Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_K04
         (994 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.                27   0.26 
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    21   3.0  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   5.7  

>AB183889-1|BAD86829.1|  316|Apis mellifera Mos protein.
          Length = 316

 Score = 27.1 bits (57), Expect = 0.26
 Identities = 9/36 (25%), Positives = 18/36 (50%)
 Frame = +2

Query: 335 TPINFGSXDSXDIVRDCFPVECRLIFAENXIXLMYK 442
           +P N  + +   I++D FP++C          ++YK
Sbjct: 48  SPFNIDTPNRQKILKDGFPIKCGTFLGSGGFGIVYK 83


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 20.6 bits (41), Expect(2) = 3.0
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +1

Query: 937  PPXPPPP 957
            PP PPPP
Sbjct: 1355 PPPPPPP 1361



 Score = 20.6 bits (41), Expect(2) = 3.0
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = +1

Query: 946  PPPPXPP 966
            PPPP PP
Sbjct: 1356 PPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 22.6 bits (46), Expect = 5.7
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 937 PPXPPPPXPP 966
           PP P PP PP
Sbjct: 338 PPKPAPPPPP 347


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,076
Number of Sequences: 438
Number of extensions: 3420
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 32895408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)