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 +PPPP P P N S PP P PPP P PP Sbjct: 53 SPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP----PVLLSPPPPPVNLSPP 108 Query: 866 XPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 109 PPPVNLSPPPPP--VLLSPPPPP 129 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS--XXXXPPPXXXXPXXXPXPPXXX 911 PPPP P P R PP P P P + PPP P PP Sbjct: 153 PPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 Query: 912 XXAR 923 AR Sbjct: 213 QAAR 216 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 4/72 (5%) Frame = +2 Query: 698 TPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 +PPPPP P P PP P P PPP P PP Sbjct: 88 SPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPP---PPPVLLSPPPPPVNLSPP 144 Query: 866 XPXXXXXXPPPP 901 P PPPP Sbjct: 145 PPPVLLSPPPPP 156 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/74 (29%), Positives = 24/74 (32%), Gaps = 4/74 (5%) Frame = +2 Query: 698 TPPPPPX----PXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 +PPPPP P P PP P P PPP PPP Sbjct: 115 SPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPP---PPPVLFSPPPPTVTRPPP 171 Query: 866 XPXXXXXXPPPPPR 907 P PPP P+ Sbjct: 172 PPTITRSPPPPRPQ 185 Score = 32.7 bits (71), Expect = 0.36 Identities = 25/84 (29%), Positives = 26/84 (30%), Gaps = 6/84 (7%) Frame = +2 Query: 701 PPPP----PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PPPP P P N S PP P PPP + PPP Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPP--PPPTITRSPPPPR 183 Query: 869 PXXXXXXP--PPPPRXXXGXPXPP 934 P PPPP G PP Sbjct: 184 PQAAAYYKKTPPPPPYKYGRVYPP 207 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PP P PP P PPPP P PP Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPPPPP--VNLSPPPPP 84 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP PP P PPPP P PP Sbjct: 34 PEPAPLVDLSPPPPPVNISSPPPP---VNLSPPPPPVNLSPPPPP 75 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 10/49 (20%) Frame = +3 Query: 726 KKTXPPPP----XXAPPRXPPXXRAPPYPHXXXPXP------XXNPPPP 842 KKT PPPP PP PP A Y P P +PPPP Sbjct: 191 KKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPP 239 Score = 29.5 bits (63), Expect = 3.4 Identities = 24/85 (28%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P T PPPP ++ P PP PPPP PP Sbjct: 164 PTVTRPPPPPTITRSPPPPRPQAAAYYKKTPP----PPPYKYGRVYPPPPP-----PPQA 214 Query: 869 PXXXXXXPPPPPRXXXG---XPXPP 934 PPPPP G P PP Sbjct: 215 ARSYKRSPPPPPPSKYGRVYSPPPP 239 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXR--APPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPPP PP P +PP P P P PP PP P P PP Sbjct: 103 TPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P S P P P PPP P PP Sbjct: 64 PANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLS 123 Query: 869 PXXXXXXPPPP----PRXXXGXPXPP 934 P PPPP P P PP Sbjct: 124 PPPPAITPPPPLATTPPALPPKPLPP 149 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P P P + PP P P P PP PP P P PP Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITP 112 Query: 918 ARPXPXT 938 P T Sbjct: 113 PPPPAIT 119 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXX-----NPPPPSXXXXPPPXXXXPXXXPXP 899 PP PP PP PP P P P +PPPP+ PP P P P Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPPP PP PP P P P P P PP P PP Sbjct: 111 TPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 167 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXX-XXPPPXXXXPXXXPXPP 902 + T PPP PP PP PP P PPP PPP P P PP Sbjct: 74 QSTSPPPVATTPPALPPKPLPPPLS------PPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/72 (33%), Positives = 25/72 (34%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 PQ TPPPPP P + PP P PP PLP PP Sbjct: 100 PQTTPPPPPAITPP----PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPP- 154 Query: 869 PXXXXXXPPPPP 904 PPPPP Sbjct: 155 ----QTTPPPPP 162 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP P P PP + P + P P + PP PP P P P Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTT 103 Query: 915 XARPXPXT 938 P T Sbjct: 104 PPPPPAIT 111 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 8/62 (12%) Frame = +3 Query: 738 PPPPXXA-----PPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXP 893 PPPP PP P + PP P P P N PPPP PP P P Sbjct: 32 PPPPCICICNPGPPPPQPDPQ-PPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPP 90 Query: 894 XP 899 P Sbjct: 91 KP 92 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 P P +PP PP PP P P P PP S Sbjct: 256 PSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLS 290 Score = 29.5 bits (63), Expect = 3.4 Identities = 24/88 (27%), Positives = 25/88 (28%), Gaps = 6/88 (6%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXX---PPPPL---PX 850 P PPP P + P PP P P PPPP P Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPL 122 Query: 851 XXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP PPPP PP Sbjct: 123 SPPPP------AITPPPPLATTPPALPP 144 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPP 898 PG S P P PP P PPP P PP Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 857 PPPXPXXXXXXP-PPPPRXXXGXPXPP 934 PPP P P PPPP+ P PP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPP 57 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GGG G GG G G GG GG G G GG Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHY 104 Query: 724 XGXGRGGGGXLG 689 G G GGG G Sbjct: 105 GGGGHHGGGGHG 116 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXE--GGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GG G G GGG GG G G G +G GG GG GG Sbjct: 49 GHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 Query: 751 XGGGG 737 GGG Sbjct: 109 HHGGG 113 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGGG G G G G GGGG + G G GG G Sbjct: 57 GGGGHGHGGHNGGGGHGLDGYGGGHGGHYG-GGGGHYGGGGGHGGGGHYGG 106 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGG G G G G GGGG + G G GG Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGG 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 13/65 (20%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRG-------------GAXXGGGGXVFXXGXGRGG 704 EG G G G GG GG G G GGGG + G G GG Sbjct: 41 EGYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGG 100 Query: 703 GGXLG 689 GG G Sbjct: 101 GGHYG 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGG--GGXFXGXGXP 805 GGGGG G GGG G GG GG G P Sbjct: 86 GGGGGHYGGGGGHGGGGHYGGGGHHGGGGHGLNEP 120 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXX--PPPPPRXXXGXPXPP 934 P PP P PP P PPP P PPPPP G P PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP---RXXXGXPXPP 934 P P PPP PPP P PPPPP + G P PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP PP P + P P G P PPP PPP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPP---PPKKGPAAPPPPPPPGKKGAGPPPPPPMS 428 Query: 881 XXXPPPPPRXXXG 919 PP PP G Sbjct: 429 KKGPPKPPGNPKG 441 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPP P PPPPP G PP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPP 409 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP APP PP + P P P PP PPP P PP Sbjct: 388 PPPSAAAPPPPPPPKKGPAAP------PPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 34.7 bits (76), Expect = 0.090 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP---PSXXXXPPPXXXXPXXXPXPPXX 908 P PP A PP PP P P P PPP P+ PPP P PP Sbjct: 373 PAPPGPANQTSPPP---PPPPSAAAPPPP--PPPKKGPAAPPPPPPPGKKGAGPPPPPPM 427 Query: 909 XXXARPXP 932 P P Sbjct: 428 SKKGPPKP 435 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PP P PP P PPPPP+ P PP Sbjct: 372 PPAPPGPANQTSPPPP---PP--PSAAAPPPPPPPKKGPAAPPPP 411 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP P PP P P P PPPPS PPP Sbjct: 146 PPPPESPPPESLP----PPSPESPSP-PSPEPPPPSSLEPPPP 183 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 797 PPXGXPXPXXXPPP----PLPXXXPPPXPXXXXXXPPPP 901 PP P P PPP P P PP P PPPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 G PP P PP P P P P PPPP Sbjct: 144 GQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P PP P PPP P P PP P PP Sbjct: 144 GQPPPPESPP---PESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPP PP P +PP P P PPPP Sbjct: 152 PPPESLPPP--SPESPSPPSPEPPPPSSLEPPPPP 184 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 813 PXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P +PPP S P P P PP P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/81 (35%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + G G G G GGGG G G G G R GG RG Sbjct: 23 GRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDR-GRGYSGRGDGRGRGGGGDRGRGY 81 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G G G GRGGGG G Sbjct: 82 SGRGD-----GHGRGGGGDRG 97 Score = 36.7 bits (81), Expect = 0.022 Identities = 29/79 (36%), Positives = 29/79 (36%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 GR GG G G G G GG G G G G R GG RG G Sbjct: 9 GRGDGRGRGGGGDR-GRGYSGRGDGRGRGGDGDRGYSGR---GDGHGRGGGGDRGRGYSG 64 Query: 745 GGGXVFXXGXGRGGGGXLG 689 G G GRGGGG G Sbjct: 65 RGD-----GRGRGGGGDRG 78 Score = 32.7 bits (71), Expect = 0.36 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GR G G G GGG G G G G G G R G G Sbjct: 32 GRGRGGDGDRGYSGRGDGHGRGGGGDRG-RGYSGRGDGRGRGGGGDRG-RGYSGRGDGHG 89 Query: 751 XGGGGXVFXXGXGRGGG 701 GGGG GRG G Sbjct: 90 RGGGGDRGRGYSGRGRG 106 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 RG G G GGG GRG G G G GG G Sbjct: 58 RGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRG 99 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/82 (34%), Positives = 30/82 (36%), Gaps = 2/82 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG +GGGG G G GG G G Sbjct: 318 GPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPL-DGKMGGGGGGPNGNKGGGGVQM 376 Query: 751 XGG--GGXVFXXGXGRGGGGXL 692 GG GG G G GGGG + Sbjct: 377 NGGPNGGKKGGGGGGGGGGGPM 398 Score = 39.5 bits (88), Expect = 0.003 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G GGGGG GGG G+GGGG G GG P Sbjct: 317 GGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGG-HPLDGKMGGGGGGPNGNKGGGGVQ 375 Query: 753 XXXXXXGFFXXGXGGGGG 700 G G GGGGG Sbjct: 376 MNGGPNGGKKGGGGGGGG 393 Score = 39.5 bits (88), Expect = 0.003 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G GGG GGG G G G GG GG Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPM 398 Query: 751 XGGGGXVFXXGXGRGGGG 698 GG F G GGGG Sbjct: 399 SGGLPPGFRPMGGGGGGG 416 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/81 (34%), Positives = 30/81 (37%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG +G G G G GG + GG GG Sbjct: 329 GGGNMGNQNQGGGGKNGGK---GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKK 385 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGGG G GGG G Sbjct: 386 GGGGGG------GGGGGPMSG 400 Score = 37.5 bits (83), Expect = 0.013 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 7/78 (8%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXE--GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF 728 GG G G GGG + GGGG G G G GG GGGG Sbjct: 317 GGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQM 376 Query: 727 XXGX-----GRGGGGXLG 689 G G GGGG G Sbjct: 377 NGGPNGGKKGGGGGGGGG 394 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 7/58 (12%) Frame = -3 Query: 933 GGXGXPXXXR-GGGGGXXXXXXGXGGGXXXG------RGGGGXFXGXGXPXGGXEXPG 781 GG G P + GGGGG G GG G +GGGG G G P G PG Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPG 405 Score = 34.7 bits (76), Expect = 0.090 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G GGG G GG G G G GG + G GGGG Sbjct: 303 GKGMPFPVQMGGGGG----GPGGKKGGPGGGGGNMGNQNQGGGGKNGGK-GGGGHPLDGK 357 Query: 718 XGRGGGGXLG 689 G GGGG G Sbjct: 358 MGGGGGGPNG 367 Score = 34.7 bits (76), Expect = 0.090 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 6/87 (6%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG---GXR- 764 G G GG G GGG G G G G G GG G G R Sbjct: 349 GGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRP 408 Query: 763 -GGAXXGGGG-XVFXXGXGRGGGGXLG 689 GG GGGG G GG +G Sbjct: 409 MGGGGGGGGGPQSMSMPMGGAMGGPMG 435 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/68 (36%), Positives = 27/68 (39%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G + GGG G G G GG GG G GGGG Sbjct: 292 GGPGPAGGKIEGKGMPFPVQMGGG-GGGPGGKKGGPGGG---GGNMGNQNQGGGG----K 343 Query: 721 GXGRGGGG 698 G+GGGG Sbjct: 344 NGGKGGGG 351 Score = 33.1 bits (72), Expect = 0.27 Identities = 26/78 (33%), Positives = 28/78 (35%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXX 751 G G P + GGGG G GG G GGGG G GG + G Sbjct: 303 GKGMPFPVQMGGGG------GGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDG 356 Query: 750 XXXXXGFFXXGXGGGGGV 697 G G GGGGV Sbjct: 357 KMGGGGGGPNGNKGGGGV 374 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GG GGGG G G + GG GGGG +GGG Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGG--GPNGNKGGG 372 Query: 700 G 698 G Sbjct: 373 G 373 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 GGGGG G G G GGGG G G P Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G G G + GG GG GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG--GXVFXXGXGRGGG 701 GG GG G GG GG +GG GGG G G G+ GG Sbjct: 291 GGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGG 346 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG GGGG G GG GG GG GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGG----GGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG G GGGG G G GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 820 GXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G G G G A G + G GGGG G G GGGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGG-----GGGGGGGG 138 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 +GGGGG G G GGGG G G G Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGG G G GGGG G G GG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPLP PPP P PPPPP P PP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPPP P PPP P PPPPP Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 37.1 bits (82), Expect = 0.017 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXPXPP 902 PP PPR ++ P P P PPPP PPP P P PP Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 857 PPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPPP G P PP Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPP 693 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 608 PPGXGGXXXXPXGGGETRCPPPEXXGGGXFXXGGXGG 498 PP GG P GGG PPP G G GG Sbjct: 683 PPPPGGGPPPPPGGG----PPPPPPPPGALGRGAGGG 715 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/48 (52%), Positives = 26/48 (54%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGGG G G +G GG R GG RGG GGG G GRGGGG Sbjct: 91 GGGGSSGGRGG--FGGGGGR--GGGRGGGSYGGGYGGRGSG-GRGGGG 133 Score = 37.9 bits (84), Expect = 0.010 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 3/82 (3%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXW---GXGGARXXGGXRGGA 755 GR GG G G GGG G GG G G G G +GG Sbjct: 98 GRGGFGGGGGRGGGRGGGSYGGGYGG-RGSGGRGGGGGDNSCFKCGEPGHMARECSQGGG 156 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GGG G G GGGG G Sbjct: 157 GYSGGGGGGRYGSGGGGGGGGG 178 Score = 36.7 bits (81), Expect = 0.022 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 14/82 (17%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG--------------ARXXGGXR 764 GG G G GGG GGG G G G GG AR Sbjct: 97 GGRGGFGGGGGRGGGRGGGSYGGG-YGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGG 155 Query: 763 GGAXXGGGGXVFXXGXGRGGGG 698 GG GGGG + G G GGGG Sbjct: 156 GGYSGGGGGGRYGSGGGGGGGG 177 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 G G P GGGG G GGG G G GG G G Sbjct: 80 GPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGG 120 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G GG GGGG G G +G G GG G GGGG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGG----YGGRGSGGRGGGGG 134 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGX--R 764 V GR G GGG GG G G G G GG GG R Sbjct: 67 VDNSGRPKAIEVSGPDGAPVQGNSGGGGS--SGGRGGFGGGGGRGGGRGGGSYGGGYGGR 124 Query: 763 GGAXXGGGG 737 G GGGG Sbjct: 125 GSGGRGGGG 133 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G + G G GGG G GGGG + G GG Sbjct: 131 GGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGG 176 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 G G RGG GG G GGG G GG G G G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GA G GG GG G F G GRGGG Sbjct: 80 GPDGAPVQGNSGGGGSSGGRGG-FGGGGGRGGG 111 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 G G GGGG G GG GRG GG G G Sbjct: 94 GSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G + GG GG GGG G G GG G G Sbjct: 92 GGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PP--PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP AP PP PP P P P PP P+ PPP P P P Sbjct: 100 PPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPA---SPPPAPASPPPAPVSP 153 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRX--PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPP PP PP A P P P P PPP+ PP P P P Sbjct: 110 TVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +3 Query: 732 TXPPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPP APP PP PP P PPP PP P P P Sbjct: 37 TAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATP 96 Score = 35.1 bits (77), Expect = 0.068 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P P AP P P P +PP + PPP P PP Sbjct: 73 PPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPP 127 Score = 34.3 bits (75), Expect = 0.12 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 6/73 (8%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNPP---PPSXXXXPPPXXXXPXXXP- 893 T PP P AP P PP P P P +PP PP PPP P P Sbjct: 80 TSPPAPKVAPVISP--ATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPA 137 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 138 SPPPAPASPPPAP 150 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXPPPXXXXP 881 T PPP +PP P PP P P P PP PS PP P Sbjct: 123 TSPPPTPASPP--PAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 32.7 bits (71), Expect = 0.36 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 3/82 (3%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXP---PXGXPXPXXXPPPPLPXXXPPPX 868 TPPP P P S P P P P PP P P Sbjct: 72 TPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPAS 131 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPP P P P Sbjct: 132 PPPAPASPPPAPASPPPAPVSP 153 Score = 31.5 bits (68), Expect = 0.83 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPPPXPXXK---NXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P TP PP P + P S PP P P PPP P P Sbjct: 75 PAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPP-PAPTSPPPTPAS-P 132 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PP P PP Sbjct: 133 PPAPAS---PPPAPASPPPAPVSPP 154 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 T PPP A P P APP P P PP S PP P Sbjct: 36 TTAPPPTTAAP---PTTAAPP-PTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVI 91 Query: 912 XXARPXP 932 A P P Sbjct: 92 SPATPPP 98 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPP--PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PP PP P PPP PPPPP PP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPP 107 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPPP PP PP PP P PPPP+ Sbjct: 64 PPPPSPPPPACPPPPALPP-PPPKKVSSYCPPPPPA 98 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXP----XXNPPPP 842 PPP PP PP PP P P P PPPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 32.7 bits (71), Expect = 0.36 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP---SXXXXPPP 866 PPPP PP PP P P P P PPPP S PPP Sbjct: 59 PPPPSPPPPSPPP----PACP----PPPALPPPPPKKVSSYCPPPP 96 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P P P PPPP+ PPP P PP Sbjct: 61 PPSPPPPSPPPPACPPPPAL--PPPPPKKVSSYCPPPP 96 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P NPPPPS PPP P P PP Sbjct: 48 PIKCSPSCIQNPPPPS----PPPPSPPPPACPPPP 78 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG--GXRGG 758 G G GG G G GGG G GG G G GG G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Query: 757 AXXGG-GGXVFXXGXGRGGGGXLG 689 + GG GG G GG G G Sbjct: 182 SGAGGYGGDATGHGGAGGGYGSSG 205 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGG-GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GGG G GG G +G GA GG G GGG Sbjct: 145 GGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSS 204 Query: 724 XGXGRGG 704 G G G Sbjct: 205 GGFGSSG 211 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GG GG G GG G G GG G GG G Sbjct: 128 GGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGG-GGXFXGXGXPXGG 796 GG G GGGG G G G G GG GG G G GG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGG 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G G G G GG G G G GGA G GG G G + Sbjct: 158 GGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSGG--FGSSGNTYG 215 Query: 724 XGXGRGGG 701 G G Sbjct: 216 EGSSASAG 223 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGG-GGXFXGXGXPXG-GXEXPGXXXXXXXXXXXXXXXG 733 R GGG G GGG G GG GG G G G G G G Sbjct: 119 RTSGGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Query: 732 FFXXGXGGGGG 700 + G GG GG Sbjct: 179 YGGSGAGGYGG 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGG--GGXFXGXGXPXGGXEXPG 781 GG G GG GG G GG G GG G + G G G + G Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATG 193 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 784 RXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 R GG GG GGGG + G GGG Sbjct: 119 RTSGGGFGGGGYGGGGGGYGGSGGYGGG 146 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G G G G GG GG G G GG G GG Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGY 201 Query: 751 XGGGG 737 GG Sbjct: 202 GSSGG 206 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GG GG G GG G GG G G G G Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAG 198 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 785 GXSXPPXGX--PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 G PP G P P PPP PPP PPP G P PPH Sbjct: 172 GGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPH 224 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 797 PPXGX---PXPXXXPPPPLPXXXPP-PXPXXXXXXPPPPPRXXXGXPXP 931 PP G P PPPP P P P PPPPP G P P Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPP 232 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRX-PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP APP PP PP P P PPP PPP Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPP 192 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP + PP R PP P+ PPP PPP P PP Sbjct: 167 PPPPFGG--QGPPMGRGPPPPYGM------RPPPQQFSGPPPPQYGQRPMIP-PPGGMMR 217 Query: 918 ARPXP 932 P P Sbjct: 218 GPPPP 222 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP R PP + P P P PPP PPP P PP Sbjct: 182 PPPPYG--MRPPPQQFSGPPPPQYGQRPMI-PPPGGMMRGPPP---PPHGMQGPPPPRPG 235 Query: 918 ARPXP 932 P P Sbjct: 236 MPPAP 240 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 785 GXSXPPXGX--PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 G PP G P P PPP PPP PPP G P PPH Sbjct: 172 GGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPH 224 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 797 PPXGX---PXPXXXPPPPLPXXXPP-PXPXXXXXXPPPPPRXXXGXPXP 931 PP G P PPPP P P P PPPPP G P P Sbjct: 184 PPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPP 232 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAPPRX-PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP APP PP PP P P PPP PPP Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPP 192 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP + PP R PP P+ PPP PPP P PP Sbjct: 167 PPPPFGG--QGPPMGRGPPPPYGM------RPPPQQFSGPPPPQYGQRPMIP-PPGGMMR 217 Query: 918 ARPXP 932 P P Sbjct: 218 GPPPP 222 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP R PP + P P P PPP PPP P PP Sbjct: 182 PPPPYG--MRPPPQQFSGPPPPQYGQRPMI-PPPGGMMRGPPP---PPHGMQGPPPPRPG 235 Query: 918 ARPXP 932 P P Sbjct: 236 MPPAP 240 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP P PPPP P PP P PPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P P PPPPL PPP P PPPPP Sbjct: 305 PQKSIPPPPPPPPPPL-LQQPPPPPSVSKAPPPPPP 339 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP RA P P P P PPPP PPP P PP Sbjct: 285 PPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 +K+ PPPP PP PP + PP P P PPPP Sbjct: 306 QKSIPPPP---PPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G S P P PPP PPP P PPPPP P PP Sbjct: 294 GDSTENRADPPPQKSIPPP-----PPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 + PPP PP PP PP P P PPPPS PPP P Sbjct: 300 RADPPPQKSIPPPPPP----PPPPLLQQP-----PPPPSVSKAPPPPPPPP 341 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPP L PPP PPPPP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 797 PPXGXPXPXX--XPPPPLPXXXPPPXPXXXXXXPPPPPR 907 PP P P PPPP PPP P PPPPP+ Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPP------PPPPPK 344 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/59 (37%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +3 Query: 732 TXPPPPXX--APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPP PP P + PPY + P NPPP S PPP P PP Sbjct: 381 TYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSS----PPPSPSYSYSSPPPP 435 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP +PP P ++PPY + P + PPP PPP P P Sbjct: 115 PPPYAYSPPPSPYVYKSPPYVYSSPPPYVYSSPPP-YAYSPPPYAYSPPPSP 165 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/66 (30%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP +PP P ++PPY + P +PPP P PP P P Sbjct: 329 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYA 388 Query: 915 XARPXP 932 + P P Sbjct: 389 YSPPPP 394 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP--XXXXPXXXPXPPXXX 911 PPP +PP P ++PPY + P +PPP PP P PP Sbjct: 154 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYA 213 Query: 912 XXARPXP 932 P P Sbjct: 214 YSPPPSP 220 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 43 PPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 85 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 67 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 109 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 91 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 133 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 209 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 251 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 233 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 275 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 257 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 299 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 281 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 323 Score = 36.7 bits (81), Expect = 0.022 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P ++PPY + P +PPP PP Sbjct: 305 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPP 347 Score = 35.1 bits (77), Expect = 0.068 Identities = 22/71 (30%), Positives = 26/71 (36%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY------PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +PP P ++PPY P+ P P PPPS P P P Sbjct: 178 PPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSP----PYVYSSP 233 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 234 PPYAYSPPPSP 244 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 T PPP + PP + PPY + P P PP PPP P P Sbjct: 47 TYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 102 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP P PPY + P P PP PPP P P Sbjct: 139 PPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 189 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 756 APPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 +PP PP + PPY + P P PP PPP P P Sbjct: 31 SPPSPPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 78 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PP + PPY + P P PP PPP P P Sbjct: 74 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 126 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PP + PPY + P P PP PPP P P Sbjct: 216 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 268 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PP + PPY + P P PP PPP P P Sbjct: 240 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 292 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PP + PPY + P P PP PPP P P Sbjct: 264 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 316 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA--PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP + PP + PPY + P P PP PPP P P Sbjct: 288 PPPSPYVYKSPPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 340 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPP K+ P PP P P PPP PPP Sbjct: 355 PYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPP--PCPDVYKPPPYVYSSPPPY 412 Query: 869 P-XXXXXXPPPPPRXXXGXPXPP 934 PPP P P PP Sbjct: 413 VYNPPPSSPPPSPSYSYSSPPPP 435 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPP P PP P P P PP PPP P Sbjct: 377 PPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP 423 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +PP P PP P+ P PP PPP Sbjct: 147 PPPYAYSPP--PYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPP 187 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 729 KTXPPPPXXA--PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 +T PPP A PP PP PP P P P PPP PPP Sbjct: 57 QTSPPPATAAQPPPNQPPNTTPPPTP-PSSPPPSITPPPSPPQPQPPP 103 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP---PPPSXXXXPPPXXXXPXXXPXP 899 T PP P P +PP P P P PPP+ PPP P P P Sbjct: 41 TQPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXAR 923 PP P PP PP P P P P S P P P PP Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQL 137 Query: 924 PXP 932 P P Sbjct: 138 PDP 140 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY--PHXXXP--XPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP PP PP + PP P P P P P PPP P P Sbjct: 86 PPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQLPDPRP 142 Score = 32.7 bits (71), Expect = 0.36 Identities = 22/73 (30%), Positives = 26/73 (35%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PP PP P + P + PP P P PP P PPP Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQ-------PPPNQPPNTTPPPTPPSSPP-PSITPPPS 95 Query: 869 PXXXXXXPPPPPR 907 P P PPP+ Sbjct: 96 PPQ----PQPPPQ 104 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P + PP PPP PPP PP PP PP Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P PPP PP P P PP PP Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPP 94 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PP P PP P PP PP+ P PP Sbjct: 62 PATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQ-----PQPP 102 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PPPPP P P PP P PPPP PP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPR-LPTHSASPPPPTAPPPPPLGQTRA 786 Query: 881 XXXPPPPP 904 PPPPP Sbjct: 787 PSAPPPPP 794 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K+ PP P APPR P +PP P P P PS PPP Sbjct: 751 KSSPPAPP-APPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP PPPP P PP P PPPPP P PP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPP-PPPPPPAPP 740 Score = 37.5 bits (83), Expect = 0.013 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 14/81 (17%) Frame = +3 Query: 738 PPPPXX------APPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXP-----PPXXXX 878 PPPP PP PP APP P H P P PPPP P Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSS 753 Query: 879 PXXXPXPP-XXXXXARPXPXT 938 P P PP A P P T Sbjct: 754 PPAPPAPPRLPTHSASPPPPT 774 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/73 (28%), Positives = 24/73 (32%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPP P ++ P P P PPPPL P Sbjct: 730 PPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSA 789 Query: 869 PXXXXXXPPPPPR 907 P PPPPP+ Sbjct: 790 P------PPPPPK 796 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ PPPPP P + P P P PPPP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNG 746 Query: 869 PXXXXXXPPPPP 904 PP PP Sbjct: 747 ISAMKSSPPAPP 758 Score = 35.1 bits (77), Expect = 0.068 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 PPPP P P P PPPPP P P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPP-RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP + + PP P P PP P PP P P PP Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPP----PPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXP-XXXXXXPPPPPRXXXGXPXP 931 P S PP P P P PPP PPPPP P P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 29.9 bits (64), Expect = 2.5 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 8/73 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPH--------XXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPPP PP PP APP P P P P P+ PPP P P Sbjct: 727 PPPP---PP--PPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP----PTAPP 777 Query: 894 XPPXXXXXARPXP 932 PP A P Sbjct: 778 PPPLGQTRAPSAP 790 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P PP PP P PPPP PPP P P PP Sbjct: 43 PPPPYRSPVTIPP---PPPVYSRPVAFP---PPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP + P PP +PP P P P +PPPP PP P PP Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPP-PPPIYPPPIYSPPPPP-IYPPPIYSPPPTPISPPP 110 Score = 35.1 bits (77), Expect = 0.068 Identities = 21/72 (29%), Positives = 23/72 (31%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP P PP P P PPP+ PPP Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPP----PPIYSPPPPPIYPPPIYSPPPPPI 93 Query: 869 PXXXXXXPPPPP 904 PPP P Sbjct: 94 YPPPIYSPPPTP 105 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP PPPP+ PPP PPPPP PP Sbjct: 57 PPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPP 102 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 818 PXXXPPPP---LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PPP P PPP P PP Sbjct: 38 PIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP P PP PP P P P +PPP PPP P Sbjct: 75 PPPPPIYP---PPIYSPPPPP--IYPPPIYSPPP--TPISPPPKVHHP 115 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 8/80 (10%) Frame = +3 Query: 687 FPXXXXXXXXXXXKKTXPP---PPXXAPP-----RXPPXXRAPPYPHXXXPXPXXNPPPP 842 FP KK PP PP PP PP PP P P PPP Sbjct: 166 FPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPP 225 Query: 843 SXXXXPPPXXXXPXXXPXPP 902 PPP P P P Sbjct: 226 VPVYKPPPKVELPPPIPKKP 245 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P P PP+ P PP P P P PPP PPP P P P Sbjct: 240 PIPKKPCPPKPPKIEHPPPVP-VYKPPPKIEKPPPVPVYKPPPKIEHP---PPVPVHKLP 295 Query: 918 ARPXP 932 +P P Sbjct: 296 KKPCP 300 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/92 (28%), Positives = 31/92 (33%), Gaps = 11/92 (11%) Frame = +2 Query: 689 PQXTPP---PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX---PXPXXXPPPPLPX 850 P+ +PP PPP P + P PP P P PPP+P Sbjct: 184 PKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPK 243 Query: 851 XXPPPXPXXXXXXPP-----PPPRXXXGXPXP 931 PP P PP PPP+ P P Sbjct: 244 KPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVP 275 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +3 Query: 726 KKTXPP-PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 KK PP PP P P + PP P P PPP P P P P PP Sbjct: 243 KKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLP-KKPCPP 301 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP P P PP P P PPP P P P PP Sbjct: 231 PPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPP 287 Score = 34.7 bits (76), Expect = 0.090 Identities = 22/79 (27%), Positives = 24/79 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP P P P PP P P PPP + PPP P Sbjct: 239 PPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPP---PVPVYKPPPKI--EHPPPVPVHK 293 Query: 881 XXXPPPPPRXXXGXPXPPH 937 P PP+ P P H Sbjct: 294 LPKKPCPPKKVDPPPVPVH 312 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 726 KKTXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 KK PPP P PP P PP P P PPP PPP P P Sbjct: 302 KKVDPPPVPVHKPPTKKP---CPPKKVDPPPVPVHKPPP--KIVIPPPKIEHPPPVP 353 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P P PP P P PPP PPP P P PP Sbjct: 201 PPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPP--KVELPPPIPKKP-CPPKPP 251 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PP PP+ PP P P P P PPP PPP P P Sbjct: 314 PPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVK 373 Query: 909 XXXARPXP 932 P P Sbjct: 374 KPCPPPVP 381 Score = 32.7 bits (71), Expect = 0.36 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-PXXXXPXXXPXPPXXX 911 PP P P+ P P + P P P P PP PP P P PP Sbjct: 287 PPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKI 346 Query: 912 XXARPXP 932 P P Sbjct: 347 EHPPPVP 353 Score = 31.5 bits (68), Expect = 0.83 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 6/75 (8%) Frame = +3 Query: 726 KKTXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXPXXXPX 896 KK PPP P PP P PP P P PPP PP P P Sbjct: 323 KKVDPPPVPVHKPP--PKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPV 380 Query: 897 P---PXXXXXARPXP 932 P P +P P Sbjct: 381 PIYKPPVVIPKKPCP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +3 Query: 738 PPPPXXAPP-----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP + PP PP P P PP P P P P PP Sbjct: 264 PPPKIEKPPPVPVYKPPPKIEHPP-PVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPP 322 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +3 Query: 726 KKTXPPP-PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP-PPXXXXPXXXPXP 899 KK PPP P PP P PP P P PP P PP P P Sbjct: 373 KKPCPPPVPIYKPPVVIPKKPCPP------PVPVYKPPVVVIPKKPCPPLPQLPPLPKFP 426 Query: 900 P 902 P Sbjct: 427 P 427 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/66 (27%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP PP + P + P P P PPP PP P P Sbjct: 169 PPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKK-EIPPPVPVYDPPPKKEVPPPVP 227 Query: 915 XARPXP 932 +P P Sbjct: 228 VYKPPP 233 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GG GGG G G G G A GG GG G G G GRGGG Sbjct: 61 GGGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGGGGHGEEEGGHGIGRGGG 114 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 5/60 (8%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGG-----XRGGAXXGGGGXVFXXGXGRGGGG 698 GG GGGG G GG GG GG GGGG G GGGG Sbjct: 38 GGGGGAHGGGGVHVSVGGAHASVGGGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGG 97 Score = 35.5 bits (78), Expect = 0.051 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GGG GG G G GG GG G A GGG V G GGG Sbjct: 40 GGGAHGGGGVHVSVGGAHASVGGGHASGGGGHASVGG--GHASGGGGHAVEGGGHAGGGG 97 Query: 700 GXLG 689 G G Sbjct: 98 GGHG 101 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 +GGGG G G GGA G GG GGGG G GGG Sbjct: 37 KGGGGGAHGGGGVHVSVGGAHASVG--GGHASGGGGHASVGGGHASGGG 83 Score = 35.1 bits (77), Expect = 0.068 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 4/84 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG--- 761 G G G G GGG GGG G G G G A GG G Sbjct: 45 GGGGVHVSVGGAHASVGGGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGGGGHGEEE 104 Query: 760 -GAXXGGGGXVFXXGXGRGGGGXL 692 G G GG + R GG L Sbjct: 105 GGHGIGRGGGMVHRPATRNGGSTL 128 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P PP PPP LP PPP P PPPP P PPH Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP------PPPPH 54 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PP PP H P PPPP P PP Sbjct: 22 PPPP---PPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPP 78 Query: 918 ARPXP 932 + P P Sbjct: 79 SAPPP 83 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY------PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P PP PP+ PH PPPP PPP P P Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS--XXXXPPPXXXXP 881 P PP PP PP P P P PPPPS PPP P Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVP---PPPPSHQPYSYPPPPPPPP 53 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +3 Query: 762 PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P PP + P P P + PPP PPP P P PP Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPP---VPPPPPSHQPYSYPPPP 49 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PP PPP P PPPP PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPP 47 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S PP P P P P PPP P P P PP Sbjct: 25 PPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPP 75 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P PPPPP P PP Sbjct: 6 PPYPPL-PQPPSQNSLAPPPPPPSLPPPVPPPP 37 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 6/77 (7%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG------ARXXGGXRGGAXXGGG 740 GG G G GGG G G G G G GG GG GGG Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGG 204 Query: 739 GXVFXXGXGRGGGGXLG 689 G V G G G G G Sbjct: 205 GGVDGSGSGSGSGSGGG 221 Score = 37.1 bits (82), Expect = 0.017 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG G G G +G G R A GGGG Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTG-YGSGDGRVSSSGEYSASAGGGGSGEGS 153 Query: 721 GXGRGGGGXLG 689 G G GG G G Sbjct: 154 GGGGGGDGSSG 164 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + G G G G GG G G G GG G G Sbjct: 159 GDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGS 218 Query: 751 XGGGGXVF 728 GG G V+ Sbjct: 219 GGGSGNVY 226 Score = 31.9 bits (69), Expect = 0.63 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G G G G G G GG Sbjct: 98 GGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGG 157 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G G G G G G G Sbjct: 158 GGDGSSGSGSGSGSGSGSGTG 178 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 GG G GGGGG G G G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTG 178 Score = 28.7 bits (61), Expect = 5.9 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G A G G G G G G GG GG GG Sbjct: 52 GGGGASVEGGTEKGIDDNANGYGDGNGNGNAHGRADCPGGIVVGGGGGGGGGGG--GGGG 109 Query: 751 XGGGGXVFXXGXGRGGG 701 GG F G G G G Sbjct: 110 SGGSNGSFFNGSGSGTG 126 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/71 (32%), Positives = 27/71 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGG G G +G G + G G GG G Sbjct: 64 GGGGFGAGGGWIGGSVGGF--GGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDG 121 Query: 721 GXGRGGGGXLG 689 G G+G G +G Sbjct: 122 GAGKGFDGGVG 132 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/71 (35%), Positives = 26/71 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG GGG GGGG G G G G GG G GG G F Sbjct: 71 GGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGA-GKGVDGGAGKGFDG 129 Query: 721 GXGRGGGGXLG 689 G G+G G G Sbjct: 130 GVGKGVDGGAG 140 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGG--ARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GGGG G G GG GG GG GG G G G+G G G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/74 (35%), Positives = 28/74 (37%), Gaps = 3/74 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGG---GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GGG GG G G G G G GG G GG G Sbjct: 84 GGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGV-GKGVDGGAGKG 142 Query: 730 FXXGXGRGGGGXLG 689 F G G+G G +G Sbjct: 143 FDGGVGKGFEGGIG 156 Score = 37.1 bits (82), Expect = 0.017 Identities = 25/82 (30%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGG-ARXXGGXRGGA 755 G G GG G G GG +GG G G GG + G G Sbjct: 83 GGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKG 142 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G F G G+G G +G Sbjct: 143 FDGGVGKGFEGGIGKGIEGGVG 164 Score = 35.5 bits (78), Expect = 0.051 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA---XXGGGGXVFXX 722 G G GG GGG G G GG GG GGA GG G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDG 113 Query: 721 GXGRGGGGXLG 689 G G+G G G Sbjct: 114 GAGKGVDGGAG 124 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 931 GXGRAXXXXXG-GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGA 755 G G+ G G G GG EGG G G GGA G GGA Sbjct: 122 GAGKGFDGGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAGK--GVDGGA 179 Query: 754 XXG-GGGXVFXXGXGRGGGG 698 G GGG G G GGGG Sbjct: 180 IGGIGGGAGKEIGGGIGGGG 199 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/82 (29%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGA-RXXGGXRGGA 755 G G G G G G G GG G G GGA + G G Sbjct: 67 GFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKG 126 Query: 754 XXGGGGXVFXXGXGRGGGGXLG 689 GG G G G+G G +G Sbjct: 127 FDGGVGKGVDGGAGKGFDGGVG 148 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG GGG G GGG G GGGG G G G Sbjct: 60 GGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDG 105 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/71 (29%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGA-RXXGGXRGGAXXGGGGXVFXX 722 G G GG +GG G G GGA + G G GG G Sbjct: 102 GVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEG 161 Query: 721 GXGRGGGGXLG 689 G G+G G G Sbjct: 162 GVGKGFDGGAG 172 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 39.1 bits (87), Expect = 0.004 Identities = 26/71 (36%), Positives = 26/71 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GG G G G GG GG GG GG G Sbjct: 134 GGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGV--GGLGKAGGI 191 Query: 721 GXGRGGGGXLG 689 G G G GG G Sbjct: 192 GVGGGIGGGHG 202 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/72 (36%), Positives = 28/72 (38%), Gaps = 1/72 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFX 725 GG G G GG G GG G G G G A GG GG GGG Sbjct: 124 GGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGL-GGLGGAGGGLGGV 182 Query: 724 XGXGRGGGGXLG 689 G G+ GG +G Sbjct: 183 GGLGKAGGIGVG 194 Score = 36.3 bits (80), Expect = 0.029 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 1/80 (1%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG-GXRGGAXX 749 G A G G GGG G GG G G G GGA G G GG Sbjct: 103 GAAGIGGFHSIGGVGGLGGVGGGVGGLGGVGGGVGGLGGVG-GLGGAGLGGVGGVGGGIG 161 Query: 748 GGGGXVFXXGXGRGGGGXLG 689 GG G G GGG G Sbjct: 162 KAGGIGGLGGLGGAGGGLGG 181 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 1/84 (1%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGG-GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG 761 V G G GG G G G G GG G G G G GG G Sbjct: 81 VGGLGMPLIGGLGGIGKYGGIGGAAGIGGFHSIGGVGGLGGVGGGVGGLGGV-------G 133 Query: 760 GAXXGGGGXVFXXGXGRGGGGXLG 689 G G GG G G GG G +G Sbjct: 134 GGVGGLGGVGGLGGAGLGGVGGVG 157 Score = 33.1 bits (72), Expect = 0.27 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 V G G A GG G G GG G GG G G G G GG GG Sbjct: 142 VGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGL--GKAGGIGVGGGIGG 199 Query: 757 AXXGGGGXV 731 GG + Sbjct: 200 GHGVVGGVI 208 Score = 32.3 bits (70), Expect = 0.48 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXX--WGXGGARXXGGXRGGAX 752 G A G G G G GG G G G G GG GG GG Sbjct: 71 GFAGVGGVAGVGGLGMPLIGGLGGIGKYGGIGGAAGIGGFHSIGGVGGLGGVGGGVGGLG 130 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG G G GG LG Sbjct: 131 GVGGGVGGLGGVGGLGGAGLG 151 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 38.7 bits (86), Expect = 0.005 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GG G GG G G G R GG RG GG G Sbjct: 9 GSSGSGSGGSVSGGSGSGGSGSGGSGSG-GSGSGGRANGRGNGG-RGSGRGGGRGDGRGD 66 Query: 721 GXGRGGGG 698 G G GGGG Sbjct: 67 GRGIGGGG 74 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/76 (31%), Positives = 25/76 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G GG G GG G G R G GG G GG G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGG---RG 61 Query: 718 XGRGGGGXLGXXXRXR 671 GRG G +G R R Sbjct: 62 DGRGDGRGIGGGGRGR 77 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXG-GGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXX 757 GG GG G G G GG GRG GG G G G G Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGGR 75 Query: 756 XXXXXXXGFFXXGXGGGGG 700 F G G G G Sbjct: 76 GRGRIPAAFMGRGRGRGRG 94 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G + G G G G G G G G G R GG RG Sbjct: 7 GSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGR--GGGRGDG- 63 Query: 751 XGGGGXVFXXGXGRG 707 G G + G GRG Sbjct: 64 RGDGRGIGGGGRGRG 78 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G G G GG G GG GR G G G GG G Sbjct: 14 GSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP+ PP PP PH P PPP PPP P PP R P Sbjct: 242 PPQRPPMGGPPPPPHIGGSAP---PPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPP P PP P PPPP P PPH Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPH 276 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXX-----PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP G P P PPPP PP P PPPP G PP Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 37.1 bits (82), Expect = 0.017 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP P PPPP PP P PPPP P PP+ Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPN 287 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPP 863 PPP PR PP APP + P P N PPP+ PP Sbjct: 284 PPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPP 328 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPP---PPRXXXGXPXPP 934 G S PP PPP + PPP PPP PP+ G P PP Sbjct: 258 GGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPP 312 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPP---XXXXPXXXPXPPX 905 PPP APP+ PP + P P PP + PPP P PP Sbjct: 295 PPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPPQYGAVPPP 354 Query: 906 XXXXARP 926 A P Sbjct: 355 QYGGAPP 361 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +3 Query: 738 PPPPXX---APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXP 881 PPPP APP APP PH PPPP+ P PP P Sbjct: 252 PPPPHIGGSAPPPPHMGGSAPPPPHM---GQNYGPPPPNNMGGPRHPPPYGAP 301 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PP--PPXXAPPRXPPXX-RAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP PP P APP PH P PP PPP PP Sbjct: 242 PPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPP--PPHMGQNYGPPPPNNMGGPRHPPP 297 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPS--XXXXPPP 866 K + PPPP +PP PP PP P H PPPPS PPP Sbjct: 34 KYSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPP 84 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP P PPPP P P PPPP G PP Sbjct: 36 SPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPP 83 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPPP P PPPP + P PP Sbjct: 40 PPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPP-----LPXXXPPPXPXXXXXX-PPPPP 904 P PP P P PPP PPP P PPPPP Sbjct: 40 PPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 38.3 bits (85), Expect = 0.007 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G GG GGG G G G GG GGA GG G Sbjct: 128 GPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGAS-GGASGGASGGGPGGASGG 186 Query: 721 GXGRGGGGXLG 689 G G GG G Sbjct: 187 GPGGASGGGPG 197 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG GG G GGA GG GGA GG G G G GG G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGAS--GGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 35.1 bits (77), Expect = 0.068 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 3/74 (4%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGX---GXXXWGXGGARXXGGXRGGAXXGGGGXV 731 G G G GG + GG G G G GGA GG GGA G G Sbjct: 114 GASGDKPGEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGAS--GGASGGASGGASGGA 171 Query: 730 FXXGXGRGGGGXLG 689 G G GG G Sbjct: 172 SGGASGGGPGGASG 185 Score = 31.9 bits (69), Expect = 0.63 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G A GG GG GG G G GGA GG GGA G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGAS--GGGPGGASGG 202 Query: 745 GGGXVFXXGXGRGGGGXLG 689 G G GG G Sbjct: 203 ASGDKPEGAPGDKPGGAWG 221 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGG--GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG P GG GG G GG G GG G G GG Sbjct: 139 GGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGG 186 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 38.3 bits (85), Expect = 0.007 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 7/87 (8%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXP-PXGXPXPXXXP--PPPLPXXXPP-- 862 TP PPP K+ P P P P P P PPP P P Sbjct: 87 TPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTP 146 Query: 863 --PXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PPPP PPH Sbjct: 147 SLPPPTPKKSPPPPPSHHSSSPSNPPH 173 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S P P P PPPP P P P P P P P+ P P Sbjct: 86 STPSPPPPAPKKSPPPPTPKKSPSP-PSLTPFVPHPTPKKSPSPPPTP 132 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/78 (26%), Positives = 24/78 (30%), Gaps = 6/78 (7%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPX-GXPXPXXXP-----PPPLPX 850 P+ +PPPP + P P P P P PPP P Sbjct: 95 PKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPK 154 Query: 851 XXPPPXPXXXXXXPPPPP 904 PPP P P PP Sbjct: 155 KSPPPPPSHHSSSPSNPP 172 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +3 Query: 774 PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P P P P +PPPP+ P P P P P P Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTP 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P P PP PP P PPP PPP PP Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPP 172 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/65 (27%), Positives = 20/65 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P P + P P P P P +P PPS P P P PP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVP--HPTPKKSPSPPPTPSL 134 Query: 918 ARPXP 932 P P Sbjct: 135 PPPAP 139 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 166 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPP----PYIYSSPPPPYY 221 Query: 915 XARPXP 932 P P Sbjct: 222 SPSPKP 227 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPP----PYVYSSPPPPYY 396 Query: 915 XARPXP 932 P P Sbjct: 397 SPSPKP 402 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 441 PPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPP----PYVYSSPPPPYY 496 Query: 915 XARPXP 932 P P Sbjct: 497 SPSPKP 502 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP-YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P +PP Y + P P +P P PPP P PP Sbjct: 568 PPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYV--YNSPPPPYYSP 625 Query: 915 XARP 926 +P Sbjct: 626 SPKP 629 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPP----PYVYSSPPPPYY 673 Query: 915 XARPXP 932 P P Sbjct: 674 SPSPKP 679 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 643 PPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPP----PYVYSSPPPPYY 698 Query: 915 XARPXP 932 P P Sbjct: 699 SPAPKP 704 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 668 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPP----PYVYSSPPPPYY 723 Query: 915 XARPXP 932 P P Sbjct: 724 SPSPKP 729 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P +P P PPP P P Sbjct: 693 PPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPP 747 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 66 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP----PYVYSSPPPPYY 121 Query: 915 XARPXP 932 P P Sbjct: 122 SPSPKP 127 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 191 PPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPP----PYVYSSPPPPYY 246 Query: 915 XARPXP 932 P P Sbjct: 247 SPSPKP 252 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 216 PPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPP----PYVYSSPPPPYY 271 Query: 915 XARPXP 932 P P Sbjct: 272 SPSPKP 277 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 241 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYV--YNSPPPPYYSP 298 Query: 915 XARP 926 +P Sbjct: 299 SPKP 302 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 291 PPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYV--YNSPPPPYYSP 348 Query: 915 XARP 926 +P Sbjct: 349 SPKP 352 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 316 PPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPP----PYVYSSPPPPYY 371 Query: 915 XARPXP 932 P P Sbjct: 372 SPSPKP 377 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 366 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYI--YNSPPPPYYSP 423 Query: 915 XARP 926 +P Sbjct: 424 SPKP 427 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 593 PPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPP----PYVYSSPPPPYY 648 Query: 915 XARPXP 932 P P Sbjct: 649 SPTPKP 654 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P +P P PPP P P Sbjct: 744 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPP 798 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 141 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPPYYSP 198 Query: 915 XARP 926 +P Sbjct: 199 SPKP 202 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/66 (31%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 266 PPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPP----PYVYSFPPPPYY 321 Query: 915 XARPXP 932 P P Sbjct: 322 SPSPKP 327 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 91 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYV--YNSPPPP 144 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PS PPP Sbjct: 466 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPP 510 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/71 (32%), Positives = 27/71 (38%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXPXXXP---XP 899 P P +PP PP + P P P P +PPPP PPP P P P Sbjct: 652 PKPTYKSPP--PPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSP 709 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 710 PPPYVYSSPPP 720 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 116 PPPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 169 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PS PPP Sbjct: 391 PPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPP 435 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P +P P PP P P Sbjct: 491 PPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPP 545 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPH-XXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P P ++PP P+ P P P P PP P PP Sbjct: 491 PPPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHPHVCVCPPPPP 545 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/72 (30%), Positives = 24/72 (33%), Gaps = 8/72 (11%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXP-----XXXPX 896 P P P P +PP P P P +PPPP PPP P P Sbjct: 727 PKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPP 786 Query: 897 PPXXXXXARPXP 932 PP P P Sbjct: 787 PPYVYSSPPPPP 798 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +P P+ PPY + P P +P P + PPP Sbjct: 847 PPPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPP 890 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/78 (29%), Positives = 28/78 (35%), Gaps = 13/78 (16%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNP---------PPPSXXXXPPPXXXXP-- 881 PPPP +P P+ PPY + P P +P PPP PPP P Sbjct: 416 PPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSP 475 Query: 882 -XXXPXPPXXXXXARPXP 932 PP + P P Sbjct: 476 KVVYKSPPPPYVYSSPPP 493 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P P P PP P P Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPP 823 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P P P PP P P Sbjct: 795 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSPPPP 849 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P ++PP Y + P P +P P PPP P PP Sbjct: 40 PPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 94 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP-----PRXXXGXPXPPH 937 P P P P P PP P PPPP P+ P PP+ Sbjct: 718 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPY 764 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XP 899 K+ PPP + P PPY +PPPP PPP P P P Sbjct: 155 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSP 207 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 208 PPPYIYSSPPP 218 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/72 (31%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXP---X 896 K+ PPP + P PPY + P P +PPPP PPP P P Sbjct: 205 KSPPPPYIYSSP-------PPPY-YSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKS 256 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 257 PPPPYVYSSPPP 268 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/72 (31%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXP---X 896 K+ PPP + P PPY + P P +PPPP PPP P P Sbjct: 380 KSPPPPYVYSSP-------PPPY-YSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKS 431 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 432 PPPPYVYSSPPP 443 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/72 (31%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXP---X 896 K+ PPP + P PPY + P P +PPPP PPP P P Sbjct: 582 KSSPPPYVYSSP-------PPPY-YSPAPKPVYKSPPPPYVYNSPPPPYYSPSPKPTYKS 633 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 634 PPPPYVYSSPPP 645 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XP 899 K+ PPP + P PPY +PPPP PPP P P P Sbjct: 632 KSPPPPYVYSSP-------PPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSP 684 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 685 PPPYVYSSPPP 695 Score = 32.3 bits (70), Expect = 0.48 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XP 899 K+ PPP + P PPY +PPPP PPP P P P Sbjct: 682 KSPPPPYVYSSP-------PPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSP 734 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 735 PPPYVYSSPPP 745 Score = 31.9 bits (69), Expect = 0.63 Identities = 22/71 (30%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP---XXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP + P PP P P P P +PPPP P P P P Sbjct: 230 KSPPPPYVYSSP-PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSP-----P 283 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 284 PPYVYNSPPPP 294 Score = 31.9 bits (69), Expect = 0.63 Identities = 22/71 (30%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP---XXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP + P PP P P P P +PPPP P P P P Sbjct: 355 KSPPPPYVYSSP-PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSP-----P 408 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 409 PPYIYNSPPPP 419 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXX-PXPXX-NPPPPSXXXXPPPXXXXP 881 P P P P +PP P+ P P +PPPP PPP P Sbjct: 400 PKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSP 448 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/72 (31%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXP---X 896 K+ PPP + P PPY + P P +PPPP PPP P P Sbjct: 255 KSPPPPYVYSSP-------PPPY-YSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKS 306 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 307 PPPPYVYSFPPP 318 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP---XP 899 K+ PPP PP PPY +PPPP PPP P P P Sbjct: 280 KSPPPPYVY---NSPP----PPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSP 332 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 333 PPPYVYNSPPP 343 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K+ PPP + P PP PPY +PPPP PPP Sbjct: 783 KSPPPPYVYSSP--PP----PPYYSPSPKVEYKSPPPPYVYSSPPP 822 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +P P+ PPY + P P P P PP P P Sbjct: 821 PPPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPPPP 875 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/56 (28%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP--YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P ++PP Y + P P P P PP P P Sbjct: 14 PPPPLYDSPTPKVDYKSPPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPPPP 69 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP P P P P +PPPP P P P PP Sbjct: 182 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPP--YYSPSP---KPVYKSPPPPY 236 Query: 909 XXXARPXP 932 + P P Sbjct: 237 VYSSPPPP 244 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP P P P P +PPPP P P P PP Sbjct: 332 PPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPPPP--YYSPSP---KPTYKSPPPPY 386 Query: 909 XXXARPXP 932 + P P Sbjct: 387 VYSSPPPP 394 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP P P P P +PPPP P P P PP Sbjct: 609 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPP--YYSPTP---KPTYKSPPPPY 663 Query: 909 XXXARPXP 932 + P P Sbjct: 664 VYSSPPPP 671 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP P P P P + PPP P P P PP Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSP--KVEYKSPPPP 763 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/71 (26%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 K+ PPP + P P +P + P P + PPP P P PP Sbjct: 758 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSP----KVEYKSPPP 813 Query: 906 XXXXARPXPXT 938 + P P T Sbjct: 814 PYVYSSPPPPT 824 Score = 28.3 bits (60), Expect = 7.8 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP P P P P +PPPP P P P PP Sbjct: 307 PPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPP--YYSPSP---KPAYKSPPPPY 361 Query: 909 XXXARPXP 932 + P P Sbjct: 362 VYSSPPPP 369 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/69 (30%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPX 905 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 939 PPPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPP 998 Query: 906 XXXXARPXP 932 + P P Sbjct: 999 PYVYSSPPP 1007 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 72 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 125 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 97 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYV--YSSPPPP 150 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 222 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYV--YSSPPPP 275 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 272 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 325 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 322 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 375 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 347 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYV--YSSPPPP 400 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 422 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 475 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 472 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYV--YSSPPPP 525 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 639 PPPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYV--YSSPPPP 692 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 864 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 917 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 889 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 942 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 914 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYV--YSSPPPP 967 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 197 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 250 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 247 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 300 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 297 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 350 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 447 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 500 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 522 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 575 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 547 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 600 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 664 PPPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YSSPPPP 717 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 689 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 742 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 714 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 767 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 739 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 792 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 764 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 817 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 789 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 842 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 814 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 867 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 839 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 892 Score = 35.5 bits (78), Expect = 0.051 Identities = 22/71 (30%), Positives = 27/71 (38%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX---NPPPPSXXXXPPPXXXXP---XXXPXP 899 PPPP P ++PP P+ P P +PPPP PPP P P Sbjct: 55 PPPPLEYSPAPKVDYKSPPPPYYS-PSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 113 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 114 PPPYVYSSPPP 124 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P P P PPP P PP Sbjct: 372 PPPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYV--YSSPPPP 425 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P P+ PPY + P P +P P PPP P PP Sbjct: 397 PPPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 450 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 497 PPPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 550 Score = 35.5 bits (78), Expect = 0.051 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP +P P+ PPY +PPPP PPP P Sbjct: 964 PPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSP 1012 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/49 (32%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP +P P+ PPY + P P +P P PP P Sbjct: 572 PPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAP 620 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP +P P+ PPY + P P +P P PP Sbjct: 122 PPPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPP 164 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P+ PPY + P P +P P PPP P PP Sbjct: 172 PPPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYV--YSSPPPP 225 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +P P PPP P PP Sbjct: 953 KSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 1008 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/55 (27%), Positives = 17/55 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP P + P + P P PP P PP Sbjct: 588 PPPPYVYSSPPPPYYSPSPKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPP 642 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPP 839 PPPP +P P+ PPY + P P +P P Sbjct: 980 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPSYSPSP 1014 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 211 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSP 263 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 264 PPPYVYSSPPP 274 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 261 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSP 313 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 314 PPPYVYSSPPP 324 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 311 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 363 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 364 PPPYVYSSPPP 374 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 336 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSP 388 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 389 PPPYVYSSPPP 399 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 411 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSP 463 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 464 PPPYVYSSPPP 474 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 461 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSP 513 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 514 PPPYVYSSPPP 524 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 653 KSSPPPYVYSSP-------PPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSP 705 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 706 PPPYVYSSPPP 716 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PP P H +PPPP PPP P P Sbjct: 678 KSPPPPYVYSSP-PPPYYSPSPKVH------YKSPPPPYVYSSPPPPYYSPSPKVVYKSP 730 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 731 PPPYVYSSPPP 741 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 853 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 905 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 906 PPPYVYSSPPP 916 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 878 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 930 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 931 PPPYVYSSPPP 941 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 903 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSP 955 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 956 PPPYVYSSPPP 966 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPP 863 K+ PPP + P P +P + P P N PPPS P Sbjct: 136 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPPPSYYSPSP 181 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 236 KSPPPPYVYSSP-------PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 288 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 289 PPPYVYSSPPP 299 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 361 KSPPPPYVYSSP-------PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSP 413 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 414 PPPYVYSSPPP 424 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -2 Query: 865 GGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXL 692 GGG +G GGG G G G G G + G GGGG G GGGG + Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPM 323 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G P GG GG G GG GGG G G P G G Sbjct: 256 GGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGG 306 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G GG GGGG G G GG +GG GGGG G GGG Sbjct: 251 GPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQN--QGGGKNGGGGHPQDGKNGGGGG 308 Query: 700 G 698 G Sbjct: 309 G 309 Score = 32.3 bits (70), Expect = 0.48 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 7/75 (9%) Frame = -2 Query: 901 GGXGXXXGXXXXGG---GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV 731 GG G G GG G GGG G G G G G G GGGG + Sbjct: 264 GGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPM 323 Query: 730 FXXGXG----RGGGG 698 G GGGG Sbjct: 324 AGGVSGGFRPMGGGG 338 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G G G GGA G GGA G G G G+ GGG Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQ--NQGGGKNGGG 295 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -3 Query: 933 GGXGXPXXXR--GGGGGXXXXXXGXGGGXXXGRGGGGXF--XGXGXP 805 GG G P + GGGGG G GGG G G F G G P Sbjct: 293 GGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGGP 339 Score = 30.7 bits (66), Expect = 1.5 Identities = 28/88 (31%), Positives = 30/88 (34%), Gaps = 7/88 (7%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG---GGGXXXGXGXXXWGXGGARXXGGXRG 761 G G G G GGG +G GGG G G GG GG G Sbjct: 271 GKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMA-GGVSG 329 Query: 760 G-AXXGGGG---XVFXXGXGRGGGGXLG 689 G GGGG G G GG +G Sbjct: 330 GFRPMGGGGPQNMSMPMGGQMGMGGPMG 357 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP PPP P PPPP P PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLP--XXXPPPXPXXXXXXPPPPPRXXXGXP 925 PP P PPPP P PPP P P PP G P Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAGGFGHP 275 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 37.9 bits (84), Expect = 0.010 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG GGG G G G GG GA GG V G Sbjct: 144 GGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSG 203 Query: 718 XGRGGGGXLG 689 GGG G Sbjct: 204 SALGGGASAG 213 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G GG GGG G G GG G+ GGGG Sbjct: 124 GAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPA 183 Query: 718 XGRGGGG 698 G GG G Sbjct: 184 LGGGGAG 190 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G G G G G G G G A G G A GG G G G Sbjct: 110 GGGSGSLPTTGSATGAGAGTGSALGGGP---GAGSALGGGAGAGPALGGGAGAGPALGGG 166 Query: 712 RGGGGXLG 689 G G LG Sbjct: 167 AGAGSALG 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 28/84 (33%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GG GGG G G G GA G GG Sbjct: 124 GAGAGTGSALGG-GPGAGSALGGGAGAGPALGGGA--GAGPALGGGAGA---GSALGGGG 177 Query: 751 XGGGGXVFXXGXGRG---GGGXLG 689 G G + G G G GGG G Sbjct: 178 AGAGPALGGGGAGAGPALGGGVAG 201 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG GGG G G G G GGGG G G GG Sbjct: 154 GGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGG--AGAGPALGG 197 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G GGG G G G G GGG G G GG G Sbjct: 165 GGAGAGSALGGGGAGAGPALGGGGAGAGPALGGG--VAGSGSALGGGASAG 213 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXG-GARXXGGXRG-G 758 G G GG G G GGGG G G G G GG G G Sbjct: 144 GGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAGAGPALGGGVAGSG 203 Query: 757 AXXGGG 740 + GGG Sbjct: 204 SALGGG 209 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 37.5 bits (83), Expect = 0.013 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXX--GXGXXXWGXGGARXXGGXR 764 V G G GG G G GGG G GG G G G GGA GG Sbjct: 78 VGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIG 137 Query: 763 GGAXXGGGG 737 G GG G Sbjct: 138 GVGGLGGIG 146 Score = 35.1 bits (77), Expect = 0.068 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 3/84 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGG---GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG 761 G G GG G G GG G GG G G G G G GG G Sbjct: 57 GVGAGLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGG 116 Query: 760 GAXXGGGGXVFXXGXGRGGGGXLG 689 G G G GG G +G Sbjct: 117 DPGIGSGIGGLGGAGGLGGIGGVG 140 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGAR---XXGGXRGGAXXGGGGXVFXXG-XGRGGGGX 695 GG G GG G G G GG GG GG GGG G G GGG Sbjct: 47 GGAAGIGGAGGVGAGLGGVAGGVGGVAGVLPVGGVGGGIGGLGGGVGGLGGLGGLGGGSG 106 Query: 694 LG 689 LG Sbjct: 107 LG 108 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGG 743 GG G G GG G GG G G GG GG GG+ GG Sbjct: 103 GGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLG--GIGGVGGLGGIGGGSDCGG 153 Score = 31.1 bits (67), Expect = 1.1 Identities = 31/80 (38%), Positives = 32/80 (40%), Gaps = 1/80 (1%) Frame = -2 Query: 925 GRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG-GAXX 749 G A GG G G GGG G GG G G G GG GG G G+ Sbjct: 71 GVAGVLPVGGVGGGIGGL--GGGVGGLGGLGGLGGGSGLGH-GVGG---IGGDPGIGSGI 124 Query: 748 GGGGXVFXXGXGRGGGGXLG 689 GG G G G GG G LG Sbjct: 125 GGLGGAGGLG-GIGGVGGLG 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG--GXFXGXGXPXGGXEXPG 781 GG G GGG G G GGG G G G G G G GG G Sbjct: 79 GGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAG 131 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P PP P P P P P P PPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP-SPSPTPGPDSP 217 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP +P PP P P P P + P P P P P P Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDS 225 Query: 918 ARPXP 932 P P Sbjct: 226 PLPLP 230 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 PP P P P PPPPS P P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSP 208 Score = 34.7 bits (76), Expect = 0.090 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P PPP P P PP P P P P P P P Sbjct: 198 PLPLPGPPPSPSP-TPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPS 256 Query: 869 PXXXXXXPPPPPRXXXGXPXP 931 P P P P P P Sbjct: 257 PTPGPDSPLPSPGPDSPLPSP 277 Score = 34.7 bits (76), Expect = 0.090 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P P P P + P S P G P P PP P P P Sbjct: 202 PGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPP-PSPSPTPG 260 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P P P P PP Sbjct: 261 PDSPLPSPGPDSPLPSPGPDPP 282 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/85 (25%), Positives = 23/85 (27%), Gaps = 3/85 (3%) Frame = +2 Query: 689 PQXTPPPP---PXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXP 859 P PPPP P P + P P G P P P P P Sbjct: 171 PSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLP 230 Query: 860 PPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P G P P Sbjct: 231 GPPPSSSPTPGPDSPLPSPGPPPSP 255 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPPP P P P P P P P PP Sbjct: 164 PPPPPPYPSPLPPPP----SPSPTPGPDSPLPSPGPDSPLPLPGPP 205 Score = 33.1 bits (72), Expect = 0.27 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP P PG P P P P P P P P Sbjct: 161 PPLPPPPPPYPSP--------LPPPPSPSPTPGPDSPLPS-PGPDSPLPLPGPPPSPSPT 211 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P P P P P PP Sbjct: 212 PGPDSPLPSPGPDSPLPLPGPP 233 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS 845 PPP +P P P P P P +PP PS Sbjct: 251 PPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPS 285 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAP-PYPHXXXPXPXXNPPPPSXXXXPP 863 P P P PP +P P P P P + P PS PP Sbjct: 240 PGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGGG G GGG GGGG + G G GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 36.7 bits (81), Expect = 0.022 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G G GG GG GG GGGG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF 823 GG G GG GG G GGG G GGG F Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGGF 158 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 GG GGGG G G G GG GG GG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXG-GGGXVFXXGXGRGGGG 698 G GG GG GG G GGG G G GGGG Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GG GG GGGG G G GGGG G Sbjct: 123 GGGGYSGG--GGGYGGGGGGYGGGGGGYGGGGDGG 155 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP AP P+ PPY + P P +P P PPP P PP Sbjct: 585 PPPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 638 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 135 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYV--YSSPPPP 188 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 110 PPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 163 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 160 PPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 213 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 185 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 238 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 210 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 263 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 235 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YGSPPPP 288 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 285 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YGSPPPP 338 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 360 PPPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 413 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 460 PPPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSFPPPP 513 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 485 PPPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 538 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 510 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 563 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 610 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 663 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 260 PPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 313 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 310 PPPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 363 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 335 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 378 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 410 PPPPYYSPSPKVDYKSPPPPYIYSSTPLPYYSPSPKVDYKSPPPPYV--YSSPPPP 463 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 535 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYI--YSSPPPP 588 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +2 Query: 785 GXSXPPXGXPXPXXX---PPPPLPXXXPPPX---PXXXXXXPPPPPRXXXGXPXPPH 937 G PP P P PPPP PPP P PPP G P PP+ Sbjct: 283 GSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPY 339 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P P P PPP P PP Sbjct: 560 PPPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYV--YSSPPPP 613 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPX---PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PPPP PPP P PPP G P PP+ Sbjct: 237 PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPPPPY 289 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 741 PPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +P P+ PPY + P P +P P PPP Sbjct: 386 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 428 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ P Y + P P +P P PPP Sbjct: 660 PPPPYYSPSPKVDYKSSPPQYVYSSPPTPYYSPSPKVTYKSPPP 703 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 830 PPPPLPXXXPPPX---PXXXXXXPPPPPRXXXGXPXPPH 937 PPPP PPP P PPPP P PP+ Sbjct: 451 PPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPPPPY 489 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PP Sbjct: 635 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSSPP 678 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P +P P+ PPY + P P +P P PPP P PP Sbjct: 436 PLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYV--YSSPPPP 488 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 149 KSPPPPYVYSSP-------PPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 201 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 202 PPPYVYSSPPP 212 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 174 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP 226 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 227 PPPYVYSSPPP 237 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 199 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 251 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 252 PPPYVYSSPPP 262 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 549 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSP 601 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 602 PPPYVYSSPPP 612 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 599 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP 651 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 652 PPPYVYSSPPP 662 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/71 (28%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K PPP + P PPY +PPPP PPP P P Sbjct: 474 KPPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSP 526 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 527 PPPYVYSSPPP 537 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 37.5 bits (83), Expect = 0.013 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPP-LPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 P P P P PPPP L PP P PPPPP P Sbjct: 108 PNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASP 156 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P P P P P P P P P P P PPP Sbjct: 68 PNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPP- 126 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PP Sbjct: 127 PDLDTTTAPPPPSTDIPIPPPP 148 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP-PPPRXXXGXPXPPH 937 P S PP PPP PPP P PP PP P P H Sbjct: 120 PEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPSSVVTSPAPVH 172 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN----PPPPSX--XXXPPPXXXXPXXXPXP 899 PP P P PP PP P P P + PPPPS PPP P Sbjct: 101 PPAPIVNPNPPPPSTPNPP-PEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLT 159 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 160 PPSSVVTSPAP 170 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG G GG G G G G GG G GGG Sbjct: 31 GGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTK--GGGDGISGGGHGDGLGCSGGGGDGTK 88 Query: 721 GXGRGGGG 698 G GR G G Sbjct: 89 GGGRRGDG 96 Score = 36.3 bits (80), Expect = 0.029 Identities = 21/56 (37%), Positives = 23/56 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG +GGG G G G GG G + GGGG G G GGG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGG----GGDGTKGGG 65 Score = 35.5 bits (78), Expect = 0.051 Identities = 27/75 (36%), Positives = 28/75 (37%), Gaps = 4/75 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGG----GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGX 734 GG G GGG +GGG G G G G GG GG R G G G Sbjct: 43 GGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRG-- 100 Query: 733 VFXXGXGRGGGGXLG 689 G G G GG G Sbjct: 101 ---LGRGGGRGGWNG 112 Score = 35.1 bits (77), Expect = 0.068 Identities = 26/73 (35%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = -2 Query: 901 GGXGXXXGXXXX--GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF 728 GG G G GGG + GGG G G G GG G +GG GG Sbjct: 16 GGDGTKGGGNTITGGGGEGKKKNGGG-EGGGGEGTSGEGGGGGGDGTKGGGDGISGGG-H 73 Query: 727 XXGXGRGGGGXLG 689 G G GGG G Sbjct: 74 GDGLGCSGGGGDG 86 Score = 33.1 bits (72), Expect = 0.27 Identities = 23/81 (28%), Positives = 25/81 (30%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G G G G G G GG R G G Sbjct: 43 GGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLG 102 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GGG + G G G +G Sbjct: 103 RGGGRGGWNGRKGFSGEGVVG 123 Score = 32.7 bits (71), Expect = 0.36 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRG--GGG 698 GGG GG G G GG GG GGGG G G G GGG Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGG 72 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG G G G GG GG GGG G G GG G G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKK--KNGGGEGGGGEGTSGEGGGGGGDGTKG 63 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGG G G GGG G GG G G GG G Sbjct: 30 GGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISG 70 Score = 29.9 bits (64), Expect = 2.5 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G G GGG GGG G GGG G G G Sbjct: 31 GGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGG 90 Query: 753 XXXXXXGFFXXGXGGGGG 700 G GGG G Sbjct: 91 GRRGDGLGRGLGRGGGRG 108 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP PP + P + PP P PPP PPP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPR---PPPPAPPPGSGGPKPPPPPGPK 409 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPPP P PP Sbjct: 410 GPRPPPPMSLGPKAPRPP 427 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP 866 P +P R P R PP P P P + PPS PPP Sbjct: 146 PSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PP PPR P ++PP P P +PPPP Sbjct: 153 PPKRSRGPPRPPTRPKSPP-PRKSSFPPSRSPPPP 186 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP PP PP P P P PPP S P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP PP + P + PP P PPP PPP P Sbjct: 353 PPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPR---PPPPAPPPGSGGPKPPPPPGPK 409 Query: 881 XXXPPPPPRXXXGXPXPP 934 PPPP P PP Sbjct: 410 GPRPPPPMSLGPKAPRPP 427 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPP 866 P +P R P R PP P P P + PPS PPP Sbjct: 146 PSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PP PPR P ++PP P P +PPPP Sbjct: 153 PPKRSRGPPRPPTRPKSPP-PRKSSFPPSRSPPPP 186 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP PP PP P P P PPP S P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP--XPPXXX 911 PPPP R P PP P P PPP PPP P P PP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPPKTK 75 Query: 912 XXARP 926 +P Sbjct: 76 CSLKP 80 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 818 PXXXPPPPL-----PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPPL P PPP P PPPPP PP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPP 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PLP PPP PPPPP P PP Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPP 59 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P P PPP + PPP P PPP P P Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +2 Query: 830 PPPPL-----PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPPL P PPP PPPPP PP Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 726 KKTXPPPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 ++ P PP PP R P PP P P PP P PP Sbjct: 24 RRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/69 (30%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPX 905 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPP 564 Query: 906 XXXXARPXP 932 + P P Sbjct: 565 PYVYSSPPP 573 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/69 (30%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPX 905 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 722 PPPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPP 781 Query: 906 XXXXARPXP 932 + P P Sbjct: 782 PYVYSSPPP 790 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP AP P+ PPY + P P +P P PPP P PP Sbjct: 763 PPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YSSPPPP 816 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 80 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 133 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 105 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 158 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 130 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 183 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 155 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 208 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 180 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 233 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV--YSSPPPP 258 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 230 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 283 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 255 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV--YSSPPPP 308 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 280 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 333 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 358 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 330 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 383 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 355 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 408 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 380 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 433 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 405 PPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 458 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 430 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV--YSSPPPP 483 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 455 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 508 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 596 PPPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 649 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 813 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 866 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 838 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 891 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 697 PPPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYV--YSSPPPP 750 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 788 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 841 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 863 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYV--YSSPPPP 916 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 533 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 546 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 599 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 571 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYV--YSSPPPP 624 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 621 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 674 Score = 35.1 bits (77), Expect = 0.068 Identities = 21/69 (30%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPX 905 PPPP +P P+ PPY +PPPP PPP P PP Sbjct: 747 PPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPP 806 Query: 906 XXXXARPXP 932 + P P Sbjct: 807 PYVYSSPPP 815 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/69 (30%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPX 905 PPPP +P P+ PPY +PPPP PPP P PP Sbjct: 530 PPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP 589 Query: 906 XXXXARPXP 932 + P P Sbjct: 590 PYVYSSPPP 598 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P PPY + P P +P P PPP P PP Sbjct: 888 PPPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YKSPPPP 941 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP +P P+ PPY + P P +P P PP P P Sbjct: 646 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 700 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P PPY + P P +P P PPP P PP Sbjct: 56 PPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYV--YSSPPPP 108 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP PP P H P P P P PP P P Sbjct: 738 PPPPYVYSSPPPPYYSPSPKVHYKSPPPPYYAPTPKVHYKSPPPPYVYSSPPPP 791 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHX-XXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP + P + PP P+ P P +P P PPP P PP Sbjct: 31 PPPLYSSPLPKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYV--YSSPPPP 83 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +P P PPP P PP Sbjct: 519 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 574 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/73 (28%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 294 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSP 346 Query: 900 PXXXXXARPXPXT 938 P + P P T Sbjct: 347 PPPYVYSSPPPPT 359 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHX-XXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P ++PP P+ P P P P PP P PP Sbjct: 646 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 700 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 69 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 123 Query: 903 XXXXXARPXP 932 + P P Sbjct: 124 PYVYSSPPPP 133 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 94 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 148 Query: 903 XXXXXARPXP 932 + P P Sbjct: 149 PYVYSSPPPP 158 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 119 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 173 Query: 903 XXXXXARPXP 932 + P P Sbjct: 174 PYVYSSPPPP 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 144 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 198 Query: 903 XXXXXARPXP 932 + P P Sbjct: 199 PYVYSSPPPP 208 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 319 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 373 Query: 903 XXXXXARPXP 932 + P P Sbjct: 374 PYVYSSPPPP 383 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 344 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 398 Query: 903 XXXXXARPXP 932 + P P Sbjct: 399 PYVYSSPPPP 408 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/70 (27%), Positives = 26/70 (37%), Gaps = 2/70 (2%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP + P P +P + P P +PPPP+ P P PP Sbjct: 369 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSP-----PP 423 Query: 903 XXXXXARPXP 932 + P P Sbjct: 424 PYVYSSPPPP 433 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/70 (25%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP + P P +P + P P PP P P PP Sbjct: 169 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP----KVEYKSPPPP 224 Query: 909 XXXARPXPXT 938 + P P T Sbjct: 225 YVYSSPPPPT 234 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/70 (25%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP + P P +P + P P PP P P PP Sbjct: 219 KSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP----KVEYKSPPPP 274 Query: 909 XXXARPXPXT 938 + P P T Sbjct: 275 YVYSSPPPPT 284 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/70 (25%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP + P P +P + P P PP P P PP Sbjct: 269 KSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP----KVDYKSPPPP 324 Query: 909 XXXARPXPXT 938 + P P T Sbjct: 325 YVYSSPPPPT 334 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/70 (25%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP + P P +P + P P PP P P PP Sbjct: 394 KSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP----KVEYKSPPPP 449 Query: 909 XXXARPXPXT 938 + P P T Sbjct: 450 YVYSSPPPPT 459 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 585 KSPPPPYVYSSP-------PPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSP 637 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 638 PPPYVYSSPPP 648 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXP 860 K+ PPP + P P +P + P P +PPPPS P Sbjct: 902 KSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPPPPSYSPSP 947 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 194 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP 246 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 247 PPPYVYSSPPP 257 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 244 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP 296 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 297 PPPYVYSSPPP 307 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 419 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSP 471 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 472 PPPYVYSSPPP 482 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP-----PRXXXGXPXPPH 937 P P P P PP P PPPP P+ P PP+ Sbjct: 671 PPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPY 717 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PP P H +PPPP PPP P P Sbjct: 777 KSPPPPYVYSSP-PPPYYSPSPKVH------YKSPPPPYVYSSPPPPYYSPSPKVEYKSP 829 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 830 PPPYVYSSPPP 840 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 802 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 854 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 855 PPPYVYSSPPP 865 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 827 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 879 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 880 PPPYVYSSPPP 890 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 852 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSP 904 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 905 PPPYVYSSPPP 915 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/68 (29%), Positives = 26/68 (38%), Gaps = 10/68 (14%) Frame = +3 Query: 729 KTXPPPPXXAPPRXP-------PXXRAPPYPH---XXXPXPXXNPPPPSXXXXPPPXXXX 878 K+ PPP + P P ++PP+PH P P +P P PPP Sbjct: 660 KSPPPPYVYSSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV- 718 Query: 879 PXXXPXPP 902 P PP Sbjct: 719 -YSSPPPP 725 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 7/54 (12%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPXPXXXXXXP----PPPPRXXXGXPXPPH 937 PP P P PP P PPP P PPP P PPH Sbjct: 673 PPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPPPPH 726 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GGG G G G GG R GG G GGGG F G GR GG Sbjct: 7 GGGGFRGRGGRD-GGGGGRFGGG---GGRFGGGGGRFGGGGGRFGG 48 Score = 36.3 bits (80), Expect = 0.029 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXX--GGGGXVFXXGXGR--GGGGXLG 689 G GG R GG GG GGGG F G GR GGGG G Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFG 47 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RGGGG GGG G GGGG F G G GG Sbjct: 6 RGGGGFRGRGGRDGGGGGRFG-GGGGRFGGGGGRFGG 41 Score = 33.1 bits (72), Expect = 0.27 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G RGG G G GGG G GGG F G G GG G Sbjct: 7 GGGGF--RGRGGRDGGGGGRFGGGGGRFGG--GGGRFGGGGGRFGGFRDEG 53 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXG 773 G G G GG GGGG G G +G GG R G Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -2 Query: 859 GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXG 746 G +GGGG G G +G GG R GG GG G Sbjct: 13 GRGGRDGGGGGRFGGGGGRFGGGGGRFGGG--GGRFGG 48 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 36.7 bits (81), Expect = 0.022 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 784 RXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXR 677 R GG RG GGGG F G GRG GG G R Sbjct: 635 RFGGGGRGNRFGGGGGNRFGGGGGRGRGGSGGRGQR 670 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP---RXXXGXPXPP 934 PP P P PLP PPP PPPPP R P PP Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PPPP PPP PPPPP P PP Sbjct: 15 PPMRGRVPLPPPPPP----PPPPMRRRAPLPPPPPPPMRRRAPLPP 56 Score = 34.7 bits (76), Expect = 0.090 Identities = 27/93 (29%), Positives = 28/93 (30%), Gaps = 12/93 (12%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGX-----PXPXXXPPPPLPXX 853 P PPPPP P + P PP P P PPPPLP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPP-PPPPLPMF 80 Query: 854 XP-------PPXPXXXXXXPPPPPRXXXGXPXP 931 PP PPPP G P P Sbjct: 81 DAEVLCCCYPPTRVRREAPLPPPPLIFVGAPPP 113 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP R P P P P P PPP P PP Sbjct: 24 PPPP---PPPPPPMRRRAPLPPPPPPPMRRRAPLP----PPPPPAMRRRVLPRPP 71 Score = 31.9 bits (69), Expect = 0.63 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP P R PP P P PPPP+ P P Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPP 73 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P PP PP P P PPPP PP P P PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPM-RRRAPLP---PPPP-----PPMRRRAPLPPPPPPAMRRR 65 Query: 918 ARPXP 932 P P Sbjct: 66 VLPRP 70 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP R P PP P P PP P P P Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 36.7 bits (81), Expect = 0.022 Identities = 21/70 (30%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPX-PXXNPP--PPSXXXXPPPXXXXPXXXPXPP 902 T PP + P P + P P P P PP PP+ PPP P PP Sbjct: 25 TRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Query: 903 XXXXXARPXP 932 + P P Sbjct: 85 NIACKSTPYP 94 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PP P PP P PPP P PP+ Sbjct: 39 PSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPN 85 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 36.7 bits (81), Expect = 0.022 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 117 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYV--YSSPPPP 170 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 92 PPPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 145 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 142 PPPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 195 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 167 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 220 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 192 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 245 Score = 36.3 bits (80), Expect = 0.029 Identities = 26/78 (33%), Positives = 32/78 (41%), Gaps = 13/78 (16%) Frame = +3 Query: 738 PPPPXXAP-PR------XPPXXRAPPYPHXXXPXP---XXNPPPPSXXXXPPPXXXXP-- 881 PPPP +P P+ PP R+PP P+ P P +PPPP PPP P Sbjct: 242 PPPPYYSPSPKVNYKSPPPPYYRSPPPPY-YSPSPKVDYKSPPPPYVYSSPPPPYYSPSP 300 Query: 882 -XXXPXPPXXXXXARPXP 932 PP + P P Sbjct: 301 KVDYKSPPPPYVYSSPPP 318 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 266 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 319 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 291 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 344 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 316 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 369 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 341 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 394 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 366 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYI--YNSPPPP 419 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 217 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPP 260 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 391 PPPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYV--YSSPPPP 444 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 416 PPPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 469 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 441 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPP 484 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P PPY + P P +P PPP Sbjct: 466 PPPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPP 509 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 131 KSPPPPYVYSSP-------PPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 183 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 184 PPPYVYSSPPP 194 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 156 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP 208 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 209 PPPYVYSSPPP 219 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 181 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 233 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 234 PPPYVYSSPPP 244 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/67 (28%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXX--NPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP P P +P + P P +PPPP P P PP Sbjct: 258 PPPPYYRSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP-----PPPYV 312 Query: 912 XXARPXP 932 + P P Sbjct: 313 YSSPPPP 319 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 280 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP 332 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 333 PPPYVYSSPPP 343 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 305 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 357 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 358 PPPYVYSSPPP 368 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 206 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSP 258 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 259 PPPYYRSPPPP 269 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 K+ PPP + P P +P + P P PPP P Sbjct: 231 KSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSP 275 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 36.7 bits (81), Expect = 0.022 Identities = 22/71 (30%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-PPSXXXXPPP-XXXXPXXXPXPPX 905 T PPP +PP PP P P + P PPS PP P P P Sbjct: 25 TTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSA 84 Query: 906 XXXXARPXPXT 938 + P P T Sbjct: 85 PITPSPPSPTT 95 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPS---XXXXPPPXXXXPXXXPXPP 902 T P P +PP PP P + PPPS PPP P P P Sbjct: 9 TTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPS 68 Query: 903 XXXXXARPXP 932 P P Sbjct: 69 PPGSLTPPLP 78 Score = 34.7 bits (76), Expect = 0.090 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 10/77 (12%) Frame = +3 Query: 732 TXPPP----PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP----PSXXXXPPPXXXXPXX 887 T PPP P PP PP PP P P PP PS PP P Sbjct: 52 TSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPN 111 Query: 888 XP--XPPXXXXXARPXP 932 P P +P P Sbjct: 112 TPSGSTPRTPSNTKPSP 128 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP----PPPPRXXXGXPXPP 934 PP P P PPP P PP P P PP P PP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPP 103 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P TP PP N P PP P P P P P P Sbjct: 36 PTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPS---PPGSLTPPLPQPSPSAP-ITPSPP 91 Query: 869 PXXXXXXPPPPPRXXXGXPXPP 934 P PP G P P Sbjct: 92 SPTTPSNPRSPPSPNQGPPNTP 113 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP 794 PPP +PPR PP PP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P P PPPP P PP P PPPP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP P PPP P PPPP P PP Sbjct: 64 PPPPPPTSPPPPSP---PPPSPPPPSPPPPSPPPP 95 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP P PP PP P P P +PPPP+ P Sbjct: 64 PPPPP--PTSPPPPSPPPPSPPPPSP-PPPSPPPPAFAVGKTP 103 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPP 865 P S PP P P PP P P PPP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 32.3 bits (70), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXP 871 PP P P PP P P PPP P Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 31.9 bits (69), Expect = 0.63 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYP 800 T PPPP PP PP PP P Sbjct: 70 TSPPPPSPPPPSPPPPSPPPPSP 92 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P P PPP P PP P P PPP Sbjct: 65 PPPPPTSPPP-PSPPPPSPPPPSPPPPSPPP 94 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP P P P PPP PPP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 789 PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP P P P PP P PPP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 107 PPPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYV--YSSPPPP 160 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 157 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 210 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 182 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 235 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 207 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 260 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 282 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 335 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 307 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 360 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 332 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 385 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 357 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 410 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 382 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 435 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 407 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 460 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 432 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 485 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 457 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 510 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 482 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 535 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 507 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 560 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 532 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 585 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP P P+ PPY + P P +P P PPP Sbjct: 82 PPPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPP 125 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P P P PPP P PP Sbjct: 57 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPP--PYEYSSPPPP 110 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP +P P+ PPY + P P +P P PP Sbjct: 232 PPPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPP 274 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPP-SXXXXPPP 866 PPPP +P P+ PPY + P P +P P + PPP Sbjct: 557 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVTYKSLPPP 601 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P +P P+ PPY + P P +P P PPP P PP Sbjct: 132 PPLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYV--YSSPPPP 185 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAP-PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P PY + P P +P P PPP P PP Sbjct: 257 PPPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 310 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 146 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 198 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 199 PPPYVYSSPPP 209 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 171 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 223 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 224 PPPYVYSSPPP 234 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 196 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP 248 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 249 PPPYVYSSPPP 259 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 221 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 273 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 274 PLPYVYSSPPP 284 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 296 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 348 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 349 PPPYVYSSPPP 359 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 321 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSP 373 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 374 PPPYVYSSPPP 384 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 346 KSPPPPYVYSSP-------PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 398 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 399 PPPYVYSSPPP 409 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 371 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 423 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 424 PPPYVYSSPPP 434 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 421 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 473 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 474 PPPYVYSSPPP 484 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 471 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 523 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 524 PPPYVYSSPPP 534 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 521 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 573 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 574 PPPYVYSSPPP 584 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 82 PPPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 135 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYV--YNSPPPP 160 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 P PP +P P+ PPY + P P +P P PPP P P Sbjct: 207 PSPPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPP 261 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P +P P PPP P PP Sbjct: 182 PPPPYYSPSPKVDYKFSPPPYVYNSPSPPYYSPSPKVDYKSPPPPYV--YNSPPPP 235 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPP--SXXXXPPPXXXXP 881 PPPP +P P+ PPY + P P P P S PPP P Sbjct: 232 PPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSP 282 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/58 (32%), Positives = 23/58 (39%), Gaps = 10/58 (17%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXP---------XXNPPPPSXXXXPPPXXXXP 881 PPPP +P P+ PPY + P P +PPPP PPP P Sbjct: 132 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSP 189 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPX----PXXXXXXPPPPPRXXXGXPXPPH 937 PP P P PPPP PPP PPPP P PP+ Sbjct: 209 PPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPY 262 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/56 (30%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXA-PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP + P+ PPY + P P +P P PP P PP Sbjct: 157 PPPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYV--YNSPSPP 210 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PPPP PP PPY +PPPP PPP P P P Sbjct: 223 PPPPYVY--NSPP----PPYFSPSPKVDYKSPPPPYVYSSPPP---PPYYSPSPEVSYKS 273 Query: 918 ARPXP 932 P P Sbjct: 274 PPPPP 278 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 9/45 (20%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPXPXXXXX------XPPPPP 904 PP P P PPPP PPP P PPPPP Sbjct: 234 PPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/58 (27%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP P P +P + P P + PPP P P P P Sbjct: 221 KSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 112 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 165 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 137 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YNSPPPP 190 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 162 PPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYV--YSSPPPP 215 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 187 PPPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 240 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 212 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 265 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 237 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYV--YNSPPPP 290 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 262 PPPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 315 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 287 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 340 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 412 PPPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 465 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 437 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 490 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 462 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 515 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 337 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPP 380 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 487 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPP 530 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 512 PPPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 565 Score = 35.5 bits (78), Expect = 0.051 Identities = 22/68 (32%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXP---XXXPXPPXX 908 P AP P +PP P P P N PPPP+ PPP P PP Sbjct: 72 PKYAPHPKPYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPP 131 Query: 909 XXXARPXP 932 + P P Sbjct: 132 YVYSSPPP 139 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 312 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 365 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P +P P PPP P PP Sbjct: 362 PPPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYV--YSSPPPP 415 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P+ PPY + P P +P P PPP P PP Sbjct: 387 PPPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYV--YSSPPPP 440 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P+ PPY + P P +P P PPP P PP Sbjct: 538 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYV--YSSPPPP 590 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP--HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P ++PP P + P P +P P PPP P PP Sbjct: 86 PPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 140 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP +P P PPY + P P +P P PP Sbjct: 587 PPPPYYSPSPMVDYKSTPPPYVYSFPPLPYYSPSPKVDYKSPP 629 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PP Sbjct: 562 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPP 605 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP +P P+ PPY + P P +P P PPP Sbjct: 637 PPPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSPPP 680 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXPPXX 908 PPPP PP PPY +PPPP PPP P PP Sbjct: 103 PPPPNVY--NSPP----PPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 156 Query: 909 XXXARPXP 932 + P P Sbjct: 157 YVYSSPPP 164 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 151 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSP 203 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 204 PPPYVYSSPPP 214 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 201 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 253 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 254 PPPYVYSSPPP 264 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 326 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 378 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 379 PPPYVYSSPPP 389 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 351 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSP 403 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 404 PPPYVYSSPPP 414 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 401 KSPPPPYVYSSP-------PPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 453 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 454 PPPYVYSSPPP 464 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 426 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP 478 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 479 PPPYVYSSPPP 489 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 451 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSP 503 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 504 PPPYVYSSPPP 514 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/72 (27%), Positives = 24/72 (33%), Gaps = 4/72 (5%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP----XXXPX 896 K+ PPP + P PPY +PPPP PPP P Sbjct: 476 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSP 528 Query: 897 PPXXXXXARPXP 932 PP + P P Sbjct: 529 PPPYVYSSHPPP 540 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P P P PP P PP Sbjct: 160 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPP 215 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P P P PP P PP Sbjct: 186 PPPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPP 241 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 238 PPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYI--YNSPPPP 291 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXX-RAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXPXP 899 PPPP PP +PP P P P N PPPP PPP P P P Sbjct: 331 PPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPP---PPYYSPFP 385 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPP +P PR PPY + P P N PPP P P P PP Sbjct: 315 PPPTYYSPSPRVDYKSPPPPYVYNSLPPPYVYNSPPPPPYYSPSPTVN--YKSPPPPYVY 372 Query: 912 XXARPXP 932 P P Sbjct: 373 NSPPPPP 379 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPPX 905 K+ PPP + P PP +P P P N PPP P P PP Sbjct: 252 KSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSP----KIDYKSPPP 307 Query: 906 XXXXARPXPXT 938 + P P T Sbjct: 308 PYVYSSPPPPT 318 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P PPY + P P P P PP P PP Sbjct: 350 PPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPP 405 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PY + P P P P PP P PP Sbjct: 212 PPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPP 267 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPXPXXXXXXP-----PPPPRXXXGXPXPPH 937 PP P P PPPP PPP P PPPP P PP+ Sbjct: 352 PPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPY 406 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P P P PP Sbjct: 376 PPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPP 419 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = +2 Query: 797 PPXGXPXPXXX---PPPPLPXXXPPPXPXXXXXXP-----PPPPRXXXGXPXPPH 937 PP P P PPPP PPP P PPPP P PP+ Sbjct: 162 PPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPPPPPY 216 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXP-----PPPPRXXXGXPXPPH 937 PPPP PPP P PPPP P PP+ Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPY 190 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/57 (35%), Positives = 23/57 (40%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP + P PP PPY +PPPP PPP P P P Sbjct: 174 KSPPPPYVYSSP--PP----PPYYSPSPKVEYKSPPPPYVYSFPPP---PPYYSPSP 221 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 PPP +P P+ PPY + P P P P PP P PP Sbjct: 289 PPPSYYSPSPKIDYKSPPPPYVYSSPPPPTYYSPSPRVDYKSPPPPYVYNSLP-PPYVYN 347 Query: 915 XARPXP 932 P P Sbjct: 348 SPPPPP 353 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/68 (29%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXX--APPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP +PP P +P + P P + PPP P P P PP Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSP--KVEYKSPPPPYV 207 Query: 909 XXXARPXP 932 P P Sbjct: 208 YSFPPPPP 215 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP P PP PPY +PPPP PPP P P P Sbjct: 364 KSPPPPYVYNSP--PP----PPYYSPFPKVEYKSPPPPYIYNSPPP---PPYYSPSP 411 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPP P PP P + P P N PPP P P P PP Sbjct: 341 PPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFP--KVEYKSPPPPYIY 398 Query: 912 XXARPXP 932 P P Sbjct: 399 NSPPPPP 405 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPP--XXAPPRXPPXXRAPPYPHXXXPXP-XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +PP P P + P P N PPP P P P PP Sbjct: 366 PPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSP--KITYKSPPPP 421 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXA--PPRXPPXXRAPPYPHXXXPXPXX-NPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPPP PP P +P + P P + PPP P P P PP Sbjct: 202 PPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSPPPPPYYSPSPKVN--YKSPPPPYV 259 Query: 909 XXXARPXP 932 P P Sbjct: 260 YSSPPPPP 267 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXP-----PPPPRXXXGXPXPPH 937 PPP PPP P PPPP P PP+ Sbjct: 341 PPPYVYNSPPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPY 380 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 80 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 133 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 105 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 158 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 130 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 183 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 155 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 208 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 180 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 233 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 205 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 258 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 230 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 283 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 255 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 308 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 280 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 333 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 305 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 358 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 330 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV--YSSPPPP 383 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 355 PPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYV--YSSPPPP 408 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 380 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYV--YSSPPPP 433 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP +P P+ PPY + P P +P P PPP P Sbjct: 605 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSP 653 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 530 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YNSPPPP 583 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 555 PPPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 608 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 405 PPPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 458 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 430 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 483 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 455 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 508 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 480 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 533 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 505 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YSSPPPP 558 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 580 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 633 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 672 PPPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPP 715 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P PPY + P P +P P PPP P PP Sbjct: 56 PPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYV--YSSPPPP 108 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP P + P P P P PP P PP Sbjct: 621 PPPPYVYSSPPPPYYSPSPKVYYKSPPPPYYSPSPKVYYKSPPHPHVCVCPPPPP 675 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPH---XXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 K+ PPP P+ ++PP+PH P P +P P PPP P P Sbjct: 644 KSPPPPYYSPSPKV--YYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYV--YNSPPP 699 Query: 900 P 902 P Sbjct: 700 P 700 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/55 (30%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHX-XXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP + P + PP P+ P P P P PPP P PP Sbjct: 31 PPPLYSSPLPEVEYKTPPLPYVDSSPPPTYTPAPEVEYKSPPPPYV--YSSPPPP 83 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/73 (28%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 294 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 346 Query: 900 PXXXXXARPXPXT 938 P + P P T Sbjct: 347 PPPYVYSSPPPPT 359 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/70 (25%), Positives = 23/70 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP + P P +P + P P PP P P PP Sbjct: 344 KSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSP----KVEYKSPPPP 399 Query: 909 XXXARPXPXT 938 + P P T Sbjct: 400 YVYSSPPPPT 409 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 94 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 146 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 147 PPPYVYSSPPP 157 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 144 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 196 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 197 PPPYVYSSPPP 207 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 169 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSP 221 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 222 PPPYVYSSPPP 232 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 194 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 246 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 247 PPPYVYSSPPP 257 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 219 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 271 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 272 PPPYVYSSPPP 282 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 244 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 296 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 297 PPPYVYSSPPP 307 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 269 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 321 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 322 PPPYVYSSPPP 332 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 319 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSP 371 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 372 PPPYVYSSPPP 382 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 369 KSPPPPYVYSSP-------PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSP 421 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 422 PPPYVYSSPPP 432 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PP P H +PPPP PPP P P Sbjct: 544 KSPPPPYVYSSP-PPPYYSPSPKVH------YKSPPPPYVYNSPPPPYYSPSPKVYYKSP 596 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 597 PPPYVYSSPPP 607 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG GGG G G GG GG GG GGGG Sbjct: 38 GGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGG 80 Score = 36.3 bits (80), Expect = 0.029 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG G WG GG GG GG GGG G G GGGG Sbjct: 38 GGGEWGGAEGGGAWGGGGG--GGGAWGGEGEGGGE---WGGGGEGGGG 80 Score = 35.9 bits (79), Expect = 0.039 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGG---XXXGXGXXXWGXGGARXXGGXRG 761 GG G GGG GGGG G G WG GG GG RG Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 34.7 bits (76), Expect = 0.090 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 814 GXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G WG G GG GG GGGG G G GG Sbjct: 30 GEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGG 68 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG GG GG G GGGG + G G GG E G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEG--EGGGEWGG 73 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G GG G GGG G G GG G G GG Sbjct: 44 GAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 G G GGGGG G GGG G G GG Sbjct: 44 GAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGG 78 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 82 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 135 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 107 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YNSPPPP 160 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 132 PPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 185 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 157 PPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 210 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 182 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 235 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 207 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 260 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 232 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 285 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 257 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 310 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 282 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 335 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 307 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 360 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 332 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 385 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 357 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YNSPPPP 410 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 382 PPPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 435 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 407 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 460 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 432 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYV--YSSPPPP 485 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 507 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPP 550 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +3 Query: 729 KTXPPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P P+ PPY + P P +P P PPP P PP Sbjct: 54 KSSPPPQYYTPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYV--YSSPPPP 110 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ P Y + P P +P P PPP P PP Sbjct: 457 PPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYV--YSSPPPP 510 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ P Y + P P +P P PPP P PP Sbjct: 482 PPPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 535 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 71 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSP 123 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 124 PPPYVYSSPPP 134 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 121 KSPPPPYVYSSP-------PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSP 173 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 174 PPPYVYSSPPP 184 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 36.3 bits (80), Expect = 0.029 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGG G G GG GG GG GGGG + G GR GGG Sbjct: 41 GGGFGDNGGGRYQGGGG---HGGHGGGGYQGGGGR-YQGGGGRQGGG 83 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GGG G GGG G GGGG G G GG G Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQG 81 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGX-RGGAXXGGGG 737 GG GGG G G G GG + GG +GG GGG Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGG 83 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 897 GGGXXXXXXGXGGGXXXG-RGGGGXFXGXGXPXGG 796 GGG G GG G +GGGG + G G GG Sbjct: 48 GGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGG 82 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G GG +GGGG G G + GG R GG GG GGG Sbjct: 42 GGFGDNGGGRY-QGGGG-HGGHGGGGYQGGGGRYQGG--GGRQGGGG 84 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP P +PP PP + P P P PPPS PPP Sbjct: 1126 PPLPHESPPSPPPQPPSSP-PPPSSPPQLAPAPPPSDHCLPPP 1167 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 789 PPYPHXXXPXPXXNP--PPPSXXXXPPPXXXXPXXXPXPP 902 P +P P P +P PPP PPP P P PP Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 791 SXPPXGXPXPXXXPP--PPLPXXXPPPXPXXXXXXPPPPP 904 S P P P PP PP P PPP P PPP Sbjct: 1120 SFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPLP PP P PPPP P PP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP P PP PP +PP P PPP+ P P Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALP 1180 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPL--PXXXPPPXPXXXXXXPPPPP 904 PP P P PPPP P P P P PP P Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P PP P P PPP PPP P P Sbjct: 1126 PPLPHESPPSPPPQP-PSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +PP+ P APP P P P PP P P Sbjct: 1144 PPPPSSPPQLAP---APPPSDHCLPPPTAPLAPAQSIALPPSSITRPSMPSHP 1193 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 363 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YSSPPPP 416 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP P P+ PPY + P P +P P PPP P PP Sbjct: 63 PPPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 116 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 163 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 216 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 188 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 241 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 213 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 266 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 238 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 291 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 263 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 316 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 288 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 341 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 388 PPPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPP 431 Score = 35.1 bits (77), Expect = 0.068 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP +P P+ PPY + P P +P P PPP Sbjct: 88 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPP 131 Score = 35.1 bits (77), Expect = 0.068 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P P +P P PPP P PP Sbjct: 313 PPPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYV--YSSPPPP 366 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P PPY + P P +P P PPP P PP Sbjct: 338 PPPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYV--YSSPPPP 391 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP +P P+ PPY + P +P P PPP P PP Sbjct: 113 PPPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYV--YSSPPPP 166 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P P+ PPY + P P +P P PPP P PP Sbjct: 138 PPPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYV--YSSPPPP 191 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/71 (29%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PP P H +PPPP PPP P P Sbjct: 352 KSPPPPYVYSSP-PPPYYSPSPKVH------YKSPPPPYVYSSPPPPYYSPSPKVHYKSP 404 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 405 PPPYVYSSPPP 415 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP---XXXPXP 899 K+ PPP + P PPY +PPPP PPP P P Sbjct: 102 KSPPPPYVYSSP-------PPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSP 154 Query: 900 PXXXXXARPXP 932 P + P P Sbjct: 155 PPPYVYSSPPP 165 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 35.9 bits (79), Expect = 0.039 Identities = 24/68 (35%), Positives = 25/68 (36%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG 713 G G G G GG G G G GG GG GG GG G G G Sbjct: 37 GYGGGYSGVGDNGLPFGGVGGGVSGPGGNL-GYGGFGGAGGGLGGGLGGGAGS--GLGGG 93 Query: 712 RGGGGXLG 689 GGG +G Sbjct: 94 LGGGSGIG 101 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G G GG G GG G G G G+ GG GG+ G G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAG 103 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GG G G G GG GG G GG G G G GG G Sbjct: 56 GGGVSGPGGNLGYGGFGGAGGGLGGG--LGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG-GGGXFXGXGXPXGG 796 G G P GGG G GG G G GGG G G GG Sbjct: 46 GDNGLPFGGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGG 92 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 35.9 bits (79), Expect = 0.039 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = +3 Query: 732 TXPP----PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP-PSXXXXPPPXXXXPXXXPX 896 T PP PP P PP PP P +PPP P PP P P Sbjct: 42 TLPPYVSLPPLSVPGNAPPFCINPPNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPN 101 Query: 897 PPXXXXXARP 926 PP P Sbjct: 102 PPESSSNPNP 111 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/63 (28%), Positives = 21/63 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP + PP + P + P NPP S PP P P PP Sbjct: 100 PNPPESSSNPNPPDSSSNPNSNPNPPVTVPNPPESSSNPNPPDSSSNPNSNPNPPESSSN 159 Query: 918 ARP 926 P Sbjct: 160 PNP 162 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP + P + P NP PP P P P PP Sbjct: 79 PPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPNPPVTVPNPPESSSNP 138 Query: 921 RP 926 P Sbjct: 139 NP 140 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T P PP + PP + P P P P +P PP PP P PP Sbjct: 165 TVPNPPESSSNPNPPESSSNPNPPITIPYPPESSSPNPPEIVPSPPESGYTPGPVLGPP 223 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 T P PP + PP + P + P NP PP PP P Sbjct: 127 TVPNPPESSSNPNPPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNP 176 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP PP P P NPP S P P PP Sbjct: 59 PPFCINPPNTPPSSSYPGLSPPPGPITLPNPPDSSSNPNSNPNPPESSSNPNPP 112 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP +PP P PPY P + P PS PP P P P Sbjct: 202 PPEIVPSPPESGYTPGPVLGPPYSEPGPSTPTGSIPSPSSGFLPPIVYPPPMAPPSP 258 Score = 28.7 bits (61), Expect = 5.9 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 5/68 (7%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP--SXXXXPP---PXXXXPXXXPXPP 902 P PP P PP + P P P NP PP S PP P P PP Sbjct: 122 PNPPVTVP--NPPESSSNPNPPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNPP 179 Query: 903 XXXXXARP 926 P Sbjct: 180 ESSSNPNP 187 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 35.9 bits (79), Expect = 0.039 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P PPPP+P P PPPPP+ P PP Sbjct: 241 PTPPPPPPPPIPVKQSATPP------PPPPPKLKNNGPSPP 275 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPPP P + PP P P PPPP Sbjct: 245 PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP P P P P PPP PPPPP Sbjct: 245 PPPPPPIPVKQSATPPP--PPPPKLKNNGPSPPPPP 278 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G G GGG G GGGG G G GG + G Sbjct: 387 GGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTG 427 Score = 34.7 bits (76), Expect = 0.090 Identities = 27/81 (33%), Positives = 27/81 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG GGG G GGA GG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDT-CTQVTHGGGGAPLTMIGGGGGE 456 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 G G G GRGGG G Sbjct: 457 QGVTGSDGGGGRGRGGGKVAG 477 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRG-GGGXFXGXG 811 GG G P GGGGG GGG GRG GGG G G Sbjct: 441 GGGGAPLTMIGGGGGEQGVTGSDGGG---GRGRGGGKVAGGG 479 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG G G GG GG +G GGGG G G GGGG Sbjct: 387 GGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGG--EQGTGVGGGG 432 Score = 32.3 bits (70), Expect = 0.48 Identities = 24/80 (30%), Positives = 26/80 (32%), Gaps = 2/80 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXG--GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 G GR G G G GG E G G G WG GG+ G Sbjct: 312 GGGRTGNKGGNGGSIKIGVGTNGITGGTGGGEAGAGMQVMQG---WGGGGSGAATQVMQG 368 Query: 757 AXXGGGGXVFXXGXGRGGGG 698 G G + G GGGG Sbjct: 369 CGGGDAGAITQVMQGWGGGG 388 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGX---GXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGR 710 G G +G GG G WG GGA G GGGG G G Sbjct: 355 GGGGSGAATQVMQGCGGGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGT 414 Query: 709 GGGGXLG 689 G GG G Sbjct: 415 GIGGGGG 421 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/77 (31%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG + G G GG + G GG Sbjct: 408 GGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGVTGSDGGGG 467 Query: 751 XG-GGGXVFXXGXGRGG 704 G GGG V G G+ G Sbjct: 468 RGRGGGKV--AGGGKKG 482 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGG--GXXXGRGGGGXFXGXGXPXGG 796 GG GGGG G GG G GGGG G G GG Sbjct: 431 GGDTCTQVTHGGGGAPLTMIGGGGGEQGVTGSDGGGGRGRGGGKVAGG 478 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 933 GGXGX-PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G +G GGG G G G G GGGG G G GG Sbjct: 387 GGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGE-QGTGVGGGG 432 Score = 29.1 bits (62), Expect = 4.4 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG +GG G G G G GG G G V Sbjct: 300 GGRGSTGEGVTDGGGRTGNKGGNGGSIKIGV------GTNGITGGTGGGEAGAGMQVM-Q 352 Query: 721 GXGRGGGG 698 G G GG G Sbjct: 353 GWGGGGSG 360 Score = 28.3 bits (60), Expect = 7.8 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXG 719 G G G G GGG G G G G GG R G G GG + G Sbjct: 273 GGGGDKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVT--DGGGRTGNKGGNGGSI-KIG 329 Query: 718 XGRGG 704 G G Sbjct: 330 VGTNG 334 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.9 bits (79), Expect = 0.039 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP +PP P P +PPPP PP P P P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPP---PXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P P PP P PP P PPPPP PP Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 35.5 bits (78), Expect = 0.051 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP P P P P + PPS PPP PP Sbjct: 49 PPP---PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 35.5 bits (78), Expect = 0.051 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP P +PP P P PP P PPP Sbjct: 50 PPPPSPPPPSCTP---SPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 35.1 bits (77), Expect = 0.068 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = +2 Query: 692 QXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXP 871 Q PPPPP P + P S PP P PP PLP PPP P Sbjct: 46 QNQPPPPPSPPPPS-----------CTPSPPPPSPPP---PKKSSCPPSPLPPPPPPPPP 91 Query: 872 XXXXXXPP 895 PP Sbjct: 92 NYVFTYPP 99 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P PP P P PPP PP P PPPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 812 PXPXXXPPPP--LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 P P PPPP P PP P PP P P PP+ Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPN 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 T PPP PP P PP P P P PPPP+ PP P Sbjct: 61 TPSPPPPSPPP--PKKSSCPPSP-LPPPPP---PPPPNYVFTYPPGDLYP 104 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PP P PPP P PPP P P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSP 81 >At3g42130.1 68416.m04326 glycine-rich protein Length = 65 Score = 35.5 bits (78), Expect = 0.051 Identities = 23/57 (40%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGA--RXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG +GGGG G +G GG R G R G GG G G GR GGG Sbjct: 12 GGGEACDGGGGRYRKGGGNVYGGGGGYERHSRGYRSG---GGCGGKRYGGGGREGGG 65 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G GGG +GGG G G G R GG GG GGGG Sbjct: 14 GEACDGGGGRYRKGGGNVYGGGGGYERHSRGYRSGGGC-GGKRYGGGG 60 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 35.5 bits (78), Expect = 0.051 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = -2 Query: 865 GGGXXXXEGG---GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GGG GG G G G GG GG GG GGG + G G GGG Sbjct: 558 GGGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 35.1 bits (77), Expect = 0.068 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGG--GGXFXGXGXPXGGXEXP 784 G G GGGGG G GGG G GG GG + G G E P Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGGEPP 629 Score = 34.7 bits (76), Expect = 0.090 Identities = 24/71 (33%), Positives = 25/71 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG GG EG G G G G GG GG GG GGGG + Sbjct: 558 GGGKNRRSGGRFGGRDFRREGSFGS--GRGGYGGGGGGYGGGGGYGGGGGYGGGGG-YGG 614 Query: 721 GXGRGGGGXLG 689 G G G G Sbjct: 615 GYGGASSGGYG 625 Score = 32.3 bits (70), Expect = 0.48 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXG-XXXWGXGGARXXGGXRGGA 755 G R GG G GGGG G G G GG GG GGA Sbjct: 560 GKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGA 619 Query: 754 XXGGGG 737 GG G Sbjct: 620 SSGGYG 625 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 G G G G +G GG GG GG GGG G GG Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 35.5 bits (78), Expect = 0.051 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRG-GA 755 G G A GG G G G G G G G G G GG G G Sbjct: 27 GGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGP 86 Query: 754 XXGGGGXVFXXGXGRGGG 701 GGGG G GGG Sbjct: 87 GYGGGGDGRGYGSETGGG 104 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG---XEXPGXXXXXXXXXXXXXXXGF 730 GGGG G GGG G GGG G G G PG G Sbjct: 24 GGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGG 83 Query: 729 FXXGXGGGG 703 G GGGG Sbjct: 84 HGPGYGGGG 92 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 897 GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GG G GGG G GGGG G G GG Sbjct: 70 GGAGPGPGYGGGGGHGPGYGGGGDGRGYGSETGG 103 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 35.5 bits (78), Expect = 0.051 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG--GGXLG 689 GGGG G G G GG GG GA G G + G G GG GG LG Sbjct: 41 GGGGSGDGLGL---GLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLG 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 930 GXGXPXXXRGGGG-GXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 G G GG G G G G G G GGGG G G GG Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.5 bits (68), Expect(2) = 0.060 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPP P PPP PPPPP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPP 67 Score = 22.6 bits (46), Expect(2) = 0.060 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 689 PQXTPPPPPXP 721 P PPPPP P Sbjct: 42 PHPPPPPPPPP 52 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 35.1 bits (77), Expect = 0.068 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPP 863 PPPP PP P PP P P P PP P PP Sbjct: 38 PPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGGYPP 81 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP---PRXXXGXPXPP 934 PP G P P PP P PP P PP P G P P Sbjct: 17 PPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAP 65 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 35.1 bits (77), Expect = 0.068 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRA---PPYPHXXXPXPXXNPPPPSXXXXPPP 866 K PPPP PP P R+ P P PPPP PPP Sbjct: 29 KEVPPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPPPP 77 Score = 29.1 bits (62), Expect = 4.4 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 7/75 (9%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPP-------PLPXXXP 859 PPPPP K P PP P PLP P Sbjct: 7 PPPPPPSGFKRYKKKRSKKMDNKEVPPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYP 66 Query: 860 PPXPXXXXXXPPPPP 904 PP P PPPPP Sbjct: 67 PPPP----PLPPPPP 77 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 35.1 bits (77), Expect = 0.068 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP P P PP P NPPP PPP P P P Sbjct: 95 PPPTSNESPSPPEDSETPPAP--PNESNDNNPPPSQDLQSPPPSSPSPNVGPTNP 147 Score = 34.7 bits (76), Expect = 0.090 Identities = 20/53 (37%), Positives = 22/53 (41%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P PP + PP P P +PPPPS PP P P PP Sbjct: 50 PPLSEPSTPPPDSQLPPLPSILPPL-TDSPPPPS--DSSPPVDSTP--SPPPP 97 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +3 Query: 738 PPPPXXAPPRX---PPXXRAPPYPHXXXPXPXXNP-PPPSXXXXPPPXXXXPXXXPXPPX 905 PPP PP PP +PP P P P PPP P P PP Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPN 117 Query: 906 XXXXARPXP 932 P P Sbjct: 118 ESNDNNPPP 126 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PP P P P PP PP PP Sbjct: 81 PSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPP 126 Score = 29.1 bits (62), Expect = 4.4 Identities = 22/73 (30%), Positives = 24/73 (32%), Gaps = 9/73 (12%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRA-PPYPHXXXPXPXXN-PP-----PPSXXXXPPPXXXXP--XXXP 893 PP +PP P + PP P P PP PP PPP P P Sbjct: 33 PPVDSSPPSPPADSSSTPPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTP 92 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 93 SPPPPTSNESPSP 105 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/65 (27%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP +PP PP +PP P P + P PP PP PP Sbjct: 72 PPLTDSPP--PPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQD 129 Query: 912 XXARP 926 + P Sbjct: 130 LQSPP 134 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 34.7 bits (76), Expect = 0.090 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G G G G G G G G GG GGG + G GR GGG G Sbjct: 59 GAGSGRSPTGWGRGSGYGYGS-GSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGG 116 Score = 33.1 bits (72), Expect = 0.27 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GR+ G G G G GGG G G +G G R GG GG Sbjct: 61 GSGRSPTGWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYG-YGSGNGRSGGGGGGGGF 119 Query: 751 XG 746 G Sbjct: 120 NG 121 Score = 32.7 bits (71), Expect = 0.36 Identities = 25/67 (37%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Frame = -2 Query: 898 GXGXXXGXXXXGGGXXXXEG-GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 G G G G G G G G G G +G GG GG RGG G G Sbjct: 57 GYGAGSGRSPTGWGRGSGYGYGSGSGSGTGYG-YGSGG----GGARGGGYGYGSGNGRSG 111 Query: 721 GXGRGGG 701 G G GGG Sbjct: 112 GGGGGGG 118 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 G G GGG G G G G GGGG F G Sbjct: 84 GTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 34.7 bits (76), Expect = 0.090 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P P PP PP PP P P P P P P P P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTA 85 Query: 918 ARPXP 932 + P P Sbjct: 86 SPPAP 90 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 PPP PP P PP P P P P PP P P Sbjct: 43 PPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPG 102 Query: 909 XXXARPXP 932 A P P Sbjct: 103 PSDASPAP 110 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 34.7 bits (76), Expect = 0.090 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 738 PPPPXXAPPRXPP--XXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP P PP A + H P P PPPP PP Sbjct: 124 PPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPP-------YPHXXXPXPXXNPPPPSXXXXPPP 866 +++ PPPP PP PP PP + H P PPPP PP Sbjct: 117 RRSPPPPP---PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/69 (27%), Positives = 21/69 (30%) Frame = +2 Query: 698 TPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXX 877 +PPPPP P S PP P P PPP + Sbjct: 119 SPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPP---PPPPPPPPPTITPPVTTTTTGH 175 Query: 878 XXXXPPPPP 904 PPPPP Sbjct: 176 HHHRPPPPP 184 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PPPP PP + H P P PPPP PP Sbjct: 97 PPPPP--PPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPP 136 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 +++ PPPP PP PP PP PPPP P Sbjct: 148 RRSPPPPP---PPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTP 190 >At3g07560.1 68416.m00903 glycine-rich protein Length = 304 Score = 34.7 bits (76), Expect = 0.090 Identities = 23/71 (32%), Positives = 25/71 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG G GG +G G GG GG G G + Sbjct: 108 GGYGSSYGGGMYGGSSMYRGGYGGGGLYGSSGMYGGGAMGGYGGTMGGYGMGMGTGM-GM 166 Query: 721 GXGRGGGGXLG 689 G G G GG G Sbjct: 167 GMGMGMGGPYG 177 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 34.7 bits (76), Expect = 0.090 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP PP + P H P P PP PPP Sbjct: 258 PPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPPP 300 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P AP + PP PP + P + P PP P P PP Sbjct: 248 PVPIPAPRQPPPP---PPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPP 298 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/73 (27%), Positives = 22/73 (30%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ PPPPP P PP G P P PPP Sbjct: 254 PRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPP---PPPQFLNH----Q 306 Query: 869 PXXXXXXPPPPPR 907 PPPPP+ Sbjct: 307 QGFGGPRPPPPPQ 319 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PP PP + PPY H P PPPP Sbjct: 330 PPQHMQQQGGPPQQQQPPYQHHHMSMP---PPPP 360 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 34.7 bits (76), Expect = 0.090 Identities = 19/63 (30%), Positives = 22/63 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 P PP +P PP +P P P PPPP P P P PP Sbjct: 38 PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP--PSSSPLSSLSPSLSPSPPSSSPS 95 Query: 918 ARP 926 + P Sbjct: 96 SAP 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 P PP +P PP +P P P PPPP Sbjct: 87 PSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 121 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +2 Query: 707 PPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXX 886 PPP + P S P P PP L PPP Sbjct: 58 PPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSS-PSSAPPSSLSPSSPPPLSLSPSS 116 Query: 887 XPPPPP 904 PPPPP Sbjct: 117 PPPPPP 122 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/55 (36%), Positives = 23/55 (41%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP A + ++P P P P PPPP PPP P P PP Sbjct: 348 PPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPP-----PPP---PPLAPPPPP 394 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 PP P P PPPP PPP P PPPPP+ Sbjct: 368 PPRRSPPPLQTPPPP-----PPPPP----LAPPPPPQ 395 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/61 (34%), Positives = 23/61 (37%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ + PPPP N P S PP P P PPPPL PPP Sbjct: 342 PKFSQPPPPP----NRAAFQAITQEKSPVPPPRRSPPPLQTPPPP-PPPPPL---APPPP 393 Query: 869 P 871 P Sbjct: 394 P 394 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 +K+ PPP +P PP PP P P P PPPP Sbjct: 362 EKSPVPPPRRSP---PPLQTPPPPP---PPPPLAPPPPP 394 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPP PPPPP P PP Sbjct: 365 PVPPPRRSPPPLQT----PPPPPPPPPLAPPPPP 394 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP 833 K PPP PP P PP P P P P Sbjct: 363 KSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 T PPPP P RAPP P P PPPP Sbjct: 6 TIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 7/37 (18%) Frame = +2 Query: 830 PPPPLPXXX-------PPPXPXXXXXXPPPPPRXXXG 919 PPPPLP PPP P PPPPP G Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLG 45 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPP--XPXXXXXXPPPP 901 P P PPPP P PPP P PPP Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P PPPPP ++ P PP PLP PP Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPPKK 630 Query: 869 PXXXXXXPPPPP 904 PPPPP Sbjct: 631 LLATTNPPPPPP 642 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGGG G GG G A GGGG Sbjct: 140 GGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGG----Y 195 Query: 721 GXGRGGGGXLG 689 G GGGG G Sbjct: 196 GSNFGGGGGYG 206 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GGG GG G G G A GG G GGGG Sbjct: 150 GGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAG 209 Query: 721 GXG 713 G G Sbjct: 210 GVG 212 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -2 Query: 880 GXXXXGGGXXXXEGG-GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 G GGG +GG G G G G GG G GG GG + G G Sbjct: 120 GFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYG 179 Query: 703 G 701 G Sbjct: 180 G 180 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G G GG G G G G GG GGA GG + G GGGG G Sbjct: 113 GSGFGGRGFGGPGGGYGASDGGYGAPA--GGYGGGAGGYGGNSSYSGNAG-GGGGYGG 167 Score = 29.9 bits (64), Expect = 2.5 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXX 754 GG G P GGG G G GGGG + G G G Sbjct: 133 GGYGAPAGGYGGGAG----GYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNA 188 Query: 753 XXXXXXGFFXXGXGGGGGVXWG 688 G GGG GV G Sbjct: 189 VGGGGGYGSNFGGGGGYGVAGG 210 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/77 (25%), Positives = 22/77 (28%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPGXXXXXXXXXX 751 G G P G G G GG G GG + G GG G Sbjct: 120 GFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNA--GGGGGYGGNSSYGGNAGG 177 Query: 750 XXXXXGFFXXGXGGGGG 700 + GGGGG Sbjct: 178 YGGNPPYSGNAVGGGGG 194 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PP P P Y P P PP + P P P P Sbjct: 57 PPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKP 107 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 K T PP P PP P Y P P PP PP Sbjct: 67 KPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLSPP 112 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 6/74 (8%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLP------XXXPP 862 PPPPP P PP P PPPPLP PP Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALP---PPPPLPMAVRKGVAAPP 250 Query: 863 PXPXXXXXXPPPPP 904 P PPPPP Sbjct: 251 LPPPGTAALPPPPP 264 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGGG G G GG R GG R G G G RG GG Sbjct: 10 GGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRGRGG 57 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG-GXLGXXXRXR 671 G GG GG GG GGG F G GR G G G R R Sbjct: 8 GRGGGGFRGGRDGGGRGFGGGRSF--GGGRSGDRGRSGPRGRGR 49 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 9/60 (15%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPP----PLPXXXPPPXPXXXXXXP-----PPPPRXXXGXPXPP 934 P PP P P PPP PL PPP P P PPP P PP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPP 98 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXP--XXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP +P PP + P P P +PPP S PPP P PP Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPP--LITVIHPPPP 98 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXX 880 PP P P P PP P PPPL PP P Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPP---PLSQSLSPPPLITVIHPPPPRFY 101 Query: 881 XXX--PPPPPRXXXGXPXPP 934 PPPPP G PP Sbjct: 102 YFESTPPPPPLSPDGKGSPP 121 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 P +PP P P P P PPPP PPP Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPP 79 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/66 (27%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXX--XXPPPXXXXPXXXPXPPXXXX 914 PPP + P PP+ H P PPP PPP P PP Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 Query: 915 XARPXP 932 + P Sbjct: 115 DGKGSP 120 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G GG GG GG GGGG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G GG GG G + GGGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 903 GGGGGXXXXXXGX--GGGXXXGRGGGGXFXGXGXPXG 799 GGGGG G GGG GGGG + G G G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXG--RGGGGXLG 689 G GG R GG GG GGGG G G GGGG G Sbjct: 89 GGGGGR--GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 GGG GGG G G G GG GG GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGG 758 GGG GGG G G G GG GG GG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RG GGG G GGG G GGG G G GG Sbjct: 85 RGSGGGGGGRG-GSGGGYRSGGGGGYSGGGGGGYSGG 120 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 933 GGXGXPXXXRGGG--GGXXXXXXGXGGGXXXGRGGGG 829 GG G GGG G G GGG G GGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRG--GGGXLG 689 G GG G GG GGG + G G G GGG G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 787 ARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 +R GG GG GGG G G GGG G Sbjct: 84 SRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXW 800 G G G GGG GGGG G G W Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGGW 126 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP G P PPP PP P PPPPP PP+ Sbjct: 14 PPAGAP-----PPPAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPPY 55 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP----HXXXPXPXXNPPP 839 PPPP PP PPY + P P PPP Sbjct: 176 PPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPPP 213 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/81 (29%), Positives = 26/81 (32%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GR G G G GG G G G +G G G G Sbjct: 206 GVGRGYGSGGSGVGYGVGIGSSGGS-----GFGEGIGSSGGNGFGEGIGSSGGSGFGEGI 260 Query: 751 XGGGGXVFXXGXGRGGGGXLG 689 GG F G G GGG +G Sbjct: 261 GSSGGSGFGEGIGSGGGTGIG 281 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G GGG GG G G G GG+ GG GGG Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIPIYGGG 128 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/51 (43%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = -2 Query: 844 EGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG---RGGG 701 +GGGG G G +G GG GG G + GGGG G G RGGG Sbjct: 72 KGGGGGGRGGGG--FGGGGRSFGGG--GSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 775 GGXRGGAXXGGGGXVFXXG--XGRGGGG 698 GG RGG GGGG F G RGGGG Sbjct: 76 GGGRGGGGFGGGGRSFGGGGSSSRGGGG 103 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXG--XXXWGXGGARXXGGXRGGAXXGGG 740 GG G G GGG GGG G G G G + GG R GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGGLRPIPIYGGG 128 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 G G G GGG G G G GG+ GG GG+ GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGG--GGSSSRGGG 118 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 +GGGGG GGG G GG G G G Sbjct: 72 KGGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRG 108 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAP-PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 P PP +P P A P P P PPPP P P P P Sbjct: 116 PLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVPAPSDDDS 175 Query: 915 XARPXPXT 938 P P T Sbjct: 176 DDDPEPET 183 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 33.9 bits (74), Expect = 0.16 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGG---ARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 GGGG G G G GG GG G A GG G G+ GGG Sbjct: 841 GGGGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGG 891 Score = 28.7 bits (61), Expect = 5.9 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 GG G G GG G GG GGGG F G G G G Sbjct: 842 GGGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGG-FGGFGGQAQGQAGGG 891 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXG-GARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 GGG GGGG G G G G G+ G GG G G G G GGG Sbjct: 32 GGGGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGT--EGFGTGGG 85 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/67 (35%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Frame = -2 Query: 901 GGXGXXXGXXXXG-GGXXXXEGGGGXXXGXGXXXWG-XGGARXXGGXRGGAXXGG--GGX 734 GG G G G GG GG G G G +G GGAR G + GG GG Sbjct: 46 GGQGYGTGGQGYGSGGQGYGTGGQGYGTGTGTEGFGTGGGARHHGQEQLHKESGGGLGGM 105 Query: 733 VFXXGXG 713 + G G Sbjct: 106 LHRSGSG 112 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/67 (31%), Positives = 23/67 (34%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G G GG G G +G G G GGA G + Sbjct: 39 GGGGGATGGQGYGTGGQGY-GSGGQGYGTGGQGYGTGTGTEGFGTGGGARHHGQEQLHKE 97 Query: 721 GXGRGGG 701 G GG Sbjct: 98 SGGGLGG 104 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = +2 Query: 704 PPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXX 883 PPPP P + P PP P PPPPL P P Sbjct: 318 PPPPAPLHQQHQSTFAGAAASLTNFQPDVHPPPGMLRFPP--PPPPLDMHPPHPGMFVGH 375 Query: 884 XXPPPPPRXXXGXP 925 P PP G P Sbjct: 376 LIPRPPYGPPPGPP 389 Score = 32.7 bits (71), Expect = 0.36 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYP----HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP PP PP+P P P PPP PPP P PP Sbjct: 349 PPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPP-----GPPPMMRPPLPPGPPP 402 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P G P PPP P P PPPP P PP Sbjct: 207 PTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPPP PP+ R PP P PPPP Sbjct: 219 PPPPPGPPPKEQDFVR-PPLPPPPQLPQSSQPPPP 252 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +2 Query: 797 PPXGXPXPXXXP--PPPLPXXXPPPXPXXXXXXPPPPPRXXXG 919 PP P P PPP P PP P PP PP G Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSAASG 200 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNP----PPPSXXXXP-PPXXXXPXXXPXP 899 P PP P P PP P P P NP PPP P PP P P P Sbjct: 317 PTPPTPTLPPIPTIPTLPPLP-VLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVP 374 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/63 (30%), Positives = 21/63 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP P PP PP + P P P PP P PP P P P Sbjct: 340 PPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGI-PPAPLIPGIPPLSPSFSSH 398 Query: 918 ARP 926 +P Sbjct: 399 HQP 401 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP----PPXXXXPXXXPXPP 902 PP P P PP P P P P PPS P PP P PP Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPP 320 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 8/73 (10%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP-------PXXXXPXXXP 893 P PP P P P P P P PP P+ PP P P P Sbjct: 293 PSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPP 352 Query: 894 XPPXXXXXARPXP 932 PP P P Sbjct: 353 PPPSFPVPLPPVP 365 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 800 PXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P PPLP P P PPPPP P P Sbjct: 322 PTLPPIPTIPTLPPLPVLPPVPI-VNPPSLPPPPPSFPVPLPPVP 365 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXG 919 P PP P P PPLP P P P PP G Sbjct: 187 PPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLPPG 232 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 732 TXPPPPXX-APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP--PPXXXXPXXXPXPP 902 T PP P +PP PP P P PP P+ P P P P P Sbjct: 285 TLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPI 344 Query: 903 XXXXXARPXP 932 P P Sbjct: 345 VNPPSLPPPP 354 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP+ P P P PPPPP Sbjct: 27 PPPPMRRSAPSPPPMSGRVPPPPPP 51 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 PP P PPPP P P PPPPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPP 50 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXP 871 P PPPP+P PPP P Sbjct: 148 PLPPPPPPMPRRSPPPPP 165 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 839 PLPXXXPPPXPXXXXXXPPPPPR 907 PLP PPP P PPPPPR Sbjct: 148 PLP---PPPPPMPRRSPPPPPPR 167 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 839 PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PLP PPP P P PPP P PP Sbjct: 22 PLP---PPPPPPMRRSAPSPPPMSGRVPPPPP 50 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 818 PXXXPPPPLPXXXPP-PXPXXXXXXPPPPPRXXXGXPXPP 934 P PPP L P P PPPP G P PP Sbjct: 614 PAVNPPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPP 653 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 P P G P P PP P PPP PPPPPR Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPP-------PPPPPPR 45 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 P P P PP PP + P P PPPP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 741 PPPXXAPP---RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +P PP PP P P P PPP PP P P P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPP-PMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP-PPPPRXXXGXPXPP 934 G S PP PPP+P PPP P P PPP P P Sbjct: 46 GSSVPPPVMSPMPMMTPPPMP-MTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP P PP P P P +PP P P PP Sbjct: 62 PPPMPMTPP--PMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPP 114 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PPP+P PP P P P P PP Sbjct: 66 PMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP--LTVPDMPSPP 114 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 782 PGXSXPPXGX-PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 P + PP P P PPP+P PPP P PP P P P Sbjct: 58 PMMTPPPMPMTPPPMPMTPPPMP-MAPPPMP---MASPPMMPMTPSTSPSP 104 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G GGG G GGGG G G P GG + Sbjct: 63 GGGGGGGGGSGGGGGGRGGGPPRGGLD 89 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 775 GGXRGGAXXGGGGXVFXXGXGRGGGGXLGXXXRXR 671 GG GG GGGG G GRGGG G R Sbjct: 59 GGGMGGGGGGGGGSG-GGGGGRGGGPPRGGLDNVR 92 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G + GGG G G G GG+ GG RGG GG Sbjct: 51 GSKPNKKWGGGMGGGGG----GGGGSGGGGGGRGGGPPRGG 87 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP-PH 937 P P P PPP L P P P PPPPP+ G P PH Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPP-----PPPPPQLPFGPKLPFPH 46 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 729 KTXPPPPXXAPPR---XPPXXRAPPYPHXXXPXPXXNPPP 839 K PPPP PPR PP PP P P P P Sbjct: 6 KRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP PPP PPPP P PP Sbjct: 508 PPPPGEEWIPPPPSESEDVPPPPPDSYSEPIPPPP 542 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 P PPPP PP P P PPP Sbjct: 511 PGEEWIPPPPSESEDVPPPPPDSYSEPIPPP 541 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/68 (35%), Positives = 27/68 (39%), Gaps = 9/68 (13%) Frame = -2 Query: 865 GGGXXXXEGGGGXXX------GXGXXXWGXGGARXXGGXRG---GAXXGGGGXVFXXGXG 713 GGG +GGGG G G G G + GG +G G GGG Sbjct: 169 GGGGGGKKGGGGGFEIPVQMKGMGEGKNGKDGKKGKGGEKGKKEGKENKGGGKTGKTDAK 228 Query: 712 RGGGGXLG 689 GGGG LG Sbjct: 229 SGGGGLLG 236 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/68 (35%), Positives = 27/68 (39%), Gaps = 9/68 (13%) Frame = -2 Query: 865 GGGXXXXEGGGGXXX------GXGXXXWGXGGARXXGGXRG---GAXXGGGGXVFXXGXG 713 GGG +GGGG G G G G + GG +G G GGG Sbjct: 268 GGGGGGKKGGGGGFEIPVQMKGMGEGKNGKDGKKGKGGEKGKKEGKENKGGGKTGKTDAK 327 Query: 712 RGGGGXLG 689 GGGG LG Sbjct: 328 SGGGGLLG 335 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPS 845 PPP PP PP +A P P P + PPPPS Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPS 128 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP +PP P P P P PP PPP Sbjct: 93 PPSPPPP--SPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXP--PPPPRXXXGXPXPP 934 PP P P PPPP PPP P PPPP PP Sbjct: 92 PPPSPPPP--SPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPP 137 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -2 Query: 880 GXXXXGGGXXXXEGGGGXXXGXGXXXWG--XGGARXXGGXRGGAXXGGGGXVFXXGXGRG 707 G GGG E G G WG GG + G G+ GGGG G G Sbjct: 1522 GWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGG---SGGWGND 1578 Query: 706 GGG 698 GG Sbjct: 1579 SGG 1581 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 5/73 (6%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGG-GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVF- 728 GG G GGG G G G WG G GG GG GG Sbjct: 1529 GGWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSG---GGGSGGWGNDSGGKKSS 1585 Query: 727 ---XXGXGRGGGG 698 G G GGGG Sbjct: 1586 EDGGFGSGSGGGG 1598 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G GG +GG G G G WG GG GG Sbjct: 1568 GGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGGWGSESGG---KK 1624 Query: 721 GXGRGGGG 698 G GG G Sbjct: 1625 SDGEGGWG 1632 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 859 GXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GGGG G G G GG G G G G GGGG G Sbjct: 1521 GGWGNSGGGGWGSESAGKKTGGGSTGGWGSESGGNKSDGAG---SWGSGSGGGGSGG 1574 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/78 (26%), Positives = 21/78 (26%), Gaps = 2/78 (2%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGG--GGXXXGXGXXXWGXGGARXXGGXRGG 758 G G G G G GG G G G G WG GG Sbjct: 1530 GWGSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGG 1589 Query: 757 AXXGGGGXVFXXGXGRGG 704 G GG G GG Sbjct: 1590 FGSGSGGGGSDWGNESGG 1607 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -2 Query: 892 GXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 G G G G GGG G +G GG R G RG GGG Sbjct: 483 GDSSGGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRGRFGSGGG 533 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 614 GXPPGXGGXXXXPXGGGETRCPPPEXXGGGXFXXGGXGGAPKK 486 G P GG P GG + PP GGG GG GG K Sbjct: 404 GSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSGK 446 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 GG G P GGG G G GG G GGG Sbjct: 410 GGSGSPPST-GGGSGSPPSTGGGGGSPSKGGGGG 442 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 614 GXPPGXGGXXXXPXGGGETRCPPPEXXGGGXFXXGGXGGAPKKK 483 G P GG P G PP GGG G GG K Sbjct: 403 GGSPSPGGGSGSPPSTGGGSGSPPSTGGGGGSPSKGGGGGKSGK 446 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 95 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 147 Query: 909 XXXARPXP 932 P P Sbjct: 148 YVYKSPPP 155 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 123 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 175 Query: 909 XXXARPXP 932 P P Sbjct: 176 YVYKSPPP 183 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 151 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 203 Query: 909 XXXARPXP 932 P P Sbjct: 204 YVYKSPPP 211 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 179 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 231 Query: 909 XXXARPXP 932 P P Sbjct: 232 YVYKSPPP 239 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 207 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 259 Query: 909 XXXARPXP 932 P P Sbjct: 260 YVYKSPPP 267 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 235 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 287 Query: 909 XXXARPXP 932 P P Sbjct: 288 YVYKSPPP 295 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 263 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 315 Query: 909 XXXARPXP 932 P P Sbjct: 316 YVYKSPPP 323 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 291 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 343 Query: 909 XXXARPXP 932 P P Sbjct: 344 YVYKSPPP 351 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/68 (32%), Positives = 25/68 (36%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXX 908 K+ PPP P PP +PP P +PPPP PPP P P P Sbjct: 319 KSPPPPVKHYSP--PPVYHSPPPPKKH--YVYKSPPPPVKHYSPPPVYHSP---PPPKKH 371 Query: 909 XXXARPXP 932 P P Sbjct: 372 YVYKSPPP 379 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 6/72 (8%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPP-----YPHXXXPXPXXN-PPPPSXXXXPPPXXXXPXXX 890 K+ PPP P PP +PP Y + P P + PPP PPP Sbjct: 347 KSPPPPVKHYSP--PPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKS 404 Query: 891 PXPPXXXXXARP 926 P PP + P Sbjct: 405 PPPPPVHHYSPP 416 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/58 (32%), Positives = 22/58 (37%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 K+ PPP P PP +PP P +PPPP PP P PP Sbjct: 375 KSPPPPVKHYSP--PPVYHSPPPP--KEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPP 428 Score = 32.3 bits (70), Expect = 0.48 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPP+ PPP PPPPP P P+ Sbjct: 386 PPPVYHSPPPPKEKYVYKSPPPPPVHHYSPPHHPY 420 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPP + P PP Sbjct: 364 SPPPPKKHYVYKSPPPPVKHYSPPP---VYHSPPPPKEKYVYKSPPPP 408 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 112 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 155 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 140 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 168 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 211 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 196 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 239 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 224 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 267 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 252 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 295 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 280 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 323 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 308 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 351 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 S PP PPPP+ PPP PPPP + PP Sbjct: 336 SPPPPKKHYVYKSPPPPVKHYSPPP----VYHSPPPPKKHYVYKSPPP 379 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 74 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 127 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 102 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 155 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 130 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 183 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 158 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 211 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 186 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 239 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 214 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 267 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 242 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 295 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 270 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 323 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 298 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 351 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 9/56 (16%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXX----RAPPYP--HXXXPXPXXNPPPPS---XXXXPPP 866 K PPP +PP PP ++PP P H P +PPPP PPP Sbjct: 326 KHYSPPPVYHSPP--PPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 379 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 T PPPP PP P RAPP P P PP P P P P PP Sbjct: 248 TPPPPPVVDPP--PATHRAPPVPR--IPPVSGVPPAPFAPFAPLQPQQHP--PPSPP 298 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 33.1 bits (72), Expect = 0.27 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 744 PPXXAPPRXP-PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PP PP+ P P PP P P NPP P PP P PP Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMP-DTPNPPTPK---TPPDVVPPIWEPPRPPDIFPPE 170 Query: 921 RPXP 932 P P Sbjct: 171 SPPP 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP---PPSXXXXPPPXXXXPXXXPXPP 902 P P PP P P P P PP PP PP P P PP Sbjct: 124 PGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PP P PP P P P P PP PP P P Sbjct: 105 PPEVTTVPSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVP 155 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PG P P P P P PP PP PP PP Sbjct: 124 PGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPP 174 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPP--LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P S P P P PP +P PP P PPP P P Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYP----HXXXPXPXXNPPPP 842 T PP PP P PP P P P +PPPP Sbjct: 141 TPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPP 181 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 33.1 bits (72), Expect = 0.27 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP--XPXXNP--PPPSXXXXPPPXXXXPXXXPXPPX 905 PP P PP P PP P P P P PP PP P PP Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPT 168 Query: 906 XXXXARPXPXT 938 +P T Sbjct: 169 TTPPVKPPTTT 179 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/67 (28%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 738 PP--PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PP PP +PP PP + P P PP + PP P PP Sbjct: 141 PPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAP 200 Query: 912 XXARPXP 932 P P Sbjct: 201 PVKPPTP 207 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/69 (27%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPY--PHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXP 899 T P P PP P + P Y P P PP PP+ P P P Sbjct: 136 TSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVK 195 Query: 900 PXXXXXARP 926 P +P Sbjct: 196 PPTAPPVKP 204 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP--PPSXXXXPPPXXXXPXXXPXPPX 905 T PP PP P + P Y P P PP P P P P P P Sbjct: 86 TPVKPPVSTPPIKLPPVQPPTY---KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPP 142 Query: 906 XXXXARPXP 932 + P Sbjct: 143 TTPPVQSPP 151 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 33.1 bits (72), Expect = 0.27 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 6/73 (8%) Frame = +3 Query: 738 PPPPXXA----PPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXPXXXPXP 899 PPP A PP P +PP P NP P P P P P P P Sbjct: 47 PPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAP 106 Query: 900 PXXXXXARPXPXT 938 P P T Sbjct: 107 PQTPSNQSPERPT 119 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXP--PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P P P P PPP PPP PP PP P P Sbjct: 20 PSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSP 72 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/65 (29%), Positives = 22/65 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXX 917 PP +PP P +PP P NP PP+ P P P P Sbjct: 61 PPTQETSPPTSPSS--SPPVVANPSPQTPENPSPPAPEGSTP---VTPPAPPQTPSNQSP 115 Query: 918 ARPXP 932 RP P Sbjct: 116 ERPTP 120 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP P P P +PPP S PP P PP Sbjct: 19 PPSNGTSPSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPP 62 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 33.1 bits (72), Expect = 0.27 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -2 Query: 838 GGGXXXGXGXXXW--GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GGG G G + G G GG GG GG G G GRG G G Sbjct: 9 GGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRG 60 Score = 32.3 bits (70), Expect = 0.48 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXG-GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 GG G G GG GGGG G G G G R G RGGA G G Sbjct: 14 GGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRG-GRGRGRGPPRGGARGGRG 67 Score = 30.3 bits (65), Expect = 1.9 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 6/65 (9%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXW--GXGGARXXGGX----RGGAXXGGGGXVFXXGXGRGG 704 GGG G GG G G + G GG GG RGG G G G RGG Sbjct: 9 GGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGP---PRGGARGG 65 Query: 703 GGXLG 689 G G Sbjct: 66 RGPAG 70 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG-GGXLGXXXR 677 G GG G RGG G G F G G GG GG G R Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDR 48 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 33.1 bits (72), Expect = 0.27 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G G G GG G G GG G A GGGG Sbjct: 311 GGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAG 370 Query: 721 GXGRGGGGXLG 689 G GGGG G Sbjct: 371 GGMPGGGGMPG 381 Score = 33.1 bits (72), Expect = 0.27 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -3 Query: 924 GXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP--XGGXEXPG 781 G P G GG G GGG G GGG G G P GG PG Sbjct: 319 GFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPG 368 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 924 GXPXXXRGG-GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G P GG G G GGG G GGGG G GG PG Sbjct: 333 GFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGGGMPGAGGGMPGGGGMPG 381 Score = 29.1 bits (62), Expect = 4.4 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG--GXFXGXGXPXGGXEXPG 781 G G P GG GG G GGG G GGG G G P G PG Sbjct: 326 GMGGMPGGFPGGMGGGMPA--GMGGGMP-GMGGGMPAGMGGGGMPGAGGGMPG 375 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 802 WGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 +G GG GG GG GGGG G G GGGG Sbjct: 121 YGGGGGYSYGGGGGGYGGGGGG---YGGGGDGGGG 152 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 P R GGG G GGG GGGG + G G GG Sbjct: 115 PSAPRAYGGGGGYSYGGGGGGYG---GGGGGYGGGGDGGGG 152 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 GGGG G G +G GG GG GG GGG Sbjct: 123 GGGGYSYGGGGGGYGGGG----GGYGGGGDGGGG 152 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 784 RXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 R GG G + GGGG G G GGGG G Sbjct: 119 RAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGGXEXPG 781 G GGG G GGGG G G GG + G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXF 823 G G GGGGG G GGG G GGG F Sbjct: 122 GGGGGYSYGGGGGGYG----GGGGGYGGGGDGGGGF 153 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXG 817 P GGGGG G GGG G G G F G Sbjct: 97 PSVLTGGGGGGDGNFGGFGGGGGGGDGNDGGFWG 130 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 33.1 bits (72), Expect = 0.27 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 7/74 (9%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEG----GGGXXXGXGXXXWGXGGARXXG---GXRGGAXXGG 743 GG G G GG G G G G G GG G G RG GG Sbjct: 43 GGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGG 102 Query: 742 GGXVFXXGXGRGGG 701 GG G G GGG Sbjct: 103 GGPGSGCGSGTGGG 116 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 906 RGG-GGGXXXXXXGXGG-GXXXGRGGGGXFXGXGXPXGGXEXPG 781 RGG GGG G GG G G G GG G G P G PG Sbjct: 3 RGGCGGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPG 46 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/88 (31%), Positives = 28/88 (31%), Gaps = 7/88 (7%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXG--GARXXGGXRGG 758 G G GG G G G G GG G G G G G G RG Sbjct: 19 GRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGP 78 Query: 757 AXXGGGGX-----VFXXGXGRGGGGXLG 689 GGGG G GGGG G Sbjct: 79 RPGGGGGPGPGPWSGPRGPRPGGGGGPG 106 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 G G RGGG G G G G G G GG G G P G P Sbjct: 11 GRGGRGFGGRGGGPGFGPGGPGFGPGGP-GFGPGGPGFGPGGPGFGGRGP 59 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGG-----GGXFXGXGXPXGGXEXPG 781 GG G G GGG G GG GG G G P G PG Sbjct: 8 GGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPG 53 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 33.1 bits (72), Expect = 0.27 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXP 860 PP P PPR PP +PP P P PP P Sbjct: 227 PPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNP 267 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P S PP P P PP LP PP P P Sbjct: 228 PSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNP 267 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPP 904 S PP P P PPPP PPP P PPPP Sbjct: 867 SQPPE--PPPEMMPPPP--QALPPPLPHSHPPLVPPPP 900 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 PPP PP PP PP PH P PPPP Sbjct: 872 PPPEMMPP--PPQALPPPLPHSHPPLV---PPPP 900 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP---PPPRXXXGXPXPP 934 PP G P PP P PP P PP PPP P P Sbjct: 849 PPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVP 897 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN--PPPPSXXXXPPPXXXXPXXXPXP 899 PPPP P + P P P P PPPP P P P P P Sbjct: 847 PPPPLGHS--LPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPP 900 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 802 WGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 +G GG GG GGA GGG G G GGGG Sbjct: 185 YGGGGGSFGGGGGGGAGSYGGGGA---GAGSGGGG 216 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXF 823 GGGGG G GGG G GGGG F Sbjct: 193 GGGGGGGAGSYG-GGGAGAGSGGGGGF 218 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 R GGGG G GG G GG G G G Sbjct: 184 RYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 GGGGG G GGG GGGG G G G Sbjct: 186 GGGGGSFG---GGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/68 (27%), Positives = 21/68 (30%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GG GGGG W G A+ G G + Sbjct: 194 GGGGGGAGSYGGGGAGAGSGGGGGFSKADEVDNWAAGKAKSSTFGSGFRESGPEPDRWAR 253 Query: 721 GXGRGGGG 698 G GGG Sbjct: 254 GVLPSGGG 261 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 31.1 bits (67), Expect(2) = 0.29 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPP 901 PPPPLP P P PPPP Sbjct: 55 PPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 20.6 bits (41), Expect(2) = 0.29 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 701 PPPPPXP 721 PPPPP P Sbjct: 54 PPPPPLP 60 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYP 800 K+ PPPP PP PP + P P Sbjct: 105 KRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 28.7 bits (61), Expect(2) = 0.33 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPP 901 PPPP P PPP P PP Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 Score = 23.0 bits (47), Expect(2) = 0.33 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 689 PQXTPPPPPXP 721 P+ PPPPP P Sbjct: 104 PKRPPPPPPKP 114 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 G P PPP P PP P PPPPPR Sbjct: 152 GRPSSPDLPPPHFPPEFPPETP---TTPPPPPPR 182 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPR 907 G P P P PP+P PPP P P PP+ Sbjct: 189 GYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQ 229 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP-SXXXXPPPXXXXPXXXPXPP 902 PP PP+ P PP P P PPPP S P P P P P Sbjct: 185 PPASGYPPQ--PSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGP 237 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP---PXXXXPXXXPXPP 902 PP P PP P PP P P P + PP P P P P PP Sbjct: 191 PPQPSAYPP--PSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 Score = 31.5 bits (68), Expect = 0.83 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXN-PPPPSXXXXPPPXXXXPXXXPXPP 902 P PP PP P P PP PS PPP P P PP Sbjct: 181 PSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYP-PQPYPP 228 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXAR 923 P APP P APPY P PS PP P PP Sbjct: 149 PQYSAPPSASPYSTAPPYSGPSLYPQVQQYPQPS--GYPPASGYPPQPSAYPPPSTSGYP 206 Query: 924 PXP 932 P P Sbjct: 207 PIP 209 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 P PPPP P PP P PPPP G P Sbjct: 43 PNPSPPPP-PSNPSPPPPSPTTTACPPPPSSSGGGP 77 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G +G GG GG GGA GG G Sbjct: 572 GGGGGGGGGGSDYYGGGG--YGGGGYGGAPSGGYG 604 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 835 GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV-FXXGXGRGGGGXLG 689 GG G G R RGG GGGG + G G GGGG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RGGGGG G GG G GG G G P GG Sbjct: 571 RGGGGG-----GGGGGSDYYGGGGYGGGGYGGAPSGG 602 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G +G GG GG GGA GG G Sbjct: 572 GGGGGGGGGGSDYYGGGG--YGGGGYGGAPSGGYG 604 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 835 GGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXV-FXXGXGRGGGGXLG 689 GG G G R RGG GGGG + G G GGGG G Sbjct: 548 GGGKKRSGGRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 RGGGGG G GG G GG G G P GG Sbjct: 571 RGGGGG-----GGGGGSDYYGGGGYGGGGYGGAPSGG 602 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.7 bits (71), Expect = 0.36 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P +P PP PP P P P PPPP+ PP P PP Sbjct: 44 PSPVYSSPADLPP----PPTP-VYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PP P P PPP+ P PPPP G PP Sbjct: 79 PPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPP 124 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 818 PXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 P PPPP P PPP PPP P PP Sbjct: 51 PADLPPPPTPVYSPPP----ADLPPPPTPYYSPPADLPP 85 Score = 29.9 bits (64), Expect = 2.5 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 6/71 (8%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPP--PSXXXXPPPXXXXP----XXXPXP 899 PP P +PP P PP P+ P P P P PPP P P Sbjct: 57 PPTPVYSPP--PADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPP 114 Query: 900 PXXXXXARPXP 932 P P P Sbjct: 115 PSKYGKVYPPP 125 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 792 PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P P P PPPP+ PPP P P Sbjct: 42 PLPSPVYSSPADLPPPPTPVYSPPPADLPPPPTP 75 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGG G GGG G GGGG G G GG Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGG--CGGGGDGGG 815 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GG GG GGGG G G GGG G Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDG 813 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GGGGG G GGG G G GG Sbjct: 783 GGGGCGGGHHGGGGG---GCGGCGGGGCGGGGDGG 814 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 793 GGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GG GG GG GGGG G G GGGG G Sbjct: 783 GGGGCGGGHHGG---GGGGCGGCGGGGCGGGGDGG 814 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 832 GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGG 701 G G G GG GG G GGGG G G GGG Sbjct: 775 GYHHGGHHGGGGCGGGHHGGGGGGCGGCGGGG---CGGGGDGGG 815 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P +P P P P P NPPP + PP P PP Sbjct: 26 PAPTISPLPATPTPSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTESPPAPP 79 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 32.3 bits (70), Expect = 0.48 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP PP P P P P PP P PP Sbjct: 111 PPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGL 170 Query: 921 RPXP 932 P P Sbjct: 171 PPPP 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXX 914 P PP PP P PP P P PPP PP P PP Sbjct: 79 PRPPMMLPPGSMPMGMRPPVLPRPMMPPQGYMPPPGVPQMMAPPGAPLP-----PPPQNG 133 Query: 915 XARP 926 RP Sbjct: 134 ILRP 137 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP PP P APP P P PPP + PP P PP Sbjct: 105 PPQGYMPPPGVPQMMAPP----GAPLP---PPPQNGILRPPGMAPIPGQGGGPP 151 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 32.3 bits (70), Expect = 0.48 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +3 Query: 726 KKTXPPP----PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP-SXXXXPPPXXXXPXXX 890 K T PPP P P PP P P P P P + PPP P Sbjct: 87 KPTIPPPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYK 146 Query: 891 PXP 899 P P Sbjct: 147 PTP 149 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP P P Y P P PP PP P PP Sbjct: 115 PPPVYTPPVYKP---TPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSPPP 165 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P P P PP PP + P P PS PPP P P Sbjct: 126 PTPVYTKPTIPPPVYTPPV-YKPTPSPPVYKKSPSYSSPPPPYVPKPTYTP 175 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 K T PP P PP P Y H P P P PP Sbjct: 53 KPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPP 98 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +3 Query: 726 KKTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 K T PP P PP P Y P +PP + PPP P P P Sbjct: 77 KHTPSPPVYTKPTIPPPVYTPPVY------KPTLSPPVYTKPTIPPPVYTPPVYKPTP 128 Score = 29.5 bits (63), Expect = 3.4 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 11/75 (14%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPP-------PP--SXXXXPPPXXXXPXXXP 893 P P PP P P Y P P PP PP + PPP P P Sbjct: 43 PSPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKP 102 Query: 894 --XPPXXXXXARPXP 932 PP P P Sbjct: 103 TLSPPVYTKPTIPPP 117 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP R PP P P + PPP P P P Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARPFGP 63 Score = 28.3 bits (60), Expect(2) = 0.49 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPPP PPP P PPPP P H Sbjct: 9 PPPP-----PPPPPSFRSIPRPPPPPSFRSIPPRRH 39 Score = 22.6 bits (46), Expect(2) = 0.49 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 698 TPPPPPXP 721 TPPPPP P Sbjct: 8 TPPPPPPP 15 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 790 GARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 GAR G GG GGG + GR GGG G Sbjct: 503 GARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYG 536 Score = 32.3 bits (70), Expect = 0.48 Identities = 23/78 (29%), Positives = 26/78 (33%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G GR+ G G G GGG GG G G +G G GG+ Sbjct: 511 GGGRSGGGGYGSYGSSSGRS--GGGSYGGYGGSSGRSGGGGGSYGGSGGSS-SRYSGGSD 567 Query: 751 XGGGGXVFXXGXGRGGGG 698 G F G GG G Sbjct: 568 RSSGFGSFGSGGSSGGFG 585 Score = 29.5 bits (63), Expect = 3.4 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 1/82 (1%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G G GG G G GGG G GG GG G + Sbjct: 501 GVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSS 560 Query: 751 XGGGGXVFXXGXGR-GGGGXLG 689 GG G G G GG G Sbjct: 561 RYSGGSDRSSGFGSFGSGGSSG 582 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 GG P GG GG G GG GGGG G P Sbjct: 48 GGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPP 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 738 PPPPXXAPP--RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PPP PP R PP R P P P PP PP P P Sbjct: 107 PPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTP 160 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP--PPPRXXXGXPXPP 934 PP P P PP +P PPP PP PP PP Sbjct: 114 PPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPP 161 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/66 (25%), Positives = 18/66 (27%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXA 920 PPP PP P + PP P PP P P P Sbjct: 119 PPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPII 178 Query: 921 RPXPXT 938 P P T Sbjct: 179 NPPPVT 184 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 G PP P P PPP+ PPP PPP Sbjct: 85 GGKSPPVVRPPPVVVRPPPI--IRPPPVVYPPPIVRPPP 121 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 701 PPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPP 862 PPPP + PG S PP G P P P P PP Sbjct: 748 PPPPETQNPSHPHPHAPYYRPPEQMSRPGYSIPPYGPPPPYHTPHGQAPQPYPP 801 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P TPPPPP P + PPP P PPP Sbjct: 248 PPATPPPPPPPPPVEVPQKPRRTHRSVRNRDLQENAKRSETKFKRTFQPPPSPPPPPPPP 307 Query: 869 PXXXXXXPPPP 901 P PP Sbjct: 308 PPQPLIAATPP 318 Score = 25.8 bits (54), Expect(2) = 0.49 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPL 844 PP P P PPPPL Sbjct: 381 PPPSPPPPPPPPPPPL 396 Score = 25.0 bits (52), Expect(2) = 0.49 Identities = 12/32 (37%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 842 LPXXXPPPXPXXXXXXPPPPP-RXXXGXPXPP 934 +P PPP P P PP R G P P Sbjct: 420 VPAPPPPPPPRYTQFDPQTPPRRVKSGRPPRP 451 Score = 24.6 bits (51), Expect(2) = 3.0 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 791 SXPPXGXPXPXXXPPPPLPXXXP 859 S PP P PPPP P P Sbjct: 242 SSPPQQPPATPPPPPPPPPVEVP 264 Score = 23.4 bits (48), Expect(2) = 3.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 857 PPPXPXXXXXXPPPPP 904 PPP P PPP P Sbjct: 296 PPPSPPPPPPPPPPQP 311 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 31.9 bits (69), Expect = 0.63 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 K+ P +PP P +PP P P +PP P+ PP Sbjct: 71 KSPAPVSESSPPPTPVPESSPPVPAPMVSSPVSSPPVPAPVADSPP 116 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGG GG G GGGG G G GG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 G G G GG G GGG G GGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 GG G GG G GGG G GGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 799 GXGGARXXGGXRGG-AXXGGGGXVFXXGXGRGGGG 698 G GGA G GG + G GG G G GGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GGG G G G G GGGG G G Sbjct: 17 GGGAGCSAGNSGGSSGCGAGGGGGGSGGGGG 47 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 31.9 bits (69), Expect = 0.63 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAX 752 G R GG GGG GGGG G G G GA G G Sbjct: 547 GKNRRSGGRFGGRDFRRESFSRGGGGADYYGGGG---GYGGVPGGGYGAMP--GGYGPVP 601 Query: 751 XGGGGXVFXXG---XGRGGGGXLG 689 GG G V G GRGGG G Sbjct: 602 GGGYGNVPGGGYAPYGRGGGAYYG 625 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXX 722 GG G G GGG GG G G G GG G GGA G GG Sbjct: 577 GGGGGYGGVP--GGGYGAMPGGYGPVPGGGYGNVPGGGYAPYGRG-GGAYYGPGGYGTVP 633 Query: 721 GXGRGGG 701 G G G Sbjct: 634 NQGYGPG 640 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 31.9 bits (69), Expect = 0.63 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXP 925 P PP G P P PPP P PP PPP G P Sbjct: 502 PKEGYPPAGYPPPAGYPPPQYPQAGYPP-----AGYPPPQQGYGQGYP 544 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP P PPP PP P P PP Sbjct: 518 PPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPP--QYPYQGPPPP 569 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPP--PLPXXXPPPXPXXXXXXPP--PPPRXXXGXPXP 931 P + PP G P PP P P PPP P PPP+ G P Sbjct: 491 PVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYP 544 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 G G GGGGG GGG G GGGG Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGG 832 GG GGGGG GGG G GGG Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG G G GG GG GG+ GGGG Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGG--GGSSGGGGG 35 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 897 GGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXEXP 784 GGG G GGG GGGG G G GG P Sbjct: 3 GGGNTITAVGGGGGGC---GGGGSSGGGGSSGGGGGGP 37 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 31.9 bits (69), Expect = 0.63 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = -2 Query: 937 VXGXGRAXXXXXGGXGXXXGXXXXGGGXXXXEG--GGGXXXGXGXXXWGXGGARXXGGXR 764 V G G G G GGG G GGG G G GG + Sbjct: 24 VSGRGGGGGFVGSGNSPSIGSGYFGGGGNPGTGYMGGGIPSGGSIRDGSNVGTGYRGGFQ 83 Query: 763 GGAXXGGG 740 GG GGG Sbjct: 84 GGKPSGGG 91 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP P P PP + + H P P PPPP P P Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPP--PPPPPQWGPPSP 74 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX--PXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP PP P + PY P P N PPP P P P Sbjct: 64 PPPPQWGPPS-PHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYPQANQ 122 Query: 912 XXARP 926 P Sbjct: 123 EWGNP 127 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP PY PPP+ PP P P Sbjct: 6 PPPQYLRPPSGPPPP-TDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSP 59 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 31.9 bits (69), Expect = 0.63 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP P P PP + + H P P PPPP P P Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPP--PPPPPQWGPPSP 74 Score = 31.9 bits (69), Expect = 0.63 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPX--PXXNPPPPSXXXXPPPXXXXPXXXPXPPXXX 911 PPPP PP P + PY P P N PPP P P P Sbjct: 64 PPPPQWGPPS-PHYPQGQPYSSPAYPPHQPPFNAGANGNSQFPPPSTGAPIPPPYPQANQ 122 Query: 912 XXARP 926 P Sbjct: 123 EWGNP 127 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPP PP PP PY PPP+ PP P P Sbjct: 6 PPPQYLRPPSGPPPP-TDPYHQYYQHQARPPVPPPTQPGGPPAWYSNQFHHPHSP 59 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPP---YPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PP PP PP PP YP P P PP + PPP P P P Sbjct: 25 PPGAYPP--PPQGAYPPPGGYPPQGYPPPPHGYPPAA--YPPPPGAYPPAGYPGP 75 Score = 31.9 bits (69), Expect = 0.63 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 738 PPPPXXA--PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PPPP A PP P PP PH P PPPP PP P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAY--PPPPG--AYPPAGYPGP 75 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 782 PGXSXPP--XGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPP-PRXXXGXPXP 931 PG PP P P PP P PPP PPPP G P P Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYP---PPPHGYPPAAYPPPPGAYPPAGYPGP 75 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 801 HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 H P PPPP PPP P P PP A P Sbjct: 20 HGHGYPPGAYPPPPQG-AYPPPGGYPPQGYPPPPHGYPPAAYPP 62 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P P PPPP PPP PPPP PP Sbjct: 23 GYP-PGAYPPPP-QGAYPPPGGYPPQGYPPPPHGYPPAAYPPP 63 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 31.9 bits (69), Expect = 0.63 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRG-GGGXLG 689 G G R G RGG GGGG G RG GGG G Sbjct: 5 GYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQG 42 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG 740 GG G GG GGGG G G R G RGG G G Sbjct: 4 GGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRGQG 57 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXG--RGGG 701 GG G G G +G GG GG G G GG G G RGGG Sbjct: 8 GGRGDGRGRGGRGYGGGG----GGGEQGRDRGYGGGEQGRGRGSERGGG 52 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGGXE 790 G G GGGGG G GGG GRG G G G E Sbjct: 15 GRGGRGYGGGGGGGEQGRDRGYGGGEQ-GRGRGSERGGGNRGQGRGE 60 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 31.5 bits (68), Expect = 0.83 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 7/65 (10%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP-------XXXPXPPXXXXX 917 P P R PY + P P +PPPP PP P P PP Sbjct: 50 PSCKPRLQRYSPYGNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMY 109 Query: 918 ARPXP 932 + P P Sbjct: 110 SPPYP 114 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 5/53 (9%) Frame = +3 Query: 738 PPPPXXAPP-----RXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP P +PP PP R PP P PPP + P P P Sbjct: 67 PPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTP 119 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARP 926 P PP P PP P P PP P+ P P PP P Sbjct: 61 PYGNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPP 120 Query: 927 XP 932 P Sbjct: 121 YP 122 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.5 bits (68), Expect = 0.83 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 806 GXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 G P P PP P PP PPP P PPH Sbjct: 171 GGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPH 214 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPPL---PXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G P G P PP + P PP P PPPP P PP Sbjct: 135 GIGGPAPGMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPP 187 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PPPP PP PP + P PPP PPP P P Sbjct: 173 PPPPYGM---RPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRP 224 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 744 PPXXAPPRXPPXXRA-PPYPHXXXPXPXXNPPPPSXXXXPPPXXXXP 881 PP PP+ P + PP P+ P P PPPP P P Sbjct: 157 PPGQMPPQPPFAGQGGPPPPYGMRP-PYPGPPPPQYGGQQRPMMIPP 202 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 7/62 (11%) Frame = +3 Query: 738 PPPPXXA----PPRXPP---XXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPX 896 PPPP P PP R PP PH P P P P P P Sbjct: 186 PPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPA 245 Query: 897 PP 902 PP Sbjct: 246 PP 247 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +2 Query: 782 PGXSXPPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PG S P G P P PP PP PP G P PP+ Sbjct: 127 PGLSGPVRGIGGPAPGMMQP-QISRPPQIIRPPGQMPPQPPFAGQGGPPPPY 177 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.5 bits (68), Expect = 0.83 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPP P PPP P PPPPP Sbjct: 98 PPPQPP--PPPQPLNLFSPPPPPP 119 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPPP PP PP + YP PPPP P P P Sbjct: 30 PPPPQSQPP--PPQTQQQTYPPVMGYPGYHQPPPPYPNYPNAPYQQYPYAQAPP 81 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PPPP P PPP PP P PP+ Sbjct: 28 PPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPY 63 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXN---PPPPSXXXXPPP 866 P PP PPR PP +P + PPPP PPP Sbjct: 71 PSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P +PPPPP P PP PPPP P PPP Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPP---------PPPP-PPPPPPPS 118 Query: 869 PXXXXXXP--PPPP 904 P PPPP Sbjct: 119 STWDFWDPFIPPPP 132 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 31.5 bits (68), Expect = 0.83 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG GGG + G G GGG G Sbjct: 47 GNGGYNGGGGYNGGGGHNGGG--YNGGGGYNGGGHGG 81 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 918 PXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 P GG GG G G G GGG G G GG Sbjct: 38 PDQYNGGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGG 78 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGG 704 GG G G G + GG GG GG GGG G R G Sbjct: 46 GGNGGYNGGGG--YNGGGGHNGGGYNGGGGYNGGGHGGRHGYCRYG 89 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 933 GGXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GG G GGGG G GG G GGG + G G Sbjct: 43 GGHGGNGGYNGGGG-----YNGGGGHNGGGYNGGGGYNGGG 78 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGX-GGARXXGGXRGG 758 GG GGGG G G G GG GG GG Sbjct: 46 GGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 31.5 bits (68), Expect = 0.83 Identities = 23/86 (26%), Positives = 26/86 (30%), Gaps = 4/86 (4%) Frame = +2 Query: 689 PQXTPPPPPXPXXKNXXXXXXXXXXXXXXXXPGXSXPPXGXPXPXXXPPPPLPXXXPPPX 868 P+ +PP PP P + S PP PPP P PPP Sbjct: 7 PENSPPAPPPPSPPSPPSSNDQQT---------TSPPPSDNQETTSPPPPSSPDIAPPPQ 57 Query: 869 PXXXXXXPPPPPRXXXG----XPXPP 934 PP P G P PP Sbjct: 58 QQQESPPPPLPENSSDGSSSSSPPPP 83 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +3 Query: 747 PXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP-SXXXXPPPXXXXPXXXPXPPXXXXXAR 923 P +PP PP +PP P +PPP + PP P P PP + Sbjct: 7 PENSPPAPPPP--SPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAP-PPQQQQESP 63 Query: 924 PXP 932 P P Sbjct: 64 PPP 66 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 PPP +PP P P +PPPPS PP P P Sbjct: 15 PPPSPPSPPSSNDQQTTSPPPSDN--QETTSPPPPSSPDIAPPPQQQQESPPPP 66 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPP----PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G P P P PPP P+ PPP PPP G P P Sbjct: 531 GVYGDPNSFPGPAALPPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAPRP 583 Score = 31.5 bits (68), Expect = 0.83 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 839 PLPXXXPPPXPXXXXXXP-PPPPRXXXGXPXPP 934 P P PPP P P PPPP P PP Sbjct: 540 PGPAALPPPRPGVPIVRPLPPPPNLALNLPRPP 572 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPP 904 PPP+P PPP P PPP P Sbjct: 654 PPPMPGMAPPPPP---EEAPPPLP 674 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +3 Query: 759 PPRXPPXXRAPPYP------HXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PP+ P PP P H P P PP + PP P P PP Sbjct: 614 PPQMQPGMHVPPPPGSQFAHHMQIPRPYGQLPPSAMGMMQPP--PMPGMAPPPP 665 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 31.5 bits (68), Expect = 0.83 Identities = 17/57 (29%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 771 PPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP---XXXXPXXXPXPPXXXXXARPXP 932 PP PP P+ P P PP+ P P P P P +RP P Sbjct: 387 PPHQSYPPPPYGYMPSPYQQQYPPNHHHQPSPMQHYAPPPAAYPYPQQPGPGSRPAP 443 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 T PPPP A P + PP P P P PPP Sbjct: 70 TTPPPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPPPP 114 Score = 27.9 bits (59), Expect(2) = 2.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPP 904 PPPP P P P PPPP Sbjct: 90 PPPPRPQTPPTFVPEETQPQTPPPP 114 Score = 20.6 bits (41), Expect(2) = 2.3 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 701 PPPPPXP 721 PPPPP P Sbjct: 89 PPPPPRP 95 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 G G RG GGG G GGG GGGG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGGG G G GG GG GG+ GGGG Sbjct: 71 GGGGGGRGYGGGGRREGGG--YGGGDGGSYGGGGG 103 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 930 GXGXPXXXRGGGGGXXXXXXGXGGGXXXGRGGGG 829 G G GGGG G G G G GGGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGG 829 GG GG G GGG G GGGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGG 36 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPPP R P +PP P N PPP PPP Sbjct: 123 PPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPP----PPPP 161 >At2g41420.1 68415.m05111 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP+ P PP + P PPP PPP Sbjct: 28 PPQGYPPQGYPQQGYPPQGYPQQGYPQQGYPPPYAPQYPPP 68 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = +3 Query: 738 PPPPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 P P PP+ P P + P PH P +P PP+ PPP P P PP Sbjct: 152 PTAPVMPPPQVPVMPPPQVPVKPH--PKVPVISPDPPA--TLPPP--KVPVISPDPP 202 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 813 PXPXXNPPPPSXXXXPPPXXXXPXXXPXPPXXXXXARPXP 932 P P PPPS PPP P P PP +RP P Sbjct: 102 PPPPDLFPPPSAQMLPPP----PASSPAPPSPPSSSRPRP 137 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 756 APPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXP 899 APP PP PP P P +P PPS PP P P P Sbjct: 100 APP-PPPDLFPPPSAQMLPPPPASSPAPPS-----PPSSSRPRPLPRP 141 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 833 PPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPP P PPP PPPP P PP Sbjct: 101 PPPPPDLFPPPSAQML----PPPPASSPAPPSPP 130 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 775 GGXRGGAXXGGGGXVFXXGXGRGGGG 698 GG GG GGGG G G GGGG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGG 829 GG GG G GGG G GGGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 838 GGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GGG G G G GG GG GG GGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGG---GGGG 89 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 870 GXGGGXXXGRGGGGXFXGXGXPXGG 796 G GGG G GGGG G G GG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGG 85 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 865 GGGXXXXEGGGGXXXGXGXXXWGXGG 788 GGG +GGGG G G G GG Sbjct: 63 GGGDGGGDGGGGGCGGGGGCGGGGGG 88 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 PPPP P P P P PPPPP P P Sbjct: 222 PPPPPPPSQPLPRP---LLLPPPPPPSFHAQPILP 253 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +3 Query: 738 PP--PPXXAPPRXP--PXXRAPPYPHXXXPXPXXNPPPPSXXXXPP--PXXXXPXXXPXP 899 PP PP AP + P P + P YP P PP PP P P Sbjct: 122 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVK 181 Query: 900 PXXXXXARP 926 P A+P Sbjct: 182 PPVSPPAKP 190 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +3 Query: 729 KTXPPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 KT P AP P PH P P +P PP+ PP PP Sbjct: 30 KTQTPSLAPAPAPYHHGHHHPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPP 87 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 732 TXPP-PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 T PP P +PP PP + P YP P PP PP Sbjct: 104 TKPPVKPPVSPPAKPPV-KPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 29.5 bits (63), Expect = 3.4 Identities = 23/74 (31%), Positives = 26/74 (35%), Gaps = 8/74 (10%) Frame = +3 Query: 729 KTXPPPPXXAPPRXP--PXXRAPPYPHXXXP-XPXXNP---PPPSXXXXPP--PXXXXPX 884 K+ PP AP P P + P YP P P P PP S PP P P Sbjct: 69 KSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPT 128 Query: 885 XXPXPPXXXXXARP 926 P P +P Sbjct: 129 KAPVKPPTKPPVKP 142 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 732 TXPP-PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 T PP P +PP PP + P YP P PP PP Sbjct: 176 TKPPVKPPVSPPAKPPV-KPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 28.7 bits (61), Expect = 5.9 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP--PXXXXPXXXPXPPXXX 911 P P PP PP +AP P P PP PP P P P P Sbjct: 155 PTKPPVKPPVYPPT-KAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTK 213 Query: 912 XXARP 926 P Sbjct: 214 PPVTP 218 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 26.6 bits (56), Expect(2) = 1.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 830 PPPPLPXXXPPPXP 871 PPPP P PPP P Sbjct: 44 PPPPPPPRPPPPPP 57 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 698 TPPPPPXP 721 TPPPPP P Sbjct: 43 TPPPPPPP 50 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFX 725 G G G G G E G G G +G GG G + GG G Sbjct: 376 GNNGGSRGRYFSGRGSFRNESFKGGRGGGGRGGYGRGGGEFSGRPKSSNPRNGGEGYQRV 435 Query: 724 XGXGRGGGGXLGXXXR 677 G GG G G R Sbjct: 436 PQNGGGGRGGRGEGGR 451 >At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 459 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGG-GXVFX 725 G G G G G E G G G +G GG G + GG G Sbjct: 375 GNNGGSRGRYFSGRGSFRNESFKGGRGGGGRGGYGRGGGEFSGRPKSSNPRNGGEGYQRV 434 Query: 724 XGXGRGGGGXLGXXXR 677 G GG G G R Sbjct: 435 PQNGGGGRGGRGEGGR 450 >At5g56890.1 68418.m07099 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 1113 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PP P PPR PP P P +PP S PP P P Sbjct: 171 PPTPSNVPPRNASNNHKPP-PIEKSIAPVASPPTISIDIAPPVHPVIPKLTP 221 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 GGGGG G G G GGGG G G P Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGP 140 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 841 GGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG G G G G + GG GG GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 862 GGXXXXEGGGGXXXGXGXXXWGXGGARXXGGXRGGAXXGGGG 737 GG GGGG G GG GG GG GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGG----GGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G GG G GGGG G G GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 820 GXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGG 698 G G G G A G + G GGGG G G GGGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGG-----GGGGGGGG 138 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXG 799 +GGGGG G G GGGG G G G Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXPXGG 796 GGGG G G GGGG G G GG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 903 GGGGGXXXXXXGXGGGXXXGRGGGGXFXGXG 811 GGGGG G GG GRGGGG F G Sbjct: 25 GGGGGHGGGGHGRGG---HGRGGGGIFFFGG 52 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -2 Query: 865 GGGXXXXEGGG---GXXXGXGXXXWGXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGX 695 GGG GGG G G G G++ GG GG+ G G G G G Sbjct: 199 GGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNR 258 Query: 694 L 692 L Sbjct: 259 L 259 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 900 GGGGXXXXXXGXGGGXXXGRGGGGXFXGXGXP 805 GGGG G GGG G GGGG G P Sbjct: 211 GGGGGLGGGNGSGGGGGGG-GGGGRISGGSSP 241 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPP 842 P P PP P R P P P PPPP Sbjct: 98 PSPAYGPPGGAPFQRFPSPPFPTTQNPPQGPPPP 131 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +2 Query: 782 PGXSXPPXGX---PXPXXXPPPPLPXXXPPPXPXXXXXXPP---PPPRXXXGXPXPP 934 PG PP P P PP P P P PP PPP+ G PP Sbjct: 85 PGSRPPPPSSNSFPSPAYGPPGGAPFQRFPSPPFPTTQNPPQGPPPPQTLAGHLSPP 141 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +3 Query: 732 TXPPPPXXAPPRXPPXXRAPPYPHXXXPX-PXXNPPPPSXXXXPPPXXXXPXXXP 893 T P PP P P P P PPPPS P P P P Sbjct: 55 TRPFTASGPPPAPPVGTMRPGQPSPFVSQIPGSRPPPPSSNSFPSPAYGPPGGAP 109 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 830 PPPPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 PPPP P P P P P PPP P P Sbjct: 193 PPPPPPPPTPRP-PRLLSSQPAPPPTPPVSLPSP 225 >At4g22740.2 68417.m03281 glycine-rich protein Length = 356 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG G GG F G GRG G G Sbjct: 3 GGGGRDPFGGGFGGPFGGFGGGSFG-GFGRGSFGGFG 38 >At4g22740.1 68417.m03280 glycine-rich protein Length = 356 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 799 GXGGARXXGGXRGGAXXGGGGXVFXXGXGRGGGGXLG 689 G GG GG GG G GG F G GRG G G Sbjct: 3 GGGGRDPFGGGFGGPFGGFGGGSFG-GFGRGSFGGFG 38 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 30.3 bits (65), Expect = 1.9 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 4/85 (4%) Frame = -2 Query: 931 GXGRAXXXXXGGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGAR----XXGGXR 764 G G G G G GG EGG G G G G R GG R Sbjct: 839 GGGTRWDSGGGFGGRGGGFSGREGGFGGREGGFGGREGGFGGRGGRFGMRDDSFGRGGNR 898 Query: 763 GGAXXGGGGXVFXXGXGRGGGGXLG 689 G G G GRGG G G Sbjct: 899 GRGFTGPDAGHMNVG-GRGGFGRFG 922 Score = 29.5 bits (63), Expect = 3.4 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -2 Query: 901 GGXGXXXGXXXXGGGXXXXEGGGGXXXGXGXXXWGXGGA-RXXGGXRGGAXXGGGGXVFX 725 GG G G GGGG G G GG G GG G GG Sbjct: 818 GGGGPGYSQDRRGMVNRFDSGGGGTRWDSGGGFGGRGGGFSGREGGFGGREGGFGGREGG 877 Query: 724 XGXGRGG 704 G GRGG Sbjct: 878 FG-GRGG 883 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 759 PPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPP 863 PP PP PP P P P P PP PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPA--PEPPKHVCKPP 104 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 797 PPXGXPXPXXXPPPPLPXXXPPPXPXXXXXXPP 895 PP P P P P P P P P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPPP-------LPXXXPPPXPXXXXXXPPPPPRXXXGXPXPP 934 G PP PPPP +P PP PPPPP PP Sbjct: 189 GYRRPPPNQGMGGAPPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPP 245 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +3 Query: 759 PPRXPPXXRAPPYP-----HXXXPXPXXNPPPPSXX-XXPPPXXXXPXXXPXPP 902 PP+ P R PP P H P P PP S PPP P P PP Sbjct: 602 PPQMQPVMRVPPPPGSQFSHMQVPQPYGQLPPLSMGMMQPPPMAEMP--PPPPP 653 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +2 Query: 785 GXSXPPXGXPXPXXXPPP----PLPXXXPPPXPXXXXXXPPPPPRXXXGXPXP 931 G P P P PPP P PPP PPP G P P Sbjct: 519 GVYGDPNSFPGPAAFPPPRPGVPTVRPLPPPQNLALNLPRPPPSVQYPGAPRP 571 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXP 815 PPP PP PP PP P P Sbjct: 641 PPPMAEMPPPPPPGEAPPPLPEEPEP 666 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 839 PLPXXXPPPXPXXXXXXP-PPPPRXXXGXPXPP 934 P P PPP P P PPP P PP Sbjct: 528 PGPAAFPPPRPGVPTVRPLPPPQNLALNLPRPP 560 >At5g65410.1 68418.m08226 zinc finger homeobox family protein / ZF-HD homeobox family protein similar to hypothetical proteins (GP|4220524)(GP|3184285|)(Arabidopsis); ZP-HD homeobox family protein GP|13374061 (Flaveria bidentis);GP:5091602 {Oryza sativa} Length = 279 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 792 PYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXPXPP 902 PY H P PPPP P P P PP Sbjct: 126 PYFHHAPPQHQPPPPPPGFYRLPAPVSYRPPPSQAPP 162 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 744 PPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP PP P P P P + PP PPP Sbjct: 132 PPQHQPPPPPPGFYRLPAPVSYRPPP--SQAPPLQLALPPP 170 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PPP PP PP PP+ P P PPP + PP Sbjct: 559 PPPTALPP--PPPLAKPPHVVERLPLPP--PPPIAPEEQEPP 596 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 812 PXPXXXPPPPLPXXXPPPXPXXXXXXPPPP 901 P P PPPP P PP PPPP Sbjct: 559 PPPTALPPPP-PLAKPPHVVERLPLPPPPP 587 >At4g23882.1 68417.m03434 heavy-metal-associated domain-containing protein Length = 284 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 836 PPLPXXXPPPXPXXXXXXPPPPPRXXXGXPXPPH 937 PP+ P P P PPP G P PP+ Sbjct: 222 PPMVYPPPQAVPGFTTPIPYPPPSFFPGRPPPPY 255 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 906 RGGGGGXXXXXXGXGGGXXXGRGGG 832 RGGGG G GGG GR GG Sbjct: 112 RGGGGAPRGSFRGEGGGPGGGRRGG 136 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +3 Query: 738 PPPPXXAP-PRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 P P P P PP PP P N P S PPP P P Sbjct: 145 PSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPPPAPLPPSLSP 197 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 P P P P P Y NPPPP+ P P Sbjct: 48 PAPAPVPAPSPASSYGPQYSQEGYASQPNNPPPPTYAPAPSP 89 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +3 Query: 741 PPPXXAPPRXPPXXRAPPY-PHXXXPXPXXNPPPPSXXXXPPPXXXXPXXXP 893 PP A P PP + PP P PPPS PPP P P Sbjct: 256 PPSSTAAPSQPPSSQLPPQLPTQFSSQQEPYCPPPSH-PQPPPSNPPPYQAP 306 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 738 PPPPXXAPPRXPPXXRAPPYPHXXXPXPXXNPPPPSXXXXPPP 866 PP PP PP +AP P P P PPP Sbjct: 289 PPSHPQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPP 331 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,823,292 Number of Sequences: 28952 Number of extensions: 333001 Number of successful extensions: 21803 Number of sequences better than 10.0: 326 Number of HSP's better than 10.0 without gapping: 1120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8018 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2246578488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -