BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_K01 (958 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 79 7e-15 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 7e-15 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 5e-13 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 60 3e-09 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 52 7e-07 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 52 9e-07 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 44 2e-04 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 42 6e-04 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 42 6e-04 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 42 6e-04 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 42 6e-04 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 42 6e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 42 7e-04 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 42 7e-04 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 41 0.001 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 41 0.001 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 40 0.003 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 40 0.003 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 40 0.004 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 39 0.005 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 39 0.007 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 38 0.009 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 38 0.009 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 38 0.009 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 38 0.009 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 38 0.009 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 38 0.009 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 38 0.009 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 38 0.009 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 38 0.009 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 38 0.009 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 38 0.009 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 38 0.009 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 38 0.009 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 38 0.009 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 38 0.009 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 38 0.009 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 38 0.009 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 38 0.009 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.009 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 38 0.009 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 38 0.009 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 38 0.009 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 38 0.009 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 38 0.009 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 38 0.009 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 38 0.009 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 38 0.009 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 38 0.009 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 38 0.009 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 38 0.009 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 38 0.009 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 38 0.009 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 38 0.009 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 38 0.009 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 38 0.009 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 38 0.009 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 38 0.009 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 38 0.009 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 38 0.009 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 38 0.009 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 38 0.009 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 38 0.009 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 38 0.009 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 38 0.009 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 38 0.009 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 38 0.009 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 38 0.009 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 38 0.009 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 38 0.009 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 38 0.009 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 38 0.009 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 38 0.009 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 38 0.009 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 38 0.009 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 38 0.009 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 38 0.009 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 38 0.009 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 38 0.009 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 38 0.009 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 38 0.009 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 38 0.009 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 38 0.009 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 38 0.009 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 38 0.009 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 38 0.009 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 38 0.009 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 38 0.009 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.009 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 38 0.009 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 38 0.009 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 38 0.009 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 38 0.009 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 38 0.009 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 38 0.009 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 38 0.009 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 38 0.009 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 38 0.009 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 38 0.009 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 38 0.009 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 38 0.009 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 38 0.009 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 38 0.009 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 38 0.009 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 38 0.009 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 38 0.009 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 38 0.009 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 38 0.009 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 38 0.009 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 38 0.009 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 38 0.009 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 38 0.009 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 38 0.009 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 38 0.009 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 38 0.009 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 38 0.009 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 38 0.009 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 38 0.009 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 38 0.009 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 38 0.009 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 93.5 bits (222), Expect = 2e-19 Identities = 46/63 (73%), Positives = 47/63 (74%) Frame = -3 Query: 560 RGGGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSX 381 RGGG+ K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS Sbjct: 758 RGGGA-YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSA 816 Query: 380 ASQ 372 ASQ Sbjct: 817 ASQ 819 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 92.7 bits (220), Expect = 4e-19 Identities = 44/61 (72%), Positives = 44/61 (72%) Frame = -3 Query: 554 GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSXAS 375 GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS AS Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 60 Query: 374 Q 372 Q Sbjct: 61 Q 61 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 92.7 bits (220), Expect = 4e-19 Identities = 44/61 (72%), Positives = 44/61 (72%) Frame = -3 Query: 554 GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSXAS 375 GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS AS Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 83 Query: 374 Q 372 Q Sbjct: 84 Q 84 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 92.7 bits (220), Expect = 4e-19 Identities = 44/61 (72%), Positives = 44/61 (72%) Frame = -3 Query: 554 GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSXAS 375 GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS AS Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 465 Query: 374 Q 372 Q Sbjct: 466 Q 466 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 92.7 bits (220), Expect = 4e-19 Identities = 44/61 (72%), Positives = 44/61 (72%) Frame = -3 Query: 554 GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSXAS 375 GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS AS Sbjct: 23 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 82 Query: 374 Q 372 Q Sbjct: 83 Q 83 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 91.1 bits (216), Expect = 1e-18 Identities = 45/73 (61%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -3 Query: 590 GGVDFXXXSCRG-GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXEL 414 G ++ RG GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP EL Sbjct: 542 GAIEHVLFVLRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSEL 601 Query: 413 IPLXXXEXPSXAS 375 IPL E PS A+ Sbjct: 602 IPLAAAERPSAAT 614 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 91.1 bits (216), Expect = 1e-18 Identities = 43/61 (70%), Positives = 43/61 (70%) Frame = -3 Query: 554 GGSPMEKRPXTXRLYGSWPFAGLLLTXSFLRYPLILWITVLPPXXELIPLXXXEXPSXAS 375 GG K P T YGSWPFAGLLLT SFLRYPLILWITVLPP ELIPL E PS A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 374 Q 372 Q Sbjct: 61 Q 61 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 78.6 bits (185), Expect = 7e-15 Identities = 37/44 (84%), Positives = 37/44 (84%) Frame = +3 Query: 300 CINESANARGXAVCVLGALPXPRSLTRXARXFGXGERYQLXXRR 431 CINESANARG AVCVLGALP PRSLTR AR FG GERYQL RR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 78.6 bits (185), Expect = 7e-15 Identities = 37/44 (84%), Positives = 37/44 (84%) Frame = +3 Query: 300 CINESANARGXAVCVLGALPXPRSLTRXARXFGXGERYQLXXRR 431 CINESANARG AVCVLGALP PRSLTR AR FG GERYQL RR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 74.5 bits (175), Expect = 1e-13 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXEXAD 412 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E D Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 72.5 bits (170), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 71.3 bits (167), Expect = 1e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA + Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 71.3 bits (167), Expect = 1e-12 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = -2 Query: 558 GGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXEXADT 409 GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E ++ Sbjct: 93 GGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYTNS 141 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 71.3 bits (167), Expect = 1e-12 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = -2 Query: 567 LVQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 L GGR + + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 56 LNSGGRSLW-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 70.9 bits (166), Expect = 1e-12 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -2 Query: 555 GREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 G EP + A N AF+R LAFCWPFAH FFPALSP SVDNRITA E Sbjct: 18 GAEPM-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 537 ETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 + A N AF+R LAFCWPFAH F+PALSP SVDNRITA E Sbjct: 7 KNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.1 bits (144), Expect = 6e-10 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = -2 Query: 564 VQGGREPYGETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXE 421 V GGR + + A N AF+R LAF WPFAH FF ALSP VDNRITA E Sbjct: 15 VSGGRSLW-KNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 59.7 bits (138), Expect = 3e-09 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = -2 Query: 537 ETAXNXAFVRXLAFCWPFAHXFFPALSPXSVDNRITAXEXADTAXXXR 394 + A N AF+R LAFCWPF H F PALSP SVD ITA E D A R Sbjct: 7 KNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSR 54 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 52.0 bits (119), Expect = 7e-07 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +3 Query: 447 QNXGITQERXCEQKASKRPGXVQTPRXWPF 536 +N GITQER CEQKASKRPG V+ PR W F Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRF 143 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 51.6 bits (118), Expect = 9e-07 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +3 Query: 450 NXGITQERXCEQKASKRPGXVQTPRXWPF 536 N GITQER CEQKASKRPG V+ PR W F Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRF 114 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/109 (26%), Positives = 34/109 (31%) Frame = +3 Query: 630 PXAFSPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXX 809 P +P P P P S +P PPP P PP Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP--YPPPLYPPPPNPPPPNAPYP 175 Query: 810 PPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXPTXLHXXXPP 956 PPP P P PPP P+ P PP+ P P + PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 47.2 bits (107), Expect = 2e-05 Identities = 29/109 (26%), Positives = 34/109 (31%) Frame = +3 Query: 630 PXAFSPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXX 809 P P P A P+ P P PPP P PP Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP--PPNPPPPNAPYPPPPYPPPP 183 Query: 810 PPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXPTXLHXXXPP 956 PP P P PPP P+ P P PP+ +P P + PP Sbjct: 184 NPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/84 (28%), Positives = 26/84 (30%) Frame = +3 Query: 678 PTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPX 857 P PL P PPP P PP PPP P P P P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP-PNAPNPPPPNPP 210 Query: 858 XXPHAXGPXPXXXXPPSXXSPXXP 929 P P P PP+ +P P Sbjct: 211 YPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/78 (28%), Positives = 25/78 (32%) Frame = +3 Query: 723 PPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXPXXXXP 902 PP +P PP PP P P PPP P+ P P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP--PPPNAPYP 141 Query: 903 PSXXSPXXPTXLHXXXPP 956 PS +P P PP Sbjct: 142 PSPNAPYPPPPNPPYPPP 159 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/82 (26%), Positives = 24/82 (29%), Gaps = 2/82 (2%) Frame = +3 Query: 717 PLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXP--PPXXXPHAXGPXPX 890 P PPP P PP PP P P P P P+ P P Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPL 160 Query: 891 XXXPPSXXSPXXPTXLHXXXPP 956 PP+ P P PP Sbjct: 161 YPPPPNPPPPNAPYPPPPYPPP 182 Score = 33.5 bits (73), Expect = 0.26 Identities = 26/92 (28%), Positives = 30/92 (32%) Frame = +1 Query: 682 PXRLPXPXPXXPPFPPXXEXXXXXXXXXXXXSAXPXLXLXXPXPPPXLGVXCXXXPPRXP 861 P P P P PP+PP +A P PPP PP P Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSP-----NAPYPPPPNPPYPPPLY-----PPPPNPP 168 Query: 862 PHTRLAPFPXNXXPLLTXHPXXPPNSXSLXPP 957 P AP+P P P PP + PP Sbjct: 169 PPN--APYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 31.9 bits (69), Expect = 0.79 Identities = 24/89 (26%), Positives = 26/89 (29%), Gaps = 1/89 (1%) Frame = +3 Query: 645 PRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXP 824 P P L P P + P PPP P PP PPP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYP-PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 825 RGXXXPXPP-PXXXPHAXGPXPXXXXPPS 908 P P P P P P PP+ Sbjct: 210 PYPPPPNAPNPPYPPPPNAPNPPYPPPPN 238 Score = 30.7 bits (66), Expect = 1.8 Identities = 24/90 (26%), Positives = 26/90 (28%), Gaps = 2/90 (2%) Frame = +1 Query: 694 PXPXPXXPPFPPXXEXXXXXXXXXXXXSAXPXLXLXXP--XPPPXLGVXCXXXPPRXPPH 867 P P P PP+PP P P PPP P PP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP- 151 Query: 868 TRLAPFPXNXXPLLTXHPXXPPNSXSLXPP 957 P P PL P PP + PP Sbjct: 152 ----PNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 29.1 bits (62), Expect = 5.6 Identities = 24/88 (27%), Positives = 27/88 (30%) Frame = +1 Query: 694 PXPXPXXPPFPPXXEXXXXXXXXXXXXSAXPXLXLXXPXPPPXLGVXCXXXPPRXPPHTR 873 P P P PP+PP P P PPP PP PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP------PYPPPP-------NPPYPPPPNP 193 Query: 874 LAPFPXNXXPLLTXHPXXPPNSXSLXPP 957 P P N +P PP + PP Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = +1 Query: 229 KQVNNNNCIHFMFXVQGEVW------EVFSALMNRPTRGXRRFAYW 348 + ++ N C+ F GE++ V +ALMNRPTRG RRFAYW Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYW 147 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 183 ICDTGYIPLPRSLTRYARSFDCGER 207 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM 478 VVR AVSA S AVIRLSTE GDNAGK M Sbjct: 72 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM 478 VVR AVSA S AVIRLSTE GDNAGK M Sbjct: 594 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM 478 VVR AVSA S AVIRLSTE GDNAGK M Sbjct: 26 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 55 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM 478 VVR AVSA S AVIRLSTE GDNAGK M Sbjct: 21 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM 478 VVR AVSA S AVIRLSTE GDNAGK M Sbjct: 159 VVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +3 Query: 702 LSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPXXXPHAXGP 881 +S P PPP P PP PPP P P PPP P A P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 882 XPXXXXPP 905 P PP Sbjct: 423 PPPPPPPP 430 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = +3 Query: 714 SPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXPXX 893 SP PPP P PP PPP P P PPP P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP---PPPPPPPPPPPPPPPPPPAP 420 Query: 894 XXPPSXXSPXXPTXLHXXXPP 956 PP P P PP Sbjct: 421 PPPPPPPPPPPPALRLACAPP 441 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/79 (26%), Positives = 23/79 (29%) Frame = +3 Query: 717 PLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXPXXX 896 P PPP +P P PPP P P PPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 897 XPPSXXSPXXPTXLHXXXP 953 PP+ P L P Sbjct: 430 PPPALRLACAPPRLRFTSP 448 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 642 SPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPX 821 SP P P+ P SP PPP P PP PPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP----PPPPPPPPPPPPPPPPPPPPPA 419 Query: 822 PRGXXXPXPPP 854 P P PPP Sbjct: 420 PPPPPPPPPPP 430 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 805 PXPPPXLGVXCXXXPPRXPPHTRLAPFPXNXXPLLTXHPXXPPNSXSLXPP 957 P PPP PP PP + P P P P PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGKXM*AK 487 VVR AVSA S AVIRLSTE GDNAGK + A+ Sbjct: 21 VVRLRRAVSAHSKAVIRLSTESGDNAGKNIDAE 53 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 467 VVRLRRAVSAHSKAVIRLSTESGDNAGK 494 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 80 VVRLRRAVSAHSKAVIRLSTESGDNAGK 107 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 328 VVRLRRAVSAHSKAVIRLSTESGDNAGK 355 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 55 VVRLRRAVSAHSKAVIRLSTESGDNAGK 82 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 228 VVRLRRAVSAHSKAVIRLSTESGDNAGK 255 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 273 VVRLRRAVSAHSKAVIRLSTESGDNAGK 300 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 18 VVRLRRAVSAHSKAVIRLSTESGDNAGK 45 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 282 VVRLRRAVSAHSKAVIRLSTESGDNAGK 309 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR AVSA S AVIRLSTE GDNAGK Sbjct: 88 VVRLRRAVSAHSKAVIRLSTESGDNAGK 115 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/72 (36%), Positives = 29/72 (40%) Frame = -1 Query: 928 GXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRRXXRXGEGGR 749 G G+ +GG G G G GGG G G GGG GG G G GG Sbjct: 771 GGGGDGGDGG----GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGD 826 Query: 748 XRGVXXGGGRGE 713 G GGG G+ Sbjct: 827 GGGYGDGGGFGD 838 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/80 (33%), Positives = 29/80 (36%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRR 776 GG G G +G G G G +GGG G G GGG GG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Query: 775 XXRXGEGGRXRGVXXGGGRG 716 G GG G GGG G Sbjct: 853 GGGGGGGGGGGGGGGGGGGG 872 Score = 36.3 bits (80), Expect = 0.037 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRR 776 GG G G GG G G G +GGG G G GGG GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 775 XXRXGEGGRXRGVXXGGGRG 716 G G G G G G Sbjct: 830 YGDGGGFGDGGGYADGDGGG 849 Score = 35.9 bits (79), Expect = 0.049 Identities = 23/63 (36%), Positives = 26/63 (41%) Frame = -1 Query: 886 GXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRRXXRXGEGGRXRGVXXGGGRGEXX 707 G G G +GGG G G GGG GG G G+GG G GGG G+ Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG-----DGDGGGGGGGGGGGGGGDGG 828 Query: 706 XRG 698 G Sbjct: 829 GYG 831 Score = 35.1 bits (77), Expect = 0.085 Identities = 26/80 (32%), Positives = 27/80 (33%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRR 776 GG G G +GG G G G GGG G G G G GG Sbjct: 787 GGGGGGGGGGGGGGGGDGGG--YGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYAD 844 Query: 775 XXRXGEGGRXRGVXXGGGRG 716 G GG G GGG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGG 864 Score = 34.7 bits (76), Expect = 0.11 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGG---GXGXXXPRGXGGGXXXVTGGX 785 GG G G+ GG G G G GG G G G GGG GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGY 830 Query: 784 GRRXXRXGEGGRXRGVXXGGGRG 716 G GG G GGG G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGG 853 Score = 33.9 bits (74), Expect = 0.20 Identities = 25/80 (31%), Positives = 26/80 (32%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRR 776 GG G G GG G G GGG G G GGG G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Query: 775 XXRXGEGGRXRGVXXGGGRG 716 G+GG G GGG G Sbjct: 841 GYADGDGGGGGGGGGGGGGG 860 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 853 GGGXGXXXPRGXGGGXXXVTGGXGRRXXRXGEGGRXRGVXXGGGRG 716 GGG G G GGG GG G G GG G G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = -1 Query: 955 GGXXXWSXVGXXGEXXEGGXCXXGXGPXACGXXNGGGXGXXXPRGXGGGXXXVTGGXGRR 776 GG G G GG G G +GGG G GGG GG G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Query: 775 XXRXGEGGRXRGV 737 G GG GV Sbjct: 865 GGGGGGGGGGGGV 877 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 865 GXXNGGGXGXXXPRGXGGGXXXVTGGXGRRXXRXGEGGRXRGVXXGGGRG 716 G GG G G GGG GG G GG G GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +1 Query: 205 FVTIISCNKQVN--NNNCIHFMFXVQGEVWEVFSALMNRPTRGXRRFAYW 348 F +I++ + N N C +M V V V +ALMNRPTRG RRFAYW Sbjct: 51 FCSILAPEIETNFSTNRCRRYMATVGKPV--VPAALMNRPTRGERRFAYW 98 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 41.1 bits (92), Expect = 0.001 Identities = 33/118 (27%), Positives = 38/118 (32%), Gaps = 2/118 (1%) Frame = +3 Query: 609 PXGLSTIPXAFSPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXX 788 P S+ P P PS+ L P P PLP P Sbjct: 208 PPERSSGPPPPPPGRGPSQRSLAPP-----PTGSSRPLPAPPPGENRPPPPMRGPTSGGE 262 Query: 789 PPVTXXXPPPXPRGXXXPXPPPXXXPHAXG-PXPXXXXPPS-XXSPXXPTXLHXXXPP 956 PP PPP RG P PPP P + PPS +P P L+ PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPP 320 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 789 PPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXP 929 PP+ PPP P P PPP P P PP+ P Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 358 Score = 29.9 bits (64), Expect = 3.2 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 3/96 (3%) Frame = +3 Query: 678 PTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPX 857 P P S PPP T R PP P P P P PPP Sbjct: 265 PPKNAPPPPKRGSSNPPPPPT-RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Query: 858 XXPHAXGPXP---XXXXPPSXXSPXXPTXLHXXXPP 956 P P PP PT PP Sbjct: 324 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 5/73 (6%) Frame = +3 Query: 717 PLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRG-----XXXPXPPPXXXPHAXGP 881 PLPPP P P T PPP P P PPP P + Sbjct: 329 PLPPP---PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKI 385 Query: 882 XPXXXXPPSXXSP 920 P PP+ P Sbjct: 386 NPPPPPPPAMDKP 398 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 41.1 bits (92), Expect = 0.001 Identities = 33/118 (27%), Positives = 38/118 (32%), Gaps = 2/118 (1%) Frame = +3 Query: 609 PXGLSTIPXAFSPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXX 788 P S+ P P PS+ L P P PLP P Sbjct: 120 PPERSSGPPPPPPGRGPSQRSLAPP-----PTGSSRPLPAPPPGENRPPPPMRGPTSGGE 174 Query: 789 PPVTXXXPPPXPRGXXXPXPPPXXXPHAXG-PXPXXXXPPS-XXSPXXPTXLHXXXPP 956 PP PPP RG P PPP P + PPS +P P L+ PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPP 232 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 789 PPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXP 929 PP+ PPP P P PPP P P PP+ P Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 270 Score = 29.9 bits (64), Expect = 3.2 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 3/96 (3%) Frame = +3 Query: 678 PTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPPX 857 P P S PPP T R PP P P P P PPP Sbjct: 177 PPKNAPPPPKRGSSNPPPPPT-RGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Query: 858 XXPHAXGPXP---XXXXPPSXXSPXXPTXLHXXXPP 956 P P PP PT PP Sbjct: 236 SRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Score = 28.7 bits (61), Expect = 7.4 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 5/73 (6%) Frame = +3 Query: 717 PLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRG-----XXXPXPPPXXXPHAXGP 881 PLPPP P P T PPP P P PPP P + Sbjct: 241 PLPPP---PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKI 297 Query: 882 XPXXXXPPSXXSP 920 P PP+ P Sbjct: 298 NPPPPPPPAMDKP 310 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 223 CNKQVNNNNCIHFMFXVQGEVWE--VFSALMNRPTRGXRRFAYW 348 C ++NN N + + V + V +ALMNRPTRG RRFAYW Sbjct: 37 CTLELNNMNTLTEYVILSVVVGKPVVPAALMNRPTRGERRFAYW 80 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 5/44 (11%) Frame = +1 Query: 232 QVNNNNCIHFMFXVQ---GEVWE--VFSALMNRPTRGXRRFAYW 348 +++NNN I + V G V + V +ALMNRPTRG RRFAYW Sbjct: 42 ELDNNNTIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 85 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGER 145 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = +1 Query: 172 FICEICDAIALFVTIISCNKQVNNNNCIHFMFXVQGEVWE---VFSALMNRPTRGXRRFA 342 F+C + ++ + I CN ++ + FM + + V +ALMNRPTRG RRFA Sbjct: 172 FVCNMLLSMGTMLLFI-CNMMLSMGTMLLFMCNMLLSMVGKPVVPAALMNRPTRGERRFA 230 Query: 343 YW 348 YW Sbjct: 231 YW 232 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = +1 Query: 214 IISCNKQVNNNNCIHFMFXVQ---GEVWE--VFSALMNRPTRGXRRFAYW 348 I + NK ++ NN I + V G V + V +ALMNRPTRG RRFAYW Sbjct: 1648 IQASNKMLSINNKIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 1697 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 389 VVRXXXAVSAXSXAVIRLSTEXGDNAGK 472 VVR A SA S AVIRLSTE GDNAGK Sbjct: 21 VVRLRRAESAHSKAVIRLSTESGDNAGK 48 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 4/90 (4%) Frame = +3 Query: 699 PLSXXSPLPPPXXTPRXXXXXXXXXXXXXXP--PVTXXXPPPXP--RGXXXPXPPPXXXP 866 P+ S P P PR P P T PPP P P PPP P Sbjct: 100 PMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Query: 867 HAXGPXPXXXXPPSXXSPXXPTXLHXXXPP 956 GP P P+ P L PP Sbjct: 160 ATGGPPPPPPIAPAATVPAPAVPLAAASPP 189 Score = 34.7 bits (76), Expect = 0.11 Identities = 30/107 (28%), Positives = 34/107 (31%), Gaps = 2/107 (1%) Frame = +3 Query: 642 SPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPX 821 +P A S A P +P PPP P P T PPP Sbjct: 99 TPMVAQSVAPTPPPPPRAPETPSQAPSPPP---PPTSPATRAPPPPPPIAPATGGPPPPP 155 Query: 822 P--RGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXPTXLHXXXPP 956 P P PPP P A P P P + SP P+ PP Sbjct: 156 PIAPATGGPPPPPPIAPAATVPAP--AVPLAAASPPPPSGGPPPPPP 200 Score = 33.9 bits (74), Expect = 0.20 Identities = 27/103 (26%), Positives = 29/103 (28%) Frame = +3 Query: 621 STIPXAFSPRXAPSRALLXPTXXLTXPLSXXSPLPPPXXTPRXXXXXXXXXXXXXXPPVT 800 S P P AP P+ P S + PPP P P T Sbjct: 105 SVAPTPPPPPRAPETPSQAPSPP-PPPTSPATRAPPPP--PPIAPATGGPPPPPPIAPAT 161 Query: 801 XXXPPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXP 929 PPP P P P A P P PP P P Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 717 PLPPPXXTPRXXXXXXXXXXXXXXPPVTXXXPPPXPRGXXXPXPPP 854 P PPP P PP PPP P P PPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +1 Query: 805 PXPPPXLGVXCXXXPPRXPPHTRLAPFPXNXXPLLTXHPXXPPNSXSLXPP 957 P PPP + PP PP A P PL P PP S PP Sbjct: 151 PPPPPPIA-PATGGPPPPPPIAPAATVPAPAVPLAAASP--PPPSGGPPPP 198 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Frame = +1 Query: 226 NKQVNNNNCIHFMFXVQG-EVWE--VFSALMNRPTRGXRRFAYW 348 N Q+ + +H +F +G V + V +ALMNRPTRG RRFAYW Sbjct: 161 NDQIISGLRLHNLFYRKGIRVGKPVVPAALMNRPTRGERRFAYW 204 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/40 (55%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +1 Query: 235 VNNNNCIHF--MFXVQGEVWEVFSALMNRPTRGXRRFAYW 348 + CI F +F V V V +ALMNRPTRG RRFAYW Sbjct: 124 IKRQPCISFTRIFRVGKPV--VPAALMNRPTRGERRFAYW 161 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 197 ICDTGYIPLPRSLTRYARSFDCGER 221 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +1 Query: 289 EVFSALMNRPTRGXRRFAYW 348 +V +ALMNRPTRG RRFAYW Sbjct: 5 DVPAALMNRPTRGERRFAYW 24 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F ER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCRER 84 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 5/46 (10%) Frame = +1 Query: 226 NKQVNNNNCIHFMFXVQ---GEVWE--VFSALMNRPTRGXRRFAYW 348 N +VN ++ I + V G V + V +ALMNRPTRG RRFAYW Sbjct: 111 NHEVNESDFIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 156 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 121 AALMNRPTRGERRFAYW 137 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGER 196 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGER 320 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGER 145 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGER 170 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 154 AALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGER 127 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGER 275 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGER 417 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGER 272 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGER 172 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGER 635 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 271 AALMNRPTRGERRFAYW 287 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGER 391 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGER 234 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGER 192 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 828 GXXXPXPPPXXXPHAXGPXPXXXXPPSXXSPXXPTXLH 941 G P PPP P P P PP P PT LH Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 789 PPVTXXXPPPXPRGXXXPXPPPXXXPHAXGPXP 887 PP PPP P P PPP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 810 PPPXPRGXXXPXPPPXXXPHAXGPXPXXXXPPSXXSP 920 PPP P P PPP P P P PP +P Sbjct: 464 PPPPPPPPPPPPPPPPPPP----PPPPPFPPPPPPTP 496 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGER 118 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 476 AALMNRPTRGERRFAYW 492 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGER 203 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGER 126 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGER 161 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 5505 AALMNRPTRGERRFAYW 5521 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGER 177 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGER 87 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGER 624 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 162 AALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 648 AALMNRPTRGERRFAYW 664 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGER 195 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 169 AALMNRPTRGERRFAYW 185 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGER 120 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGER 141 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGER 163 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGER 140 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGER 129 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 54 AALMNRPTRGERRFAYW 70 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 357 AALMNRPTRGERRFAYW 373 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGER 154 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGER 123 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGER 261 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGER 652 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGER 374 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGER 147 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGER 878 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 581 AALMNRPTRGERRFAYW 597 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 137 AALMNRPTRGERRFAYW 153 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGER 263 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGER 162 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGER 563 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGER 108 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 145 AALMNRPTRGERRFAYW 161 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGER 1008 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGER 134 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGER 176 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGER 513 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGER 146 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 424 AALMNRPTRGERRFAYW 440 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGER 309 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 240 AALMNRPTRGERRFAYW 256 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 200 AALMNRPTRGERRFAYW 216 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 143 AALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 752 AALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGER 128 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGER 98 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 117 AALMNRPTRGERRFAYW 133 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGER 218 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGER 303 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGER 129 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGER 177 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 136 AALMNRPTRGERRFAYW 152 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 178 AALMNRPTRGERRFAYW 194 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGER 179 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGER 147 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 115 AALMNRPTRGERRFAYW 131 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 73 AALMNRPTRGERRFAYW 89 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGER 1019 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGER 166 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGER 499 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 105 ICDTGYIPLPRSLTRYARTFDCGER 129 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGER 181 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 183 AALMNRPTRGERRFAYW 199 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGER 547 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGER 154 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGER 545 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGER 167 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGER 169 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGER 176 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 336 VCVLGALPXPRSLTRXARXFGXGER 410 +C G +P PRSLTR AR F GER Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGER 315 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 298 SALMNRPTRGXRRFAYW 348 +ALMNRPTRG RRFAYW Sbjct: 150 AALMNRPTRGERRFAYW 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,820,054 Number of Sequences: 59808 Number of extensions: 388869 Number of successful extensions: 4032 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2948 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -