BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K04 (994 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 40 0.002 03_06_0297 - 32924162-32924605 33 0.27 03_01_0515 - 3864796-3865425 33 0.27 02_04_0400 - 22608519-22608844,22609044-22609122 33 0.27 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 33 0.35 07_03_1433 + 26513728-26514135,26525534-26526280 33 0.47 07_03_0558 + 19461369-19462448 33 0.47 06_03_1326 - 29355467-29355817 33 0.47 06_03_0790 - 24636805-24637770 33 0.47 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 32 0.62 08_02_1615 + 28257275-28258428,28258523-28259144 32 0.62 07_03_1751 - 29215074-29216270 32 0.62 12_02_0299 - 17051570-17052474,17053542-17053755 32 0.82 12_01_0838 - 7830944-7831444 32 0.82 08_01_0059 - 394001-394708 32 0.82 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 32 0.82 07_03_0560 + 19479597-19480667 32 0.82 07_03_0559 + 19475893-19476783 32 0.82 07_03_0177 - 14770777-14772045 32 0.82 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 32 0.82 03_01_0023 + 198414-198968 32 0.82 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 32 0.82 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 32 0.82 10_03_0023 - 7151465-7152111,7152222-7152405 31 1.1 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.1 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.1 06_01_0486 - 3455030-3455770 31 1.1 07_03_0890 - 22332768-22333382 29 1.2 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 26 1.4 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 26 1.4 11_06_0610 - 25449085-25453284 31 1.4 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.4 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 26 1.7 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 31 1.9 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 31 1.9 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 26 2.3 07_03_1432 - 26508135-26508881,26509301-26509708 30 2.5 12_02_1174 - 26696869-26698191 30 3.3 03_02_0765 + 11000724-11002496 30 3.3 02_05_0686 - 30900748-30902167,30903442-30904742 30 3.3 02_05_0149 + 26290236-26290880 30 3.3 10_08_0214 - 15915156-15915713 29 4.4 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 4.4 07_03_1136 + 24218601-24218734,24218769-24219906 29 4.4 06_02_0127 + 12140843-12140966,12141170-12141567 29 4.4 06_01_0178 + 1386981-1387505 29 4.4 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 29 4.4 04_03_1022 - 21778315-21779007 29 4.4 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 29 4.4 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 4.4 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 4.4 07_01_0015 + 108338-109186 26 5.4 10_08_0213 - 15912048-15912716 29 5.8 07_01_0080 + 587674-588510 29 5.8 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 5.8 04_03_0904 + 20717005-20718087 29 5.8 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 5.8 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 5.8 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 5.8 01_01_0570 - 4231100-4232560 29 5.8 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 26 6.6 11_01_0066 - 536281-537196,537397-537452 29 7.6 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 7.6 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 7.6 08_02_0796 - 21300251-21300373,21300846-21301721 29 7.6 07_03_1381 - 26166673-26166747,26166972-26167544 29 7.6 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 7.6 06_03_1506 + 30641428-30642168 29 7.6 06_02_0126 + 12130409-12130532,12131015-12131373 29 7.6 04_04_1687 - 35365766-35366356,35367137-35368135 29 7.6 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 7.6 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 7.6 03_05_0630 + 26260159-26260272,26260520-26260894 29 7.6 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 7.6 02_04_0001 - 18816492-18816741,18816881-18817050,18817244-188173... 29 7.6 06_01_0561 - 3983308-3983564,3983652-3983775 26 7.7 04_04_0057 + 22410167-22411330 24 8.8 08_02_0937 + 22801526-22802461 25 8.9 12_01_0319 + 2440129-2440661,2440875-2440902 26 9.4 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/58 (34%), Positives = 23/58 (39%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P P P +PP P P PL+P P PPP P P P + PP P Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPP--PPPPPPLPSGPPPQPAPPPLPIQPPPIP 1209 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +2 Query: 794 PSGSPXXPX-APPAXXIP-XPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P G P P APP +P P PL P PP P P P L PP P Sbjct: 1126 PDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPP 1185 Score = 32.3 bits (70), Expect = 0.62 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 782 DRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPX 961 D P P P P+ P PL P P PPP P P PP Sbjct: 1135 DAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 Query: 962 XP 967 P Sbjct: 1195 QP 1196 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXP 907 P P P PP P PLP+ P P PPP P Sbjct: 1182 PPPPPPLPSGPPPQPAPPPLPIQPPPIP--PPPVPSSP 1217 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 788 LXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXP 907 L PS P P PP P P P P PPP P Sbjct: 1160 LPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXP 934 P SP P PP P PLP P P PPP P P P Sbjct: 1173 PPLSPSLPPPPP----PPPLPSGPPPQPA-PPPLPIQPPPIPPPPVP 1214 >03_06_0297 - 32924162-32924605 Length = 147 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/69 (26%), Positives = 22/69 (31%) Frame = +2 Query: 782 DRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPX 961 + L +P APP +P P P P P P P P P + PP Sbjct: 59 EELPSIDTPPEFEAPPGLDVPMPPPGAPTPGPEQPGPSIPSPPMPEVPDVPRNPDVPPPK 118 Query: 962 XPXXSXXXP 988 P P Sbjct: 119 PPELDPPRP 127 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXX 973 P+ P P PP + P P P PPP P P P PP P Sbjct: 64 PAAGPLMPPPPPPPSVTSSPP-PPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAW 122 Query: 974 S 976 S Sbjct: 123 S 123 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXX 973 P P P A + P P P PPP P P P PP P Sbjct: 54 PPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVK 113 Query: 974 SXXXP 988 S P Sbjct: 114 SSPPP 118 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXP 828 GG GGGG GG GG G GGG GG P Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYP 95 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXP 828 GG GGGG GG GG G GGG GG P Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 77 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 962 GXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G GGG GG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G GGG GG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 PS + P PP P P + PPP P P P L PP P Sbjct: 221 PSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPPREIVPGQTLLPPPPPP 278 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/58 (27%), Positives = 18/58 (31%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 PS P P PP P+ + P PPP P P PP P Sbjct: 200 PSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPP 257 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 32.7 bits (71), Expect = 0.47 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +2 Query: 794 PSGSPXXPXA--PPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXP 934 PS SP P PP+ P P P++P PPP P P P Sbjct: 38 PSLSPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPAPTSPSP 86 >07_03_0558 + 19461369-19462448 Length = 359 Score = 32.7 bits (71), Expect = 0.47 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXPVEPXGXAG 804 GG GGGG GG GG G GGG GG + G G Sbjct: 244 GGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGGGGLGGGHGSGFGG 297 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 102 GGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGG 143 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 280 GGGGGGGLGGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGG 321 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXV 834 GG GGG GG GG G GGG GG V Sbjct: 162 GGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGGGV 205 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXV 834 GG GGG GG GG G GGG GG V Sbjct: 302 GGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGAGAGVGGGAGGGV 345 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 176 GGGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGG 216 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGG GG GG G GGG GG Sbjct: 198 GGGAGGGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGG 239 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G GGG GG Sbjct: 316 GGGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGGGGFGGGGGG 357 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXV 834 GG GGG GG GG G G G GG V Sbjct: 230 GGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGGGV 273 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXV 834 G GGG GG GG G GGG GG V Sbjct: 266 GSGAGGGVGGGGGFGGGGGGGLGGGHGSGFGGGAGVGGGAGGGV 309 >06_03_1326 - 29355467-29355817 Length = 116 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGG 43 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 989 GXEXXXXXGGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G + GG GGG GG GG G GGG GG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGG 51 >06_03_0790 - 24636805-24637770 Length = 321 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXPVEPXGXAGN 801 GG GGGG GG GG G GGG GG G GN Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGN 148 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G + GG GG Sbjct: 130 GGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGG 171 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 773 TVHDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 T L P+ +P P + + +P P PL P+ PPP Sbjct: 75 TAAPALAPTPTPPPPSSTASSSLPPPTPLLPKHQQAPPPP 114 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 776 VHDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 +H P P P AP A P P PLTP PPP Sbjct: 39 LHHHHSPQSHPQ-PDAPAAAAPPPPAPLTPPPPKSPPPP 76 >07_03_1751 - 29215074-29216270 Length = 398 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 130 GGGGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGGGGLGG 171 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXPVEPXGXAG 804 GG GGG GG GG G GGG GG V G G Sbjct: 326 GGGFGGGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKGGGFGGGVGGGHGAGGGG 379 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGG GG GG G GGG GG Sbjct: 170 GGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGG 211 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 208 GAGGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAGG 249 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 302 GGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGG 343 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GG G GG GG G GGG GG Sbjct: 306 GGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGG 347 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGG GG GG G GGG GG Sbjct: 318 GGGKGGGFGGGFGGGKGGGVGGGAGGGFGGGGGAGAGGGFGG 359 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 815 PXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P +PP P PLP P PPP P P P PP P Sbjct: 252 PPSPPPPAFPFPLP----PWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFP 298 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +2 Query: 788 LXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPP-----PXXXXPXXXPXXXXPXXXXLX 952 L P SP P PP P P P P P PP P P P P Sbjct: 280 LPPIFSPPSPPPPPPPAFPFPFPQLP-PLPHFPPLPSFYPSPPPPPPPPPPPPPSFPWPF 338 Query: 953 PPXXP 967 PP P Sbjct: 339 PPLAP 343 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 Query: 824 PPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXSXXXP 988 PP +P PLP P P PPP P P P P S P Sbjct: 235 PPPPFLPFPLPPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSP 289 >12_01_0838 - 7830944-7831444 Length = 166 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 989 GXEXXXXXGGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G E GG GGGG GG G G + GGG GG Sbjct: 31 GGESGGGGGGGGGGGGGGNGSGSGSGYGYNYGKGGGQSGGGQGSGGGGGG 80 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G + GGG GG Sbjct: 75 GGGGGGGGGGSNGSGSGSGYGYGYGQGNGGAQGQGSGGGGGG 116 >08_01_0059 - 394001-394708 Length = 235 Score = 31.9 bits (69), Expect = 0.82 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 815 PXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P PP P P P TP P PP P P P PP P Sbjct: 2 PPPPPPRRAPPP-PATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHP 51 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P P PP+ I P P TPR P PPP P P PP P Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPR--PYAPPPPSHPLAPPPPHISPPAPVPPPPSPP 72 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXP 907 P+ P P P P P P P+ P PPP P Sbjct: 53 PTAPPPKPSPTPPPASPPPAPTPPQTRPPSPPPQQQQP 90 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 Query: 803 SPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 S P APP P P P +P P PP P P P P P Sbjct: 49 SSAAPTAPPPKPSPTPPPASP--PPAPTPPQTRPPSPPPQQQQPRPVSPPPVAEP 101 >07_03_0560 + 19479597-19480667 Length = 356 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 74 GGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGG 115 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 251 GGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGG 292 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G + GG GG Sbjct: 243 GGGGGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGG 284 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXV 834 GG GGGG G GG G GGG GG V Sbjct: 97 GGLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGV 140 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 85 GGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGG 126 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG G GG GG GG G GGG GG Sbjct: 89 GGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGG 130 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 167 GGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGG 207 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 85 GGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGG 126 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 162 GGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGG 202 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 80 GLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGG 121 >07_03_0177 - 14770777-14772045 Length = 422 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 371 GGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGG 412 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 94 GGGGGGGLGGGGGFGKGGGVGGGFGKGGGFGKGGGFGGGFG 134 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 376 GGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGGGGGG 417 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 148 GGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGG 189 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 149 GGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGG 191 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 151 GGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGG 192 >03_01_0023 + 198414-198968 Length = 184 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGG 80 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXPVE 822 GG GGG GG G G GGG GG P++ Sbjct: 56 GGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCPID 103 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG G Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSG 79 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 282 GGKGGGGGGGGNTGGGIGGSTGGGGRGAGAGVGGITGGGDGG 323 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 55 GGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGG 96 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 962 GXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 72 GGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGG 112 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGG 92 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPP 889 P +P P PP +P P+PL P PG PP Sbjct: 233 PLLNPPPPPPPPPSLLP-PVPLLPPLIPGVPP 263 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 806 PXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 P P PP+ IP LPL P P PPP Sbjct: 215 PLTPQPPPSSLIPPVLPL-PLLNPPPPPP 242 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXX 973 P+ SP P PP P PLP + PPP P P PP P Sbjct: 559 PAFSPPPPPPPPP---PPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNR 615 Query: 974 SXXXP 988 S P Sbjct: 616 SVPPP 620 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 S P P PP P P P P P P P P L PP P Sbjct: 583 SQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPP 642 Query: 977 XXXP 988 P Sbjct: 643 PSLP 646 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +2 Query: 782 DRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPX 961 DR PS SP PP P P P + PPP P P PP Sbjct: 531 DRKLPSPSPTAAAPPPPP--PPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPP 588 Query: 962 XP 967 P Sbjct: 589 PP 590 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 761 QAXDTVHDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 +A +T+ P P P PP P PLP P P PPP Sbjct: 414 KATETIQYTELPPPPPLPPPPPPPPPPPPPLP--PNMPPPLPPP 455 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 425 PPPPPLPPPPPPPPPPPPP 443 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 428 PPLPPPPPPPPPPPPPLPP 446 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 937 PPXPPPPXPPXXLXXSXP 990 PP PPPP PP L + P Sbjct: 432 PPPPPPPPPPPPLPPNMP 449 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 779 HDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPP 958 H P SP P P P P P P P P P P P P PP Sbjct: 61 HHHHKPPPSPRCPSCHPPYTPPTPRP--PPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPP 118 Query: 959 XXP 967 P Sbjct: 119 PTP 121 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/64 (28%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 803 SPXXPXAPPAXXIPXPLPLTPRXXPGXPPP--XXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 +P P PP +P P P P P PP P P P PP P + Sbjct: 83 TPRPPPTPP--YVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPT 140 Query: 977 XXXP 988 P Sbjct: 141 PPSP 144 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 75 PPPPPAEATPPPPPPPPPP 93 Score = 27.1 bits (57), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 SXPPXXXXXXXPPXPPPPXP 963 S PP PP PPPP P Sbjct: 74 SPPPPPAEATPPPPPPPPPP 93 Score = 23.0 bits (47), Expect(2) = 1.2 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 937 PPXPPPPXPPXXLXXSXP 990 PP PPPP P P Sbjct: 104 PPPPPPPTAPTPTPPELP 121 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 305 PPIPPPPPPP 314 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 940 PXPPPPXPPXXLXXS 984 P PPPP PP + S Sbjct: 308 PPPPPPPPPPPMPRS 322 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 24 PPLPPPPPPP 33 Score = 23.8 bits (49), Expect(2) = 1.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 940 PXPPPPXPPXXL 975 P PPPP PP L Sbjct: 27 PPPPPPPPPSQL 38 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 S P P P I P P P P PPP P P P PP P S Sbjct: 1151 SPPPPAPVILPPPPIKSPPPPAPVISP--PPPVKSPPPPAPVILPPPPVKSPPPPAPVIS 1208 Query: 977 XXXP 988 P Sbjct: 1209 PPPP 1212 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 S P P P + P P P P PPP P P P PP P S Sbjct: 1183 SPPPPAPVILPPPPVKSPPPPAPVISP--PPPVKSPPPPAPVILPPPPVKSPPPPAPVIS 1240 Query: 977 XXXP 988 P Sbjct: 1241 PPPP 1244 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPP 958 P SP P P P LP P P P P P P L PP Sbjct: 1141 PVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPP 1195 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 S P P P + P P P P PPP P P P PP P Sbjct: 1167 SPPPPAPVISPPPPVKSPPPPAPVILP--PPPVKSPPPPAPVISPPPPVKSPPPPAP 1221 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 S P P P + P P P P PPP P P P PP P Sbjct: 1199 SPPPPAPVISPPPPVKSPPPPAPVILP--PPPVKSPPPPAPVISPPPPEKSPPPAAP 1253 Score = 28.7 bits (61), Expect = 7.6 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 806 PXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXSXXX 985 P PP P P P+ P P PPP P P P PP P S Sbjct: 1123 PATVSLPPPTVKPLPPPV-PVSSP--PPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPP 1179 Query: 986 P 988 P Sbjct: 1180 P 1180 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPP 958 P SP P P P LP P P P P P P L PP Sbjct: 1173 PVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPP 1227 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +2 Query: 779 HDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXP 934 H R+ P P P P P P ++P P PPP P P P Sbjct: 85 HHRIPPPPPPLLPTPP-----PPPASISPTPAPPLPPPPAPAPPPTPTPKFP 131 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 815 PXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 P +PP +P P TP P PPP P P L P P S Sbjct: 54 PDSPPPPPLPTPTVTTPTPPP--PPPAPRPPRRHHRIPPPPPPLLPTPPPPPAS 105 Score = 29.1 bits (62), Expect = 5.8 Identities = 22/84 (26%), Positives = 24/84 (28%), Gaps = 9/84 (10%) Frame = +2 Query: 743 YHRXYRQAXDTVHDRLXPSGSPXXPXAPPAXXIPXPLPLTP--------RXXPGXPPPXX 898 +HR T+ P P P P P P P P P PPP Sbjct: 37 HHRSSSPTQTTLQQLHSPDSPPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPPPLL 96 Query: 899 XXPXXXPXXXXP-XXXXLXPPXXP 967 P P P L PP P Sbjct: 97 PTPPPPPASISPTPAPPLPPPPAP 120 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 25.8 bits (54), Expect(2) = 1.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 349 PPPPPPPEPP 358 Score = 23.4 bits (48), Expect(2) = 1.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPP 957 PP PP PPPP Sbjct: 323 PPSNPPPAPPPPPPPP 338 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 803 SPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 S P PP P P L+P PP P P P PP P S Sbjct: 549 SESTPMQPPVMPPPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKS 606 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 1/59 (1%) Frame = +2 Query: 815 PXAPPAXXIPXPLPLTPRXXPGXPP-PXXXXPXXXPXXXXPXXXXLXPPXXPXXSXXXP 988 P AP A P P P PP P P P P PP P S P Sbjct: 569 PPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRP 627 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 758 RQAXDTVHDRLXPSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 R++ + D P P P APP P P+ P+ P PPP Sbjct: 1911 RESKSNLKDMAKPKQPP--PHAPPPPPPPPPVEGKPKPPPHAPPP 1953 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +1 Query: 886 PXXXXXSXPPXXXXXXXPPXPPPPXP 963 P PP PP PPPP P Sbjct: 133 PRGPGQEPPPPHVPKAAPPPPPPPPP 158 Score = 22.6 bits (46), Expect(2) = 2.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP P Sbjct: 152 PPPPPPPHAP 161 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 824 PPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P P P L+P P PPP P P P L P P Sbjct: 29 PTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTP 76 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 815 PXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P PP+ P P P P P PP P P PP P Sbjct: 179 PQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVP 229 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 PS P P PP P + P+ P PPP P P P P P Sbjct: 219 PSPPPPPPTVPPRTPGDTPAVVEPKPQP--PPPPPRAPVKMPRVLEPKPSPPPPSPLP 274 >03_02_0765 + 11000724-11002496 Length = 590 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 175 GAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGGGLGG 216 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 207 GAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGG 248 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXP---GXPPPXXXXPXXXPXXXXPXXXXLXPPXX 964 P+ + P PP P P P P P G PPP P P PP Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 Query: 965 P 967 P Sbjct: 381 P 381 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPP---PXXXXPXXXPXXXXPXXXXLXPPXX 964 P+ P P P A P P P P+ P PP P P P P PP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPP--PKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Query: 965 P 967 P Sbjct: 369 P 369 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 821 APPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXSXXXP 988 APP P P P P PPP P P P PP P P Sbjct: 312 APPPPPPPKPAAAAP---PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSP 364 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P P P PP P P P P+ PPP P P PP P Sbjct: 337 PPPPPKGPPPPPPAKGPPPPP-PPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 >02_05_0149 + 26290236-26290880 Length = 214 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG G Sbjct: 133 GGGGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGGGAG 174 >10_08_0214 - 15915156-15915713 Length = 185 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G GGG GG Sbjct: 78 GGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGGGGG 119 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 886 PXXXXXSXPPXXXXXXXPPXPPPPXPP 966 P + PP PP PPPP PP Sbjct: 65 PHHHVSAAPPPPQTPPSPPPPPPPPPP 91 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPPXXL 975 PP PP PPPP PP L Sbjct: 75 PPQTPPSPPPPPPPPPPPPPPL 96 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 74 PPPQTPPSPPPPPPPPPPP 92 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGGXVXPVEPXGXAG 804 GG GGGG G GG G GGG GG V G G Sbjct: 175 GGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGGGG 228 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG-GXVXPVEP 819 GG GGGG G G G + GGG G G V P P Sbjct: 300 GGGGGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGGGGGAGGVFPPTP 349 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG G G + GGG GG Sbjct: 102 GGYGGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGG 143 >06_01_0178 + 1386981-1387505 Length = 174 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGG 78 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 886 PXXXXXSXPPXXXXXXXPPXPPPPXPP 966 P + PP PP PPPP PP Sbjct: 11 PSPVAAAPPPPPVQVPVPPPPPPPLPP 37 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 886 PXXXXXSXPPXXXXXXXPPXPPPPXPP 966 P + PP PP PPPP PP Sbjct: 19 PPPATRARPPCSSAHLLPPPPPPPPPP 45 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXG 843 GG GGGG GG GG G GGG G Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 962 GXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G GGGG GG GG G GGG GG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLP---LTPRXXPGXPPP 892 PS +P P PP P P P P+ P PPP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 Query: 842 PXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXXS 976 P P P+ P P PPP P P PP P S Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPS 382 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPPXXLXXSXP 990 PP PP PPPP PP + P Sbjct: 38 PPPPPPPPPPPPPPPPPPPLEVVSPSP 64 >07_01_0015 + 108338-109186 Length = 282 Score = 25.8 bits (54), Expect(2) = 5.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXP 963 PP PP PPPP P Sbjct: 97 PPTVSICAPPPPPPPPPP 114 Score = 21.8 bits (44), Expect(2) = 5.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP P Sbjct: 108 PPPPPPPLLP 117 >10_08_0213 - 15912048-15912716 Length = 222 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 989 GXEXXXXXGGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 G E GG G GG GG G G GGG GG Sbjct: 33 GGEGGGGGGGGGSGGGGGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGG 82 >07_01_0080 + 587674-588510 Length = 278 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 806 PXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 P P PP+ P P P P P PPP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 95 PPPPPSSGSPPPPPPPPPP 113 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 96 PPPPSSGSPPPPPPPPPPP 114 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 97 PPPSSGSPPPPPPPPPPPP 115 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 98 PPSSGSPPPPPPPPPPPPP 116 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/67 (25%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 794 PSGSPXX--PXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 P+ +P P +PP P P P PPP P P P P P Sbjct: 47 PNATPADTTPTSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPP 106 Query: 968 XXSXXXP 988 + P Sbjct: 107 TTTTTTP 113 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/65 (24%), Positives = 19/65 (29%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPXX 973 P+ P PP P P P+ P PP P P P P P Sbjct: 228 PTYKPQPKPNPPPTYKPAPPTYKPQPKPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTP 287 Query: 974 SXXXP 988 + P Sbjct: 288 TPYTP 292 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 Query: 797 SGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 +G+P P A PA P P +P P P P P PP P Sbjct: 318 TGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPP 374 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 794 PSGSPXXPXAPPAXXIPXPLPLTPRXXPGXPPP 892 P P P PP P P P P G PPP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPP 371 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 356 PPPPPPPPPPPPPPPPRPP 374 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 361 PPPPPPPPPPPRPPPPPPP 379 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 886 PXXXXXSXPPXXXXXXXPPXPPPPXPP 966 P PP PP PPPP PP Sbjct: 405 PRNPFVQPPPPPTHTHGPPPPPPPPPP 431 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 414 PPPTHTHGPPPPPPPPPPP 432 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 415 PPTHTHGPPPPPPPPPPPP 433 >01_01_0570 - 4231100-4232560 Length = 486 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGG GG GG G GGG GG Sbjct: 257 GGGAGGGMGGDIGGGAGGGVGGGGGGGMGGGGGFGGGGGVGG 298 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 25.8 bits (54), Expect(2) = 6.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 43 PPPPPPPKPP 52 Score = 21.4 bits (43), Expect(2) = 6.6 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 904 SXPPXXXXXXXPPXPPPP 957 S PP PP PP P Sbjct: 19 SAPPPSSSSPSPPVPPDP 36 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 28.7 bits (61), Expect = 7.6 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 803 SPXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXPXXXXPXXXXLXPPXXP 967 S P PP P P PL P PPP P P P PP P Sbjct: 193 SDPAPPTPPTIARP-PRPLPPA---SPPPPSIATPPPSPASPPPPSTATPPPPSP 243 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 28.7 bits (61), Expect = 7.6 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 806 PXXPXAPPAXXIPXPL--PLTPRXX---PGXPPPXXXXPXXXPXXXXPXXXXLXPPXXPX 970 P PPA P P PLTP P PPP P P PP P Sbjct: 49 PLPTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPPTPAIAVPPALPP 108 Query: 971 XSXXXP 988 P Sbjct: 109 IPAIVP 114 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 257 PPPQSVRPPPPPPPPPPPP 275 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 258 PPQSVRPPPPPPPPPPPPP 276 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 94 PPSPPLLALPPPPPPPPPP 112 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 97 PPLLALPPPPPPPPPPPPP 115 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 152 PPCGDANENPPPPPPPPPP 170 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 56 PPPPRTLPPPPPPPPPQPP 74 >06_03_1506 + 30641428-30642168 Length = 246 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG GG GG G GGG GG Sbjct: 65 GGVGGGGYGGGGGYGSGGGEGNGAY-GQGYGYGSGNGGGGGG 105 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 117 GGYGGGGYEGYGRGYGGGGGGGGYGGGGYPGGGYYGGGGGGG 158 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 4 PPAATAPPPPPPPPPPPPP 22 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 19 PPAPAPVPPPPPPPPPPPP 37 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 40 PPARHRAPSPPRPPPPPPP 58 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 965 GGXGGGGXGGXXXXXXXGGXXXXXXXGXXXXXXEXXGGGXGG 840 GG GGGG G GG G GGG GG Sbjct: 113 GGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGG 154 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 761 QAXDTVHDRLXPSGS-PXXPXAPPAXXIPXPLPLTPRXXPGXPPPXXXXPXXXP 919 QA H + GS P P PP+ LP + P PPP P P Sbjct: 54 QAMYQAHPQYPMPGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVP 107 >02_04_0001 - 18816492-18816741,18816881-18817050,18817244-18817388, 18817495-18817565,18817910-18817993,18818103-18818222, 18818310-18818480,18818955-18819044,18821893-18821985, 18822073-18822405 Length = 508 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PPXXXXXXXPPXPPPPXPP 966 PP PP PPPP PP Sbjct: 38 PPEGAGDVSPPSPPPPPPP 56 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 25.8 bits (54), Expect(2) = 7.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 31 PPPPPPPPPP 40 Score = 21.4 bits (43), Expect(2) = 7.7 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 904 SXPPXXXXXXXPPXPPPP 957 S P PP PPPP Sbjct: 22 SSPTSSSSSPPPPPPPPP 39 >04_04_0057 + 22410167-22411330 Length = 387 Score = 23.8 bits (49), Expect(2) = 8.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 940 PXPPPPXPPXXL 975 P PPPP PP L Sbjct: 206 PSPPPPPPPHAL 217 Score = 23.0 bits (47), Expect(2) = 8.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 937 PPXPPPPXP 963 PP PPPP P Sbjct: 181 PPPPPPPPP 189 >08_02_0937 + 22801526-22802461 Length = 311 Score = 24.6 bits (51), Expect(2) = 8.9 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 940 PXPPPPXPPXXLXXS 984 P PPPP PP L S Sbjct: 73 PPPPPPPPPGFLSDS 87 Score = 22.2 bits (45), Expect(2) = 8.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP P Sbjct: 33 PPPPPPPSRP 42 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 25.8 bits (54), Expect(2) = 9.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 937 PPXPPPPXPP 966 PP PPPP PP Sbjct: 46 PPPPPPPPPP 55 Score = 21.0 bits (42), Expect(2) = 9.4 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 946 PPPPXPPXXLXXSXP 990 PPPP PP + P Sbjct: 47 PPPPPPPPPRAAAAP 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,862,183 Number of Sequences: 37544 Number of extensions: 332240 Number of successful extensions: 5548 Number of sequences better than 10.0: 79 Number of HSP's better than 10.0 without gapping: 1612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3975 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2905255520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -