BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K04 (994 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AF506022-1|AAM46898.1| 685|Tribolium castaneum polyubiquitin pr... 23 4.9 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 23 4.9 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 6.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 6.4 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 6.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 6.4 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 6.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 6.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.4 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 6.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 6.4 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 2.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSPKTRLXLCTSATVS 455 LST + SSG+ S LSV S P TS +S Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLS 167 >AF506022-1|AAM46898.1| 685|Tribolium castaneum polyubiquitin protein. Length = 685 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 159 PDRSRNDILEEQLYNXVXVXDYDXAAEKSXHL 254 PD+ R+ +QL + + DY+ E + HL Sbjct: 418 PDQQRSIFAGKQLEDGRTLSDYNIQKESTLHL 449 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 439 VHKXNRVFGEDKSTLNWETIPDDVLGV 359 VH +R GED T IP D + + Sbjct: 62 VHLISRALGEDVRTQKGYLIPKDTITI 88 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 319 MNXMEYAYQLWLXXLXGHRPGLFPS*V*TYLRRK 420 +N M Y + + GH GL+PS V T +K Sbjct: 202 INVMAYDLRGSWDGVTGHHSGLYPSAVDTTTNQK 235 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 85 LSTPSNSNATKSSGLTSPLSVSTSPP 110 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 339 LSTLAPXTPRTSSGIVSQLSVDLSSP 416 LST + SSG+ S LSV S P Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPP 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,078 Number of Sequences: 336 Number of extensions: 2369 Number of successful extensions: 27 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28237209 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -